F468676

General Info

Members Datasets Scaffolds Average Seq Length
607 266 607 312

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10011754|Ga0105245_100117543
Length 363
Sequence MDQITPSHIPVSFANFAVTIFCCSRPLPSSPVTVTLELNPTFVSPEASMANAAKYVWLDDELKDAATSGVPIVNAGLHYGYTVFEGIRSYATDRGPAVFRLEEHVDRLLDSALILGFRNLPWTRNTLIDAIHKTIAANNFSACYIRPVIYLDGAMDLVVDSGKPRLIIAVWEWTAFLGEEAKERGIRANIASFTRLHPNIMMTKAKVAGNYVSSILAKTESQRAGFDEAIMLDPQGYVAECTGENIFVVRNNVIYTPGRGAILEGITRDALITLAQDLGHTVVEEQISRDQLYIADEVFVCGTAAEVVGLREIDFRTIGSGKTGPVTRALQAEFDKLTSGRHARSAAWFSPVPAFDPALVGAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
179 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.45
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1245215 2162886007 Bacteria 9543
2 JGI24752J21851_1000560 3300001976 Bacteria 4946
3 JGI24034J26672_10000532 3300002239 Bacteria 4880
4 Ga0058859_10006034 3300004798 Bacteria 2818
5 Ga0058859_11031243 3300004798 Unclassified 1499
6 Ga0058860_10158606 3300004801 Bacteria 4438
7 Ga0058860_12212553 3300004801 Unclassified 1402
8 Ga0065704_10001431 3300005289 Bacteria 13768
9 Ga0065704_10246315 3300005289 Unclassified 1001
10 Ga0065712_10129045 3300005290 Bacteria 1572
11 Ga0065715_10013113 3300005293 Bacteria 3695
12 Ga0065715_10243287 3300005293 Bacteria 1192
13 Ga0065707_10000488 3300005295 Bacteria 36380
14 Ga0065707_10086750 3300005295 Bacteria 5323
15 Ga0065707_10102424 3300005295 Bacteria 2806
16 Ga0065707_10114550 3300005295 Bacteria 2294
17 Ga0070676_10106280 3300005328 Bacteria 1741
18 Ga0070683_100013067 3300005329 Bacteria 7230
19 Ga0070683_100025703 3300005329 Bacteria 5292
20 Ga0070690_100027145 3300005330 Bacteria 3538
21 Ga0070690_100060911 3300005330 Bacteria 2430
22 Ga0070670_100062868 3300005331 Bacteria 3186
23 Ga0070666_10059317 3300005335 Bacteria 2588
24 Ga0070680_100052867 3300005336 Bacteria 3315
25 Ga0070682_100044751 3300005337 Unclassified 2741
26 Ga0068868_100002535 3300005338 Bacteria 12686
27 Ga0068868_100006574 3300005338 Bacteria 8237
28 Ga0068868_100077507 3300005338 Bacteria 2659
29 Ga0070689_100079513 3300005340 Bacteria 2572
30 Ga0070691_10027846 3300005341 Bacteria 2638
31 Ga0070661_100022449 3300005344 Bacteria 4519
32 Ga0070661_100173351 3300005344 Bacteria 1639
33 Ga0070668_100000548 3300005347 Bacteria 25144
34 Ga0070669_100144322 3300005353 Bacteria 1838
35 Ga0070675_100018631 3300005354 Bacteria 5526
36 Ga0070675_100025882 3300005354 Bacteria 4705
37 Ga0070671_100175759 3300005355 Bacteria 1812
38 Ga0070674_100072544 3300005356 Unclassified 2438
39 Ga0070688_100001186 3300005365 Bacteria 12944
40 Ga0070659_100004809 3300005366 Bacteria 9649
41 Ga0070709_10146427 3300005434 Bacteria 1628
42 Ga0070713_100009429 3300005436 Bacteria 6989
43 Ga0070713_100075754 3300005436 Bacteria 2855
44 Ga0070713_100257110 3300005436 Bacteria 1595
45 Ga0070710_10204298 3300005437 Unclassified 1249
46 Ga0070711_100001083 3300005439 Bacteria 14543
47 Ga0070711_100015675 3300005439 Bacteria 4798
48 Ga0070700_100010690 3300005441 Bacteria 5070
49 Ga0070694_100038352 3300005444 Bacteria 3184
50 Ga0070694_100078462 3300005444 Bacteria 2291
51 Ga0070694_100116629 3300005444 Unclassified 1910
52 Ga0070694_100363141 3300005444 Bacteria 1125
53 Ga0070708_100002567 3300005445 Bacteria 14055
54 Ga0070708_100021997 3300005445 Bacteria 5405
55 Ga0070708_100027398 3300005445 Bacteria 4889
56 Ga0070708_100075972 3300005445 Bacteria 3033
57 Ga0070708_100130137 3300005445 Bacteria 2329
58 Ga0070708_100207065 3300005445 Bacteria 1837
59 Ga0070663_100019260 3300005455 Bacteria 4494
60 Ga0070663_100023579 3300005455 Bacteria 4126
61 Ga0070663_100351165 3300005455 Bacteria 1194
62 Ga0070678_100029110 3300005456 Bacteria 3778
63 Ga0070678_100310971 3300005456 Bacteria 1342
64 Ga0070662_100009477 3300005457 Bacteria 6370
65 Ga0070681_10045834 3300005458 Bacteria 4373
66 Ga0070681_10373858 3300005458 Bacteria 1336
67 Ga0070681_10449751 3300005458 Unclassified 1200
68 Ga0068867_100292163 3300005459 Bacteria 1340
69 Ga0070685_10001268 3300005466 Bacteria 13369
70 Ga0070706_100000114 3300005467 Bacteria 98324
71 Ga0070706_100004312 3300005467 Bacteria 13774
72 Ga0070706_100016980 3300005467 Bacteria 6723
73 Ga0070706_100274240 3300005467 Unclassified 1574
74 Ga0070706_100342063 3300005467 Unclassified 1395
75 Ga0070706_100626544 3300005467 Bacteria 999
76 Ga0070707_100001344 3300005468 Bacteria 24173
77 Ga0070707_100039413 3300005468 Bacteria 4515
78 Ga0070707_100160204 3300005468 Bacteria 2193
79 Ga0070707_100457776 3300005468 Unclassified 1236
80 Ga0070698_100008701 3300005471 Bacteria 10934
81 Ga0070698_100010298 3300005471 Bacteria 9982
82 Ga0070698_100059767 3300005471 Bacteria 3848
83 Ga0070698_100197536 3300005471 Bacteria 1948
84 Ga0070699_100002678 3300005518 Bacteria 15919
85 Ga0070699_100010311 3300005518 Bacteria 8080
86 Ga0070699_100025421 3300005518 Bacteria 5104
87 Ga0070699_100078091 3300005518 Bacteria 2883
88 Ga0070699_100111233 3300005518 Bacteria 2405
89 Ga0070699_100126988 3300005518 Bacteria 2246
90 Ga0070699_100202090 3300005518 Bacteria 1767
91 Ga0070699_100273580 3300005518 Unclassified 1512
92 Ga0070699_100300137 3300005518 Bacteria 1441
93 Ga0070699_100520355 3300005518 Unclassified 1081
94 Ga0070684_100001985 3300005535 Bacteria 15042
95 Ga0070684_100052819 3300005535 Bacteria 3535
96 Ga0070684_100070476 3300005535 Bacteria 3076
97 Ga0070697_100000049 3300005536 Bacteria 90362
98 Ga0070697_100010343 3300005536 Bacteria 7275
99 Ga0070697_100012910 3300005536 Bacteria 6545
100 Ga0070697_100024049 3300005536 Bacteria 4849
101 Ga0070697_100031702 3300005536 Bacteria 4253
102 Ga0070697_100060405 3300005536 Bacteria 3089
103 Ga0068853_100013289 3300005539 Bacteria 6721
104 Ga0068853_100312936 3300005539 Bacteria 1454
105 Ga0068853_100401767 3300005539 Bacteria 1282
106 Ga0070686_100002375 3300005544 Bacteria 10370
107 Ga0070686_100043121 3300005544 Bacteria 2829
108 Ga0070686_100250765 3300005544 Bacteria 1293
109 Ga0070695_100050200 3300005545 Bacteria 2673
110 Ga0070695_100101420 3300005545 Bacteria 1939
111 Ga0070695_100121496 3300005545 Unclassified 1787
112 Ga0070696_100035573 3300005546 Bacteria 3430
113 Ga0070665_100081865 3300005548 Unclassified 3233
114 Ga0070704_100061076 3300005549 Bacteria 2695
115 Ga0070704_100273874 3300005549 Bacteria 1396
116 Ga0068855_100087269 3300005563 Unclassified 3606
117 Ga0070664_100021244 3300005564 Bacteria 5348
118 Ga0070664_100116377 3300005564 Bacteria 2338
119 Ga0068857_100001408 3300005577 Bacteria 19001
120 Ga0068857_100003515 3300005577 Bacteria 13091
121 Ga0068857_100166776 3300005577 Bacteria 2000
122 Ga0068857_100376683 3300005577 Bacteria 1317
123 Ga0068857_100615276 3300005577 Bacteria 1027
124 Ga0068854_100057980 3300005578 Unclassified 2794
125 Ga0068854_100216720 3300005578 Bacteria 1512
126 Ga0068856_100011280 3300005614 Bacteria 8673
127 Ga0068852_100000762 3300005616 Bacteria 21236
128 Ga0068852_100013053 3300005616 Bacteria 6341
129 Ga0068859_100205240 3300005617 Bacteria 2056
130 Ga0068866_10050404 3300005718 Bacteria 2114
131 Ga0068866_10085676 3300005718 Bacteria 1703
132 Ga0068866_10206151 3300005718 Bacteria 1177
133 Ga0068851_10006877 3300005834 Bacteria 5211
134 Ga0068851_10037838 3300005834 Bacteria 2420
135 Ga0068870_10006693 3300005840 Bacteria 5097
136 Ga0068863_100185964 3300005841 Bacteria 1995
137 Ga0068863_100575059 3300005841 Bacteria 1114
138 Ga0068858_100128672 3300005842 Bacteria 2373
139 Ga0068858_100193491 3300005842 Bacteria 1922
140 Ga0068862_100103242 3300005844 Bacteria 2496
141 Ga0081455_10000449 3300005937 Bacteria 54227
142 Ga0081455_10005416 3300005937 Bacteria 14003
143 Ga0081538_10006413 3300005981 Bacteria 10361
144 Ga0081538_10017299 3300005981 Bacteria 5479
145 Ga0081538_10039917 3300005981 Bacteria 3002
146 Ga0081540_1023956 3300005983 Bacteria 3554
147 Ga0081539_10002676 3300005985 Bacteria 24240
148 Ga0081539_10008956 3300005985 Bacteria 8522
149 Ga0070717_10009487 3300006028 Bacteria 7317
150 Ga0070717_10095440 3300006028 Unclassified 2517
151 Ga0070717_10621796 3300006028 Bacteria 980
152 Ga0070715_10009049 3300006163 Bacteria 3496
153 Ga0070715_10054903 3300006163 Bacteria 1727
154 Ga0070716_100004790 3300006173 Bacteria 6497
155 Ga0070716_100039531 3300006173 Bacteria 2619
156 Ga0070716_100064002 3300006173 Bacteria 2137
157 Ga0070716_100138227 3300006173 Unclassified 1550
158 Ga0070712_100000102 3300006175 Bacteria 43637
159 Ga0097621_100069667 3300006237 Bacteria 2904
160 Ga0097621_100144787 3300006237 Bacteria 2033
161 Ga0097621_100259956 3300006237 Bacteria 1523
162 Ga0068871_100022341 3300006358 Bacteria 4876
163 Ga0068871_100039655 3300006358 Bacteria 3770
164 Ga0068871_100070394 3300006358 Bacteria 2875
165 Ga0068871_100219385 3300006358 Unclassified 1647
166 Ga0075428_100011264 3300006844 Bacteria 9947
167 Ga0075428_100086806 3300006844 Bacteria 3413
168 Ga0075428_100242521 3300006844 Unclassified 1944
169 Ga0075428_100561849 3300006844 Bacteria 1220
170 Ga0075430_100097625 3300006846 Unclassified 2455
171 Ga0075430_100148632 3300006846 Bacteria 1951
172 Ga0075431_100014657 3300006847 Bacteria 7931
173 Ga0075431_100021948 3300006847 Bacteria 6527
174 Ga0075431_100025040 3300006847 Bacteria 6118
175 Ga0075431_100070666 3300006847 Bacteria 3602
176 Ga0075431_100077042 3300006847 Bacteria 3441
177 Ga0075431_100128818 3300006847 Bacteria 2611
178 Ga0075433_10000116 3300006852 Bacteria 39869
179 Ga0075433_10016481 3300006852 Bacteria 6093
180 Ga0075433_10055088 3300006852 Bacteria 3471
181 Ga0075433_10069583 3300006852 Bacteria 3091
182 Ga0075433_10426084 3300006852 Bacteria 1170
183 Ga0075434_100004427 3300006871 Bacteria 12663
184 Ga0075434_100012427 3300006871 Bacteria 8074
185 Ga0075434_100072354 3300006871 Bacteria 3439
186 Ga0075434_100255135 3300006871 Bacteria 1772
187 Ga0075429_100008878 3300006880 Bacteria 8737
188 Ga0075429_100051125 3300006880 Bacteria 3596
189 Ga0075429_100090951 3300006880 Bacteria 2662
190 Ga0075429_100094952 3300006880 Bacteria 2600
191 Ga0075429_100142169 3300006880 Bacteria 2101
192 Ga0075429_100158867 3300006880 Bacteria 1979
193 Ga0075429_100503152 3300006880 Bacteria 1062
194 Ga0068865_100012429 3300006881 Bacteria 5358
195 Ga0068865_100175719 3300006881 Bacteria 1645
196 Ga0075436_100001009 3300006914 Bacteria 18940
197 Ga0075436_100086820 3300006914 Unclassified 2173
198 Ga0097620_100205249 3300006931 Bacteria 2056
199 Ga0075435_100006346 3300007076 Bacteria 8355
200 Ga0075435_100058211 3300007076 Bacteria 3129
201 Ga0099794_10000371 3300007265 Bacteria 15436
202 Ga0099794_10093431 3300007265 Bacteria 1495
203 Ga0105250_10020832 3300009092 Bacteria 2648
204 Ga0105240_10013436 3300009093 Bacteria 11242
205 Ga0105240_10368271 3300009093 Unclassified 1625
206 Ga0111539_10013441 3300009094 Bacteria 10231
207 Ga0111539_10226203 3300009094 Bacteria 2179
208 Ga0111539_10497383 3300009094 Unclassified 1420
209 Ga0105245_10004346 3300009098 Bacteria 12542
210 Ga0105245_10011754 3300009098 Bacteria 7617
211 Ga0105245_10093118 3300009098 Bacteria 2776
212 Ga0105245_10283133 3300009098 Bacteria 1621
213 Ga0105247_10008842 3300009101 Bacteria 6140
214 Ga0105247_10052414 3300009101 Bacteria 2516
215 Ga0114129_10000526 3300009147 Bacteria 46823
216 Ga0114129_10008846 3300009147 Bacteria 14368
217 Ga0114129_10011611 3300009147 Bacteria 12540
218 Ga0114129_10017172 3300009147 Bacteria 10306
219 Ga0114129_10032686 3300009147 Bacteria 7351
220 Ga0114129_10080304 3300009147 Bacteria 4533
221 Ga0114129_10134165 3300009147 Bacteria 3398
222 Ga0114129_10244744 3300009147 Unclassified 2410
223 Ga0114129_10296495 3300009147 Bacteria 2156
224 Ga0114129_10331006 3300009147 Bacteria 2022
225 Ga0114129_10769492 3300009147 Bacteria 1231
226 Ga0105243_10031606 3300009148 Bacteria 4081
227 Ga0105243_10073447 3300009148 Bacteria 2772
228 Ga0105243_10092816 3300009148 Bacteria 2490
229 Ga0105241_10044130 3300009174 Bacteria 3377
230 Ga0105241_10215948 3300009174 Unclassified 1609
231 Ga0105242_10017112 3300009176 Bacteria 5645
232 Ga0105242_10090156 3300009176 Bacteria 2578
233 Ga0105242_10268665 3300009176 Bacteria 1544
234 Ga0105248_10019629 3300009177 Bacteria 7481
235 Ga0105248_10103220 3300009177 Bacteria 3214
236 Ga0105248_10213749 3300009177 Bacteria 2172
237 Ga0105237_10138676 3300009545 Bacteria 2427
238 Ga0105238_10047234 3300009551 Bacteria 4343
239 Ga0105249_10065096 3300009553 Bacteria 3352
240 Ga0105249_10217934 3300009553 Unclassified 1877
241 Ga0105249_10254466 3300009553 Bacteria 1742
242 Ga0105249_10270187 3300009553 Bacteria 1694
243 Ga0105239_10037129 3300010375 Bacteria 5344
244 Ga0105239_10289717 3300010375 Bacteria 1844
245 Ga0105246_10028938 3300011119 Bacteria 3644
246 Ga0157371_10030789 3300013102 Bacteria 3868
247 Ga0157371_10147389 3300013102 Bacteria 1678
248 Ga0157370_10133141 3300013104 Bacteria 2318
249 Ga0157370_10211987 3300013104 Bacteria 1795
250 Ga0157369_10020526 3300013105 Bacteria 7386
251 Ga0157369_10054306 3300013105 Bacteria 4327
252 Ga0157374_10003798 3300013296 Bacteria 12707
253 Ga0157374_10030833 3300013296 Bacteria 4870
254 Ga0157374_10061795 3300013296 Bacteria 3509
255 Ga0157374_10125330 3300013296 Bacteria 2482
256 Ga0163162_10001428 3300013306 Bacteria 22237
257 Ga0163162_10011666 3300013306 Bacteria 8567
258 Ga0163162_10018906 3300013306 Bacteria 6755
259 Ga0163162_10044920 3300013306 Bacteria 4426
260 Ga0163162_10120402 3300013306 Bacteria 2728
261 Ga0163162_10470282 3300013306 Bacteria 1389
262 Ga0157372_10103965 3300013307 Bacteria 3246
263 Ga0157372_10112001 3300013307 Bacteria 3127
264 Ga0157372_10137739 3300013307 Bacteria 2812
265 Ga0157375_10035580 3300013308 Bacteria 4755
266 Ga0157375_10046278 3300013308 Bacteria 4240
267 Ga0157375_10480929 3300013308 Bacteria 1407
268 Ga0163163_10000005 3300014325 Bacteria 369548
269 Ga0163163_10006112 3300014325 Bacteria 10485
270 Ga0163163_10065491 3300014325 Bacteria 3607
271 Ga0157380_10163730 3300014326 Bacteria 1936
272 Ga0157380_10218405 3300014326 Bacteria 1704
273 Ga0157380_10311339 3300014326 Bacteria 1455
274 Ga0182008_10109766 3300014497 Bacteria 1367
275 Ga0157377_10000614 3300014745 Bacteria 14785
276 Ga0157377_10043337 3300014745 Bacteria 2504
277 Ga0157379_10001964 3300014968 Bacteria 17013
278 Ga0157379_10023879 3300014968 Bacteria 5428
279 Ga0157379_10026669 3300014968 Bacteria 5144
280 Ga0157379_10055413 3300014968 Unclassified 3542
281 Ga0157376_10011866 3300014969 Bacteria 6441
282 Ga0157376_10057479 3300014969 Bacteria 3254
283 Ga0157376_10228182 3300014969 Bacteria 1728
284 Ga0157376_10265707 3300014969 Bacteria 1609
285 Ga0182007_10050112 3300015262 Bacteria 1379
286 Ga0163161_10027204 3300017792 Bacteria 4057
287 Ga0163161_10383916 3300017792 Bacteria 1123
288 Ga0213874_10018325 3300021377 Unclassified 1890
289 Ga0207697_10067147 3300025315 Unclassified 1499
290 Ga0207692_10010172 3300025898 Bacteria 3956
291 Ga0207710_10030844 3300025900 Bacteria 2341
292 Ga0207710_10084511 3300025900 Unclassified 1477
293 Ga0207688_10012559 3300025901 Unclassified 4608
294 Ga0207680_10043851 3300025903 Bacteria 2626
295 Ga0207647_10002289 3300025904 Bacteria 14588
296 Ga0207647_10007542 3300025904 Bacteria 7849
297 Ga0207685_10004629 3300025905 Bacteria 3528
298 Ga0207685_10013294 3300025905 Unclassified 2542
299 Ga0207699_10033977 3300025906 Bacteria 2887
300 Ga0207699_10062795 3300025906 Unclassified 2241
301 Ga0207699_10089759 3300025906 Unclassified 1927
302 Ga0207699_10216893 3300025906 Unclassified 1304
303 Ga0207645_10001951 3300025907 Bacteria 16619
304 Ga0207645_10071089 3300025907 Bacteria 2227
305 Ga0207643_10000194 3300025908 Bacteria 41979
306 Ga0207684_10000187 3300025910 Bacteria 98338
307 Ga0207684_10003742 3300025910 Bacteria 14701
308 Ga0207684_10108656 3300025910 Unclassified 2373
309 Ga0207684_10143299 3300025910 Unclassified 2055
310 Ga0207654_10019831 3300025911 Bacteria 3555
311 Ga0207654_10098457 3300025911 Bacteria 1797
312 Ga0207707_10078102 3300025912 Unclassified 2890
313 Ga0207695_10045283 3300025913 Bacteria 4671
314 Ga0207671_10146482 3300025914 Bacteria 1822
315 Ga0207693_10000937 3300025915 Bacteria 26188
316 Ga0207693_10008342 3300025915 Bacteria 8478
317 Ga0207693_10014649 3300025915 Bacteria 6300
318 Ga0207693_10216231 3300025915 Bacteria 1506
319 Ga0207663_10030112 3300025916 Bacteria 3197
320 Ga0207663_10405545 3300025916 Unclassified 1043
321 Ga0207662_10030655 3300025918 Bacteria 3123
322 Ga0207657_10017994 3300025919 Bacteria 6762
323 Ga0207657_10019624 3300025919 Bacteria 6412
324 Ga0207649_10000353 3300025920 Bacteria 34763
325 Ga0207649_10041445 3300025920 Bacteria 2802
326 Ga0207649_10065099 3300025920 Bacteria 2307
327 Ga0207649_10128855 3300025920 Bacteria 1716
328 Ga0207646_10015099 3300025922 Bacteria 7308
329 Ga0207646_10051464 3300025922 Bacteria 3685
330 Ga0207646_10088759 3300025922 Bacteria 2767
331 Ga0207646_10158614 3300025922 Bacteria 2041
332 Ga0207650_10000216 3300025925 Bacteria 65683
333 Ga0207650_10034332 3300025925 Bacteria 3678
334 Ga0207650_10331274 3300025925 Unclassified 1249
335 Ga0207659_10042543 3300025926 Unclassified 3186
336 Ga0207687_10031558 3300025927 Bacteria 3582
337 Ga0207687_10104582 3300025927 Bacteria 2090
338 Ga0207700_10023329 3300025928 Unclassified 4263
339 Ga0207700_10028137 3300025928 Bacteria 3947
340 Ga0207700_10073614 3300025928 Bacteria 2639
341 Ga0207664_10350065 3300025929 Bacteria 1307
342 Ga0207644_10093323 3300025931 Bacteria 2247
343 Ga0207690_10004696 3300025932 Bacteria 8067
344 Ga0207706_10000958 3300025933 Bacteria 29517
345 Ga0207706_10002606 3300025933 Bacteria 17558
346 Ga0207686_10044247 3300025934 Bacteria 2733
347 Ga0207686_10044790 3300025934 Bacteria 2719
348 Ga0207686_10179926 3300025934 Bacteria 1499
349 Ga0207669_10063658 3300025937 Bacteria 2278
350 Ga0207704_10097904 3300025938 Bacteria 1947
351 Ga0207665_10000508 3300025939 Bacteria 26274
352 Ga0207665_10025080 3300025939 Unclassified 3933
353 Ga0207665_10029298 3300025939 Bacteria 3639
354 Ga0207665_10088974 3300025939 Bacteria 2138
355 Ga0207691_10000459 3300025940 Bacteria 40352
356 Ga0207711_10038172 3300025941 Bacteria 4083
357 Ga0207711_10335105 3300025941 Bacteria 1400
358 Ga0207689_10019987 3300025942 Bacteria 5640
359 Ga0207689_10301637 3300025942 Bacteria 1328
360 Ga0207661_10000423 3300025944 Bacteria 27313
361 Ga0207679_10000544 3300025945 Bacteria 25307
362 Ga0207679_10002324 3300025945 Bacteria 11694
363 Ga0207667_10008105 3300025949 Bacteria 12521
364 Ga0207651_10000651 3300025960 Bacteria 14749
365 Ga0207712_10240862 3300025961 Unclassified 1457
366 Ga0207712_10267492 3300025961 Bacteria 1389
367 Ga0207640_10022990 3300025981 Bacteria 3741
368 Ga0207658_10013736 3300025986 Bacteria 5539
369 Ga0207677_10084338 3300026023 Bacteria 2290
370 Ga0207677_10142153 3300026023 Bacteria 1839
371 Ga0207703_10046013 3300026035 Bacteria 3512
372 Ga0207703_10048627 3300026035 Bacteria 3425
373 Ga0207639_10118402 3300026041 Bacteria 2172
374 Ga0207678_10003748 3300026067 Bacteria 13678
375 Ga0207678_10022906 3300026067 Bacteria 5466
376 Ga0207678_10264871 3300026067 Bacteria 1473
377 Ga0207702_10037998 3300026078 Bacteria 4032
378 Ga0207641_10000309 3300026088 Bacteria 60888
379 Ga0207641_10527795 3300026088 Bacteria 1149
380 Ga0207648_10000826 3300026089 Bacteria 34905
381 Ga0207648_10004830 3300026089 Bacteria 13742
382 Ga0207676_10000058 3300026095 Bacteria 120315
383 Ga0207676_10221279 3300026095 Bacteria 1686
384 Ga0207676_10492328 3300026095 Bacteria 1163
385 Ga0207674_10000148 3300026116 Bacteria 82478
386 Ga0207674_10155073 3300026116 Bacteria 2245
387 Ga0207674_10379724 3300026116 Bacteria 1366
388 Ga0207674_10386217 3300026116 Bacteria 1353
389 Ga0207675_100034888 3300026118 Bacteria 4690
390 Ga0207675_100035002 3300026118 Unclassified 4683
391 Ga0207675_100165992 3300026118 Unclassified 2108
392 Ga0207683_10000695 3300026121 Bacteria 30863
393 Ga0207683_10000913 3300026121 Bacteria 27167
394 Ga0207683_10063889 3300026121 Bacteria 3243
395 Ga0207698_10009366 3300026142 Bacteria 6242
396 Ga0207698_10447245 3300026142 Bacteria 1246
397 Ga0209588_1000059 3300027671 Bacteria 38911
398 Ga0209588_1001901 3300027671 Bacteria 5585
399 Ga0207428_10064605 3300027907 Bacteria 2889
400 Ga0268266_10003073 3300028379 Bacteria 17059
401 Ga0268266_10092376 3300028379 Bacteria 2655
402 Ga0268265_10046910 3300028380 Bacteria 3233
403 Ga0268265_10065633 3300028380 Bacteria 2802
404 Ga0268264_10036105 3300028381 Bacteria 4069
405 Ga0268264_10130310 3300028381 Bacteria 2228
406 Ga0265337_1019754 3300028556 Unclassified 2119
407 Ga0265326_10023685 3300028558 Bacteria 1754
408 Ga0265318_10001824 3300028577 Bacteria 12069
409 Ga0265318_10033631 3300028577 Bacteria 1978
410 Ga0265318_10038149 3300028577 Bacteria 1838
411 Ga0265338_10078642 3300028800 Bacteria 2780
412 Ga0265338_10245751 3300028800 Bacteria 1323
413 Ga0265330_10027242 3300031235 Bacteria 2583
414 Ga0265320_10050827 3300031240 Bacteria 2013
415 Ga0265340_10046388 3300031247 Bacteria 2120
416 Ga0265340_10053609 3300031247 Bacteria 1947
417 Ga0265331_10010434 3300031250 Bacteria 5141
418 Ga0265316_10028435 3300031344 Bacteria 4613
419 Ga0265313_10117572 3300031595 Unclassified 1163
420 Ga0316579_10019085 3300031691 Bacteria 3025
421 Ga0265314_10165449 3300031711 Bacteria 1341
422 Ga0265314_10175508 3300031711 Bacteria 1289
423 Ga0265314_10190604 3300031711 Bacteria 1220
424 Ga0307416_100403204 3300032002 Unclassified 1406
425 Ga0307415_100011967 3300032126 Unclassified 4996
426 Ga0307415_100387982 3300032126 Bacteria 1188
427 Ga0373934_0014437 3300035086 Bacteria 2993
428 Ga0373953_0029117 3300035117 Unclassified 2134
429 Ga0373957_0002356 3300035120 Bacteria 5374
430 Ga0373955_0004759 3300035172 Bacteria 6037
431 Ga0373931_0012086 3300035691 Bacteria 4179
432 Ga0373933_0082135 3300035724 Unclassified 1977
433 Ga0373937_0000017 3300036401 Bacteria 144650
434 Ga0373937_0162682 3300036401 Unclassified 2092
435 Ga0395900_0346250 3300037418 Bacteria 1460
436 Ga0395898_0060764 3300037466 Bacteria 3672
437 Ga0395905_0020989 3300037471 Bacteria 6184
438 Ga0436360_0352075 3300039438 Unclassified 1977
439 Ga0436363_0430709 3300039450 Unclassified 2722
440 Ga0439447_047844 3300041407 Bacteria 1027
441 Ga0451800_0390088 3300041459 Unclassified 1410
442 Ga0451577_0000770 3300042876 Bacteria 48404
443 Ga0451577_0029941 3300042876 Unclassified 4918
444 Ga0451577_0038350 3300042876 Bacteria 4310
445 Ga0451577_0095781 3300042876 Bacteria 2650
446 Ga0451577_0130685 3300042876 Bacteria 2252
447 Ga0451577_0233209 3300042876 Bacteria 1665
448 Ga0451577_0413380 3300042876 Bacteria 1224
449 Ga0439440_0042264 3300042993 Unclassified 1115
450 Ga0453683_0000448 3300044673 Bacteria 47323
451 Ga0453683_0002533 3300044673 Bacteria 14103
452 Ga0453683_0004298 3300044673 Bacteria 10157
453 Ga0453683_0005209 3300044673 Bacteria 9105
454 Ga0453683_0055218 3300044673 Bacteria 2486
455 Ga0453684_0000689 3300044712 Bacteria 120254
456 Ga0453684_0000843 3300044712 Bacteria 103482
457 Ga0453684_0000895 3300044712 Bacteria 99507
458 Ga0453684_0001770 3300044712 Bacteria 57649
459 Ga0453684_0001954 3300044712 Bacteria 53181
460 Ga0453684_0007814 3300044712 Bacteria 19501
461 Ga0453684_0013328 3300044712 Bacteria 13378
462 Ga0453684_0014335 3300044712 Bacteria 12695
463 Ga0453684_0018118 3300044712 Bacteria 10840
464 Ga0453684_0032836 3300044712 Bacteria 7251
465 Ga0453684_0034328 3300044712 Bacteria 7043
466 Ga0453684_0047962 3300044712 Bacteria 5656
467 Ga0453684_0055755 3300044712 Bacteria 5135
468 Ga0453684_0185854 3300044712 Bacteria 2435
469 Ga0453684_0251748 3300044712 Bacteria 2028
470 Ga0453684_0276920 3300044712 Bacteria 1915
471 Ga0453684_0329790 3300044712 Bacteria 1726
472 Ga0453684_0359144 3300044712 Bacteria 1641
473 Ga0453684_0376094 3300044712 Unclassified 1596
474 Ga0453684_0524799 3300044712 Bacteria 1308
475 Ga0453684_0654421 3300044712 Bacteria 1146
476 Ga0451576_0000218 3300045051 Bacteria 142018
477 Ga0451576_0002465 3300045051 Bacteria 27543
478 Ga0451576_0003866 3300045051 Bacteria 20083
479 Ga0451576_0008409 3300045051 Bacteria 12113
480 Ga0451576_0014548 3300045051 Bacteria 8747
481 Ga0451576_0015714 3300045051 Bacteria 8378
482 Ga0451576_0016884 3300045051 Bacteria 8041
483 Ga0451576_0028115 3300045051 Bacteria 6028
484 Ga0451576_0028283 3300045051 Bacteria 6008
485 Ga0451576_0041277 3300045051 Bacteria 4879
486 Ga0451576_0060840 3300045051 Bacteria 3939
487 Ga0451576_0322011 3300045051 Bacteria 1618
488 Ga0451576_0694585 3300045051 Bacteria 1069
489 Ga0495603_0148320 3300046455 Unclassified 1363
490 Ga0495651_0069986 3300046462 Unclassified 2670
491 Ga0495653_0031871 3300046463 Bacteria 4188
492 Ga0495580_0003298 3300046472 Bacteria 13795
493 Ga0495580_0004264 3300046472 Bacteria 12030
494 Ga0495580_0011216 3300046472 Bacteria 6935
495 Ga0495580_0085659 3300046472 Unclassified 2194
496 Ga0495580_0093791 3300046472 Bacteria 2089
497 Ga0495580_0158540 3300046472 Bacteria 1566
498 Ga0495652_0205664 3300046529 Archaea 1491
499 Ga0495588_0063556 3300046674 Bacteria 1914
500 Ga0495669_0137724 3300046684 Bacteria 1151
501 Ga0495676_0033961 3300047321 Bacteria 4286
502 Ga0495680_0102819 3300047322 Unclassified 2127
503 Ga0496100_0072211 3300048903 Bacteria 2306
504 Ga0496100_0148132 3300048903 Bacteria 1671
505 Ga0496101_0030080 3300048904 Bacteria 3804
506 Ga0496101_0091276 3300048904 Bacteria 2267
507 Ga0496102_0049234 3300048905 Bacteria 3833
508 Ga0496102_0163548 3300048905 Bacteria 2094
509 Ga0496104_0007471 3300048907 Bacteria 9660
510 Ga0496104_0133906 3300048907 Bacteria 2381
511 Ga0496104_0194167 3300048907 Bacteria 1942
512 Ga0496105_0083494 3300048908 Bacteria 2638
513 Ga0496105_0083952 3300048908 Bacteria 2630
514 Ga0496106_0193612 3300048909 Bacteria 1617
515 Ga0496107_0119428 3300048910 Bacteria 1942
516 Ga0496107_0124624 3300048910 Bacteria 1899
517 Ga0496108_0000170 3300048911 Bacteria 61234
518 Ga0496109_0000055 3300048912 Bacteria 121528
519 Ga0496109_0181461 3300048912 Bacteria 1977
520 Ga0496110_0013379 3300048913 Bacteria 6781
521 Ga0496110_0220587 3300048913 Bacteria 1724
522 Ga0496111_0162228 3300048914 Bacteria 1660
523 Ga0496111_0286541 3300048914 Unclassified 1221
524 Ga0496112_0000409 3300048915 Bacteria 28190
525 Ga0496112_0062523 3300048915 Bacteria 3672
526 Ga0496113_0003411 3300048916 Bacteria 9508
527 Ga0496113_0034189 3300048916 Bacteria 3707
528 Ga0496114_0004334 3300048917 Bacteria 10988
529 Ga0501311_001823 3300049527 Unclassified 1941
530 Ga0501317_012522 3300049533 Bacteria 1048
531 Ga0501034_0402603 3300049571 Bacteria 1291
532 Ga0501036_0077420 3300049572 Bacteria 2814
533 Ga0501036_0326779 3300049572 Bacteria 1281
534 Ga0501038_0174858 3300049574 Unclassified 1736
535 Ga0501040_0141402 3300049576 Bacteria 1696
536 Ga0501040_0211460 3300049576 Bacteria 1379
537 Ga0501041_0029499 3300049577 Bacteria 3309
538 Ga0501042_0204204 3300049578 Bacteria 1425
539 Ga0501046_0214221 3300049580 Bacteria 1429
540 Ga0501070_0094200 3300049586 Bacteria 2478
541 Ga0501071_0101746 3300049587 Bacteria 2118
542 Ga0501071_0211783 3300049587 Bacteria 1457
543 Ga0501072_0012975 3300049588 Bacteria 6377
544 Ga0501072_0255939 3300049588 Bacteria 1394
545 Ga0501072_0266592 3300049588 Bacteria 1363
546 Ga0501072_0379829 3300049588 Bacteria 1121
547 Ga0501075_0022900 3300049591 Unclassified 4568
548 Ga0501075_0037744 3300049591 Bacteria 3611
549 Ga0501075_0226710 3300049591 Bacteria 1425
550 Ga0501075_0227078 3300049591 Bacteria 1424
551 Ga0501076_0007104 3300049592 Bacteria 8136
552 Ga0501076_0086301 3300049592 Bacteria 2522
553 Ga0501076_0101141 3300049592 Bacteria 2323
554 Ga0501076_0114262 3300049592 Bacteria 2184
555 Ga0501079_0042929 3300049741 Bacteria 3491
556 Ga0501079_0071730 3300049741 Bacteria 2676
557 Ga0501079_0130715 3300049741 Bacteria 1954
558 Ga0501080_0041508 3300049742 Unclassified 4286
559 Ga0501081_0062697 3300049743 Bacteria 2579
560 Ga0501081_0099824 3300049743 Bacteria 2051
561 Ga0501045_0022527 3300049824 Bacteria 4512
562 Ga0501045_0045081 3300049824 Bacteria 3211
563 nmdc:mga05p37_145368_c1 3300050507 Bacteria 2904
564 nmdc:mga05p37_255327_c1 3300050507 Bacteria 2101
565 nmdc:mga05p37_28338_c1 3300050507 Bacteria 6829
566 nmdc:mga05p37_354111_c1 3300050507 Bacteria 1728
567 nmdc:mga05p37_3978_c1 3300050507 Bacteria 17298
568 nmdc:mga05p37_618047_c1 3300050507 Bacteria 1220
569 nmdc:mga05p37_71069_c1 3300050507 Bacteria 4281
570 nmdc:mga09592_117344_c1 3300050508 Bacteria 2284
571 nmdc:mga09592_214597_c1 3300050508 Bacteria 1667
572 nmdc:mga09592_293269_c1 3300050508 Bacteria 1410
573 nmdc:mga09592_327401_c1 3300050508 Unclassified 1327
574 nmdc:mga09592_370_c1 3300050508 Bacteria 23930
575 nmdc:mga09592_51456_c1 3300050508 Bacteria 3475
576 nmdc:mga09592_91762_c1 3300050508 Bacteria 2596
577 nmdc:mga0qj67_118376_c1 3300050509 Bacteria 2141
578 nmdc:mga0qj67_128557_c1 3300050509 Bacteria 2050
579 nmdc:mga0qj67_72896_c1 3300050509 Bacteria 2743
580 nmdc:mga0qj67_95046_c1 3300050509 Unclassified 2398
581 nmdc:mga06r32_11276_c1 3300050510 Bacteria 8050
582 nmdc:mga06r32_154703_c1 3300050510 Bacteria 2274
583 nmdc:mga06r32_158640_c1 3300050510 Bacteria 2244
584 nmdc:mga06r32_283342_c1 3300050510 Bacteria 1644
585 nmdc:mga06r32_36880_c1 3300050510 Bacteria 4623
586 nmdc:mga06r32_403950_c1 3300050510 Bacteria 1348
587 nmdc:mga08y16_175560_c1 3300050511 Bacteria 2225
588 nmdc:mga08y16_188753_c1 3300050511 Bacteria 2138
589 nmdc:mga0n895_22333_c1 3300050512 Bacteria 5932
590 nmdc:mga0n895_386904_c1 3300050512 Bacteria 1415
591 nmdc:mga0n895_70888_c1 3300050512 Bacteria 3454
592 nmdc:mga0n895_9465_c1 3300050512 Bacteria 8525
593 nmdc:mga0rr50_144209_c1 3300050513 Bacteria 1918
594 nmdc:mga0rr50_1777_c1 3300050513 Bacteria 11907
595 nmdc:mga08x19_199609_c1 3300050514 Bacteria 1371
596 nmdc:mga08x19_24535_c1 3300050514 Bacteria 3749
597 nmdc:mga0a205_190870_c1 3300050515 Bacteria 1941
598 nmdc:mga0a205_222_c1 3300050515 Bacteria 40112
599 nmdc:mga0a205_49512_c2 3300050515 Bacteria 3659
600 nmdc:mga0a205_71255_c1 3300050515 Bacteria 3357
601 nmdc:mga0a205_71935_c1 3300050515 Bacteria 3340
602 Ga0495601_0198772 3300053077 Unclassified 1310
603 Ga0495619_0011117 3300053085 Bacteria 5662
604 Ga0501084_0052029 3300054114 Bacteria 3427
605 Ga0587109_031330 3300059624 Bacteria 1011
606 Ga0501082_0022499 3300060353 Bacteria 5430
607 Ga0530510_0116647 3300061734 Bacteria 1958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0083494 Ga0496105_0083494_12_782 254
2 3300004801 Ga0058860_12212553 Ga0058860_122125531 295
3 3300005329 Ga0070683_100025703 Ga0070683_1000257035 296
4 3300005331 Ga0070670_100062868 Ga0070670_1000628682 296
5 3300005344 Ga0070661_100173351 Ga0070661_1001733512 296
6 3300005354 Ga0070675_100025882 Ga0070675_1000258822 296
7 3300005355 Ga0070671_100175759 Ga0070671_1001757591 296
8 3300005539 Ga0068853_100312936 Ga0068853_1003129362 296
9 3300005564 Ga0070664_100116377 Ga0070664_1001163772 296
10 3300005616 Ga0068852_100013053 Ga0068852_1000130533 296
11 3300006358 Ga0068871_100219385 Ga0068871_1002193852 296
12 3300013296 Ga0157374_10061795 Ga0157374_100617952 296
13 3300013307 Ga0157372_10112001 Ga0157372_101120013 296
14 3300014745 Ga0157377_10043337 Ga0157377_100433372 296
15 3300025904 Ga0207647_10002289 Ga0207647_100022892 296
16 3300025920 Ga0207649_10065099 Ga0207649_100650992 296
17 3300025925 Ga0207650_10034332 Ga0207650_100343324 296
18 3300025926 Ga0207659_10042543 Ga0207659_100425432 296
19 3300025931 Ga0207644_10093323 Ga0207644_100933232 296
20 3300025932 Ga0207690_10004696 Ga0207690_100046964 296
21 3300026095 Ga0207676_10492328 Ga0207676_104923282 296
22 3300026142 Ga0207698_10009366 Ga0207698_100093665 296
23 3300059624 Ga0587109_031330 Ga0587109_031330_47_937 296
24 3300005937 Ga0081455_10005416 Ga0081455_100054167 301
25 3300037418 Ga0395900_0346250 Ga0395900_0346250_58_981 301
26 3300037466 Ga0395898_0060764 Ga0395898_0060764_802_1725 301
27 3300037471 Ga0395905_0020989 Ga0395905_0020989_4192_5115 301
28 3300039438 Ga0436360_0352075 Ga0436360_0352075_812_1726 302
29 3300044712 Ga0453684_0001954 Ga0453684_0001954_45900_46811 302
30 3300004798 Ga0058859_11031243 Ga0058859_110312431 303
31 3300009093 Ga0105240_10013436 Ga0105240_1001343611 303
32 3300013104 Ga0157370_10133141 Ga0157370_101331412 303
33 3300025929 Ga0207664_10350065 Ga0207664_103500652 303
34 3300039450 Ga0436363_0430709 Ga0436363_0430709_1475_2392 303
35 3300046463 Ga0495653_0031871 Ga0495653_0031871_2925_3836 303
36 3300046472 Ga0495580_0158540 Ga0495580_0158540_583_1500 303
37 3300050512 nmdc:mga0n895_22333_c1 nmdc:mga0n895_22333_c1_615_1532 303
38 3300050514 nmdc:mga08x19_24535_c1 nmdc:mga08x19_24535_c1_815_1738 303
39 3300050515 nmdc:mga0a205_190870_c1 nmdc:mga0a205_190870_c1_67_984 303
40 3300004798 Ga0058859_10006034 Ga0058859_100060344 304
41 3300004801 Ga0058860_10158606 Ga0058860_101586063 304
42 3300005338 Ga0068868_100077507 Ga0068868_1000775072 304
43 3300005471 Ga0070698_100197536 Ga0070698_1001975363 304
44 3300005518 Ga0070699_100300137 Ga0070699_1003001371 304
45 3300005544 Ga0070686_100250765 Ga0070686_1002507651 304
46 3300005842 Ga0068858_100193491 Ga0068858_1001934913 304
47 3300005937 Ga0081455_10000449 Ga0081455_1000044926 304
48 3300005981 Ga0081538_10006413 Ga0081538_100064135 304
49 3300005981 Ga0081538_10017299 Ga0081538_100172994 304
50 3300005981 Ga0081538_10039917 Ga0081538_100399174 304
51 3300005983 Ga0081540_1023956 Ga0081540_10239563 304
52 3300006844 Ga0075428_100011264 Ga0075428_1000112643 304
53 3300006846 Ga0075430_100148632 Ga0075430_1001486321 304
54 3300006847 Ga0075431_100077042 Ga0075431_1000770425 304
55 3300006847 Ga0075431_100128818 Ga0075431_1001288182 304
56 3300006852 Ga0075433_10055088 Ga0075433_100550883 304
57 3300006871 Ga0075434_100255135 Ga0075434_1002551353 304
58 3300006880 Ga0075429_100051125 Ga0075429_1000511254 304
59 3300007265 Ga0099794_10093431 Ga0099794_100934311 304
60 3300009094 Ga0111539_10013441 Ga0111539_100134414 304
61 3300009098 Ga0105245_10283133 Ga0105245_102831331 304
62 3300009147 Ga0114129_10032686 Ga0114129_100326863 304
63 3300009553 Ga0105249_10254466 Ga0105249_102544662 304
64 3300013306 Ga0163162_10120402 Ga0163162_101204023 304
65 3300013306 Ga0163162_10470282 Ga0163162_104702822 304
66 3300014968 Ga0157379_10026669 Ga0157379_100266695 304
67 3300025961 Ga0207712_10240862 Ga0207712_102408621 304
68 3300026035 Ga0207703_10048627 Ga0207703_100486272 304
69 3300026118 Ga0207675_100165992 Ga0207675_1001659923 304
70 3300027671 Ga0209588_1001901 Ga0209588_10019013 304
71 3300027907 Ga0207428_10064605 Ga0207428_100646053 304
72 3300041407 Ga0439447_047844 Ga0439447_047844_70_990 304
73 3300041459 Ga0451800_0390088 Ga0451800_0390088_247_1161 304
74 3300042993 Ga0439440_0042264 Ga0439440_0042264_179_1093 304
75 3300044712 Ga0453684_0000895 Ga0453684_0000895_91359_92273 304
76 3300044712 Ga0453684_0047962 Ga0453684_0047962_3157_4071 304
77 3300044712 Ga0453684_0329790 Ga0453684_0329790_787_1701 304
78 3300044712 Ga0453684_0359144 Ga0453684_0359144_243_1157 304
79 3300049527 Ga0501311_001823 Ga0501311_001823_27_941 304
80 3300049533 Ga0501317_012522 Ga0501317_012522_87_1001 304
81 3300049578 Ga0501042_0204204 Ga0501042_0204204_493_1407 304
82 3300049588 Ga0501072_0255939 Ga0501072_0255939_216_1130 304
83 3300049588 Ga0501072_0379829 Ga0501072_0379829_42_956 304
84 3300049591 Ga0501075_0226710 Ga0501075_0226710_349_1263 304
85 3300049592 Ga0501076_0101141 Ga0501076_0101141_719_1633 304
86 3300050508 nmdc:mga09592_327401_c1 nmdc:mga09592_327401_c1_403_1317 304
87 3300050509 nmdc:mga0qj67_128557_c1 nmdc:mga0qj67_128557_c1_302_1216 304
88 3300050510 nmdc:mga06r32_283342_c1 nmdc:mga06r32_283342_c1_506_1420 304
89 3300050510 nmdc:mga06r32_36880_c1 nmdc:mga06r32_36880_c1_2416_3330 304
90 3300050511 nmdc:mga08y16_175560_c1 nmdc:mga08y16_175560_c1_391_1305 304
91 3300050512 nmdc:mga0n895_386904_c1 nmdc:mga0n895_386904_c1_371_1285 304
92 3300050513 nmdc:mga0rr50_144209_c1 nmdc:mga0rr50_144209_c1_194_1108 304
93 3300050515 nmdc:mga0a205_49512_c2 nmdc:mga0a205_49512_c2_80_994 304
94 3300050515 nmdc:mga0a205_71935_c1 nmdc:mga0a205_71935_c1_1160_2074 304
95 3300005289 Ga0065704_10246315 Ga0065704_102463151 305
96 3300005295 Ga0065707_10086750 Ga0065707_100867501 305
97 3300005330 Ga0070690_100060911 Ga0070690_1000609112 305
98 3300005445 Ga0070708_100021997 Ga0070708_1000219973 305
99 3300005455 Ga0070663_100351165 Ga0070663_1003511652 305
100 3300005456 Ga0070678_100029110 Ga0070678_1000291102 305
101 3300005617 Ga0068859_100205240 Ga0068859_1002052402 305
102 3300005718 Ga0068866_10085676 Ga0068866_100856762 305
103 3300005841 Ga0068863_100575059 Ga0068863_1005750591 305
104 3300005842 Ga0068858_100128672 Ga0068858_1001286722 305
105 3300006173 Ga0070716_100064002 Ga0070716_1000640022 305
106 3300006237 Ga0097621_100259956 Ga0097621_1002599562 305
107 3300006358 Ga0068871_100039655 Ga0068871_1000396552 305
108 3300006931 Ga0097620_100205249 Ga0097620_1002052492 305
109 3300009101 Ga0105247_10052414 Ga0105247_100524142 305
110 3300009148 Ga0105243_10073447 Ga0105243_100734472 305
111 3300009174 Ga0105241_10044130 Ga0105241_100441302 305
112 3300009176 Ga0105242_10268665 Ga0105242_102686652 305
113 3300009177 Ga0105248_10019629 Ga0105248_100196297 305
114 3300009177 Ga0105248_10213749 Ga0105248_102137492 305
115 3300013306 Ga0163162_10018906 Ga0163162_100189062 305
116 3300013308 Ga0157375_10480929 Ga0157375_104809292 305
117 3300014968 Ga0157379_10001964 Ga0157379_100019643 305
118 3300014969 Ga0157376_10228182 Ga0157376_102281822 305
119 3300017792 Ga0163161_10383916 Ga0163161_103839161 305
120 3300025900 Ga0207710_10030844 Ga0207710_100308442 305
121 3300025911 Ga0207654_10098457 Ga0207654_100984572 305
122 3300025934 Ga0207686_10044247 Ga0207686_100442471 305
123 3300025939 Ga0207665_10088974 Ga0207665_100889741 305
124 3300025941 Ga0207711_10038172 Ga0207711_100381725 305
125 3300025941 Ga0207711_10335105 Ga0207711_103351052 305
126 3300026067 Ga0207678_10264871 Ga0207678_102648712 305
127 3300026088 Ga0207641_10527795 Ga0207641_105277951 305
128 3300026121 Ga0207683_10000695 Ga0207683_100006956 305
129 3300042876 Ga0451577_0029941 Ga0451577_0029941_1978_2895 305
130 3300044712 Ga0453684_0018118 Ga0453684_0018118_3658_4575 305
131 3300044712 Ga0453684_0032836 Ga0453684_0032836_1570_2487 305
132 3300045051 Ga0451576_0014548 Ga0451576_0014548_7683_8600 305
133 3300045051 Ga0451576_0694585 Ga0451576_0694585_127_1044 305
134 3300048903 Ga0496100_0072211 Ga0496100_0072211_1211_2134 305
135 3300048904 Ga0496101_0030080 Ga0496101_0030080_1575_2498 305
136 3300048910 Ga0496107_0124624 Ga0496107_0124624_528_1451 305
137 3300049571 Ga0501034_0402603 Ga0501034_0402603_323_1258 305
138 3300049586 Ga0501070_0094200 Ga0501070_0094200_1393_2328 305
139 3300005295 Ga0065707_10114550 Ga0065707_101145502 306
140 3300005340 Ga0070689_100079513 Ga0070689_1000795132 306
141 3300005444 Ga0070694_100078462 Ga0070694_1000784621 306
142 3300005445 Ga0070708_100075972 Ga0070708_1000759722 306
143 3300005458 Ga0070681_10373858 Ga0070681_103738582 306
144 3300005467 Ga0070706_100626544 Ga0070706_1006265441 306
145 3300005518 Ga0070699_100078091 Ga0070699_1000780914 306
146 3300005536 Ga0070697_100010343 Ga0070697_1000103431 306
147 3300005536 Ga0070697_100060405 Ga0070697_1000604052 306
148 3300006844 Ga0075428_100561849 Ga0075428_1005618491 306
149 3300006847 Ga0075431_100025040 Ga0075431_1000250404 306
150 3300009147 Ga0114129_10011611 Ga0114129_1001161110 306
151 3300009148 Ga0105243_10031606 Ga0105243_100316064 306
152 3300014326 Ga0157380_10311339 Ga0157380_103113392 306
153 3300025910 Ga0207684_10143299 Ga0207684_101432992 306
154 3300025928 Ga0207700_10028137 Ga0207700_100281374 306
155 3300025942 Ga0207689_10301637 Ga0207689_103016372 306
156 3300026116 Ga0207674_10379724 Ga0207674_103797241 306
157 3300028577 Ga0265318_10033631 Ga0265318_100336312 306
158 3300028800 Ga0265338_10245751 Ga0265338_102457511 306
159 3300031711 Ga0265314_10165449 Ga0265314_101654492 306
160 3300042876 Ga0451577_0000770 Ga0451577_0000770_42720_43676 306
161 3300042876 Ga0451577_0095781 Ga0451577_0095781_154_1074 306
162 3300042876 Ga0451577_0233209 Ga0451577_0233209_332_1252 306
163 3300044673 Ga0453683_0000448 Ga0453683_0000448_35451_36371 306
164 3300044673 Ga0453683_0002533 Ga0453683_0002533_4129_5049 306
165 3300044673 Ga0453683_0004298 Ga0453683_0004298_1908_2828 306
166 3300044673 Ga0453683_0005209 Ga0453683_0005209_2720_3640 306
167 3300044712 Ga0453684_0000843 Ga0453684_0000843_6218_7207 306
168 3300044712 Ga0453684_0001770 Ga0453684_0001770_43932_44888 306
169 3300044712 Ga0453684_0013328 Ga0453684_0013328_10687_11673 306
170 3300044712 Ga0453684_0014335 Ga0453684_0014335_8848_9768 306
171 3300044712 Ga0453684_0055755 Ga0453684_0055755_2628_3548 306
172 3300044712 Ga0453684_0185854 Ga0453684_0185854_1002_1922 306
173 3300044712 Ga0453684_0276920 Ga0453684_0276920_522_1442 306
174 3300044712 Ga0453684_0654421 Ga0453684_0654421_87_1007 306
175 3300045051 Ga0451576_0000218 Ga0451576_0000218_67703_68623 306
176 3300045051 Ga0451576_0002465 Ga0451576_0002465_15451_16371 306
177 3300045051 Ga0451576_0060840 Ga0451576_0060840_2656_3576 306
178 3300046529 Ga0495652_0205664 Ga0495652_0205664_110_1036 306
179 3300046674 Ga0495588_0063556 Ga0495588_0063556_389_1315 306
180 3300047321 Ga0495676_0033961 Ga0495676_0033961_438_1364 306
181 3300048912 Ga0496109_0181461 Ga0496109_0181461_408_1352 306
182 3300049574 Ga0501038_0174858 Ga0501038_0174858_552_1472 306
183 3300049591 Ga0501075_0022900 Ga0501075_0022900_760_1680 306
184 3300049592 Ga0501076_0007104 Ga0501076_0007104_7047_7967 306
185 3300049741 Ga0501079_0042929 Ga0501079_0042929_1067_1987 306
186 3300049742 Ga0501080_0041508 Ga0501080_0041508_2887_3807 306
187 3300049743 Ga0501081_0099824 Ga0501081_0099824_649_1569 306
188 3300050507 nmdc:mga05p37_354111_c1 nmdc:mga05p37_354111_c1_740_1675 306
189 3300050509 nmdc:mga0qj67_72896_c1 nmdc:mga0qj67_72896_c1_385_1320 306
190 3300050510 nmdc:mga06r32_154703_c1 nmdc:mga06r32_154703_c1_266_1201 306
191 3300054114 Ga0501084_0052029 Ga0501084_0052029_1060_1980 306
192 3300060353 Ga0501082_0022499 Ga0501082_0022499_148_1068 306
193 3300005577 Ga0068857_100376683 Ga0068857_1003766832 307
194 3300009094 Ga0111539_10226203 Ga0111539_102262032 307
195 3300009094 Ga0111539_10497383 Ga0111539_104973832 307
196 3300009553 Ga0105249_10270187 Ga0105249_102701871 307
197 3300026116 Ga0207674_10386217 Ga0207674_103862171 307
198 3300044712 Ga0453684_0000689 Ga0453684_0000689_18467_19396 307
199 3300050511 nmdc:mga08y16_188753_c1 nmdc:mga08y16_188753_c1_820_1818 307
200 3300025915 Ga0207693_10216231 Ga0207693_102162312 308
201 3300035086 Ga0373934_0014437 Ga0373934_0014437_1152_2081 308
202 3300035117 Ga0373953_0029117 Ga0373953_0029117_532_1461 308
203 3300035120 Ga0373957_0002356 Ga0373957_0002356_14_943 308
204 3300035172 Ga0373955_0004759 Ga0373955_0004759_2496_3425 308
205 3300035724 Ga0373933_0082135 Ga0373933_0082135_260_1189 308
206 3300036401 Ga0373937_0000017 Ga0373937_0000017_23275_24204 308
207 3300046462 Ga0495651_0069986 Ga0495651_0069986_999_1928 308
208 3300047322 Ga0495680_0102819 Ga0495680_0102819_702_1631 308
209 3300048907 Ga0496104_0007471 Ga0496104_0007471_4342_5286 308
210 3300048908 Ga0496105_0083952 Ga0496105_0083952_854_1798 308
211 3300005444 Ga0070694_100363141 Ga0070694_1003631411 309
212 3300005445 Ga0070708_100207065 Ga0070708_1002070652 309
213 3300005467 Ga0070706_100016980 Ga0070706_1000169806 309
214 3300005468 Ga0070707_100001344 Ga0070707_10000134419 309
215 3300005471 Ga0070698_100008701 Ga0070698_1000087013 309
216 3300005518 Ga0070699_100002678 Ga0070699_1000026789 309
217 3300005536 Ga0070697_100012910 Ga0070697_1000129102 309
218 3300005577 Ga0068857_100615276 Ga0068857_1006152761 309
219 3300014325 Ga0163163_10000005 Ga0163163_10000005205 309
220 3300025922 Ga0207646_10015099 Ga0207646_100150995 309
221 3300045051 Ga0451576_0016884 Ga0451576_0016884_1568_2503 309
222 3300048913 Ga0496110_0220587 Ga0496110_0220587_766_1701 309
223 3300053077 Ga0495601_0198772 Ga0495601_0198772_212_1147 309
224 3300006852 Ga0075433_10000116 Ga0075433_100001163 310
225 3300006871 Ga0075434_100004427 Ga0075434_1000044272 310
226 3300007076 Ga0075435_100006346 Ga0075435_1000063462 310
227 3300009147 Ga0114129_10244744 Ga0114129_102447442 310
228 3300046472 Ga0495580_0011216 Ga0495580_0011216_306_1244 310
229 3300050510 nmdc:mga06r32_403950_c1 nmdc:mga06r32_403950_c1_34_978 310
230 3300050512 nmdc:mga0n895_9465_c1 nmdc:mga0n895_9465_c1_4527_5465 310
231 3300050513 nmdc:mga0rr50_1777_c1 nmdc:mga0rr50_1777_c1_6496_7434 310
232 3300050515 nmdc:mga0a205_222_c1 nmdc:mga0a205_222_c1_19776_20714 310
233 3300005336 Ga0070680_100052867 Ga0070680_1000528672 311
234 3300005344 Ga0070661_100022449 Ga0070661_1000224493 311
235 3300005436 Ga0070713_100009429 Ga0070713_1000094292 311
236 3300005436 Ga0070713_100075754 Ga0070713_1000757542 311
237 3300005444 Ga0070694_100038352 Ga0070694_1000383521 311
238 3300005445 Ga0070708_100002567 Ga0070708_10000256710 311
239 3300005445 Ga0070708_100130137 Ga0070708_1001301372 311
240 3300005459 Ga0068867_100292163 Ga0068867_1002921632 311
241 3300005467 Ga0070706_100000114 Ga0070706_10000011486 311
242 3300005467 Ga0070706_100342063 Ga0070706_1003420632 311
243 3300005468 Ga0070707_100039413 Ga0070707_1000394131 311
244 3300005468 Ga0070707_100160204 Ga0070707_1001602042 311
245 3300005468 Ga0070707_100457776 Ga0070707_1004577761 311
246 3300005471 Ga0070698_100059767 Ga0070698_1000597671 311
247 3300005518 Ga0070699_100025421 Ga0070699_1000254213 311
248 3300005518 Ga0070699_100126988 Ga0070699_1001269882 311
249 3300005518 Ga0070699_100202090 Ga0070699_1002020902 311
250 3300005535 Ga0070684_100070476 Ga0070684_1000704764 311
251 3300005536 Ga0070697_100024049 Ga0070697_1000240494 311
252 3300005546 Ga0070696_100035573 Ga0070696_1000355732 311
253 3300005549 Ga0070704_100061076 Ga0070704_1000610762 311
254 3300005564 Ga0070664_100021244 Ga0070664_1000212443 311
255 3300005577 Ga0068857_100001408 Ga0068857_10000140817 311
256 3300005985 Ga0081539_10002676 Ga0081539_1000267626 311
257 3300005985 Ga0081539_10008956 Ga0081539_100089562 311
258 3300006028 Ga0070717_10009487 Ga0070717_100094871 311
259 3300006028 Ga0070717_10621796 Ga0070717_106217961 311
260 3300006844 Ga0075428_100242521 Ga0075428_1002425212 311
261 3300006847 Ga0075431_100021948 Ga0075431_1000219483 311
262 3300006880 Ga0075429_100008878 Ga0075429_1000088784 311
263 3300006880 Ga0075429_100094952 Ga0075429_1000949522 311
264 3300006880 Ga0075429_100142169 Ga0075429_1001421692 311
265 3300007265 Ga0099794_10000371 Ga0099794_100003716 311
266 3300009147 Ga0114129_10000526 Ga0114129_1000052630 311
267 3300009147 Ga0114129_10080304 Ga0114129_100803044 311
268 3300009147 Ga0114129_10296495 Ga0114129_102964952 311
269 3300009147 Ga0114129_10331006 Ga0114129_103310062 311
270 3300009148 Ga0105243_10092816 Ga0105243_100928162 311
271 3300014326 Ga0157380_10163730 Ga0157380_101637302 311
272 3300014326 Ga0157380_10218405 Ga0157380_102184052 311
273 3300025906 Ga0207699_10062795 Ga0207699_100627952 311
274 3300025910 Ga0207684_10000187 Ga0207684_1000018785 311
275 3300025910 Ga0207684_10108656 Ga0207684_101086561 311
276 3300025920 Ga0207649_10041445 Ga0207649_100414451 311
277 3300025922 Ga0207646_10088759 Ga0207646_100887592 311
278 3300025922 Ga0207646_10158614 Ga0207646_101586142 311
279 3300025928 Ga0207700_10023329 Ga0207700_100233291 311
280 3300025928 Ga0207700_10073614 Ga0207700_100736142 311
281 3300025945 Ga0207679_10002324 Ga0207679_1000232410 311
282 3300026118 Ga0207675_100035002 Ga0207675_1000350022 311
283 3300027671 Ga0209588_1000059 Ga0209588_100005921 311
284 3300028380 Ga0268265_10065633 Ga0268265_100656332 311
285 3300031247 Ga0265340_10046388 Ga0265340_100463882 311
286 3300031711 Ga0265314_10175508 Ga0265314_101755082 311
287 3300031711 Ga0265314_10190604 Ga0265314_101906041 311
288 3300032126 Ga0307415_100011967 Ga0307415_1000119674 311
289 3300032126 Ga0307415_100387982 Ga0307415_1003879821 311
290 3300042876 Ga0451577_0038350 Ga0451577_0038350_716_1672 311
291 3300042876 Ga0451577_0130685 Ga0451577_0130685_657_1619 311
292 3300044712 Ga0453684_0007814 Ga0453684_0007814_4613_5575 311
293 3300044712 Ga0453684_0524799 Ga0453684_0524799_77_1030 311
294 3300045051 Ga0451576_0041277 Ga0451576_0041277_2939_3895 311
295 3300049588 Ga0501072_0266592 Ga0501072_0266592_91_1026 311
296 3300049592 Ga0501076_0114262 Ga0501076_0114262_981_1916 311
297 3300050507 nmdc:mga05p37_145368_c1 nmdc:mga05p37_145368_c1_401_1348 311
298 3300050507 nmdc:mga05p37_28338_c1 nmdc:mga05p37_28338_c1_276_1235 311
299 3300050507 nmdc:mga05p37_3978_c1 nmdc:mga05p37_3978_c1_14979_15914 311
300 3300050508 nmdc:mga09592_370_c1 nmdc:mga09592_370_c1_17849_18784 311
301 3300050508 nmdc:mga09592_51456_c1 nmdc:mga09592_51456_c1_1994_2929 311
302 3300001976 JGI24752J21851_1000560 JGI24752J21851_10005602 312
303 3300002239 JGI24034J26672_10000532 JGI24034J26672_100005322 312
304 3300005290 Ga0065712_10129045 Ga0065712_101290451 312
305 3300005293 Ga0065715_10013113 Ga0065715_100131133 312
306 3300005293 Ga0065715_10243287 Ga0065715_102432871 312
307 3300005328 Ga0070676_10106280 Ga0070676_101062802 312
308 3300005329 Ga0070683_100013067 Ga0070683_1000130674 312
309 3300005330 Ga0070690_100027145 Ga0070690_1000271452 312
310 3300005335 Ga0070666_10059317 Ga0070666_100593172 312
311 3300005337 Ga0070682_100044751 Ga0070682_1000447512 312
312 3300005338 Ga0068868_100002535 Ga0068868_1000025353 312
313 3300005338 Ga0068868_100006574 Ga0068868_1000065745 312
314 3300005341 Ga0070691_10027846 Ga0070691_100278461 312
315 3300005347 Ga0070668_100000548 Ga0070668_10000054815 312
316 3300005353 Ga0070669_100144322 Ga0070669_1001443222 312
317 3300005354 Ga0070675_100018631 Ga0070675_1000186312 312
318 3300005356 Ga0070674_100072544 Ga0070674_1000725442 312
319 3300005365 Ga0070688_100001186 Ga0070688_1000011863 312
320 3300005366 Ga0070659_100004809 Ga0070659_1000048093 312
321 3300005434 Ga0070709_10146427 Ga0070709_101464271 312
322 3300005436 Ga0070713_100257110 Ga0070713_1002571102 312
323 3300005437 Ga0070710_10204298 Ga0070710_102042981 312
324 3300005439 Ga0070711_100001083 Ga0070711_1000010836 312
325 3300005439 Ga0070711_100015675 Ga0070711_1000156753 312
326 3300005445 Ga0070708_100027398 Ga0070708_1000273983 312
327 3300005455 Ga0070663_100019260 Ga0070663_1000192602 312
328 3300005455 Ga0070663_100023579 Ga0070663_1000235792 312
329 3300005456 Ga0070678_100310971 Ga0070678_1003109711 312
330 3300005457 Ga0070662_100009477 Ga0070662_1000094773 312
331 3300005458 Ga0070681_10045834 Ga0070681_100458344 312
332 3300005458 Ga0070681_10449751 Ga0070681_104497511 312
333 3300005466 Ga0070685_10001268 Ga0070685_100012686 312
334 3300005467 Ga0070706_100004312 Ga0070706_10000431210 312
335 3300005518 Ga0070699_100273580 Ga0070699_1002735802 312
336 3300005535 Ga0070684_100001985 Ga0070684_1000019858 312
337 3300005535 Ga0070684_100052819 Ga0070684_1000528192 312
338 3300005536 Ga0070697_100000049 Ga0070697_10000004949 312
339 3300005536 Ga0070697_100031702 Ga0070697_1000317023 312
340 3300005539 Ga0068853_100013289 Ga0068853_1000132893 312
341 3300005539 Ga0068853_100401767 Ga0068853_1004017671 312
342 3300005544 Ga0070686_100002375 Ga0070686_1000023757 312
343 3300005544 Ga0070686_100043121 Ga0070686_1000431212 312
344 3300005545 Ga0070695_100121496 Ga0070695_1001214962 312
345 3300005548 Ga0070665_100081865 Ga0070665_1000818652 312
346 3300005563 Ga0068855_100087269 Ga0068855_1000872692 312
347 3300005577 Ga0068857_100003515 Ga0068857_1000035153 312
348 3300005577 Ga0068857_100166776 Ga0068857_1001667761 312
349 3300005578 Ga0068854_100057980 Ga0068854_1000579803 312
350 3300005578 Ga0068854_100216720 Ga0068854_1002167202 312
351 3300005614 Ga0068856_100011280 Ga0068856_1000112806 312
352 3300005616 Ga0068852_100000762 Ga0068852_1000007622 312
353 3300005718 Ga0068866_10050404 Ga0068866_100504041 312
354 3300005718 Ga0068866_10206151 Ga0068866_102061511 312
355 3300005834 Ga0068851_10006877 Ga0068851_100068773 312
356 3300005834 Ga0068851_10037838 Ga0068851_100378384 312
357 3300005840 Ga0068870_10006693 Ga0068870_100066932 312
358 3300005841 Ga0068863_100185964 Ga0068863_1001859642 312
359 3300005844 Ga0068862_100103242 Ga0068862_1001032422 312
360 3300006028 Ga0070717_10095440 Ga0070717_100954402 312
361 3300006163 Ga0070715_10009049 Ga0070715_100090493 312
362 3300006163 Ga0070715_10054903 Ga0070715_100549033 312
363 3300006173 Ga0070716_100004790 Ga0070716_1000047904 312
364 3300006173 Ga0070716_100039531 Ga0070716_1000395313 312
365 3300006173 Ga0070716_100138227 Ga0070716_1001382272 312
366 3300006175 Ga0070712_100000102 Ga0070712_1000001029 312
367 3300006237 Ga0097621_100069667 Ga0097621_1000696672 312
368 3300006237 Ga0097621_100144787 Ga0097621_1001447872 312
369 3300006358 Ga0068871_100022341 Ga0068871_1000223413 312
370 3300006358 Ga0068871_100070394 Ga0068871_1000703942 312
371 3300006852 Ga0075433_10069583 Ga0075433_100695832 312
372 3300006852 Ga0075433_10426084 Ga0075433_104260842 312
373 3300006871 Ga0075434_100012427 Ga0075434_1000124272 312
374 3300006881 Ga0068865_100012429 Ga0068865_1000124292 312
375 3300006881 Ga0068865_100175719 Ga0068865_1001757192 312
376 3300006914 Ga0075436_100001009 Ga0075436_1000010096 312
377 3300006914 Ga0075436_100086820 Ga0075436_1000868203 312
378 3300007076 Ga0075435_100058211 Ga0075435_1000582112 312
379 3300009092 Ga0105250_10020832 Ga0105250_100208322 312
380 3300009093 Ga0105240_10368271 Ga0105240_103682712 312
381 3300009098 Ga0105245_10004346 Ga0105245_100043462 312
382 3300009098 Ga0105245_10011754 Ga0105245_100117543 312
383 3300009098 Ga0105245_10093118 Ga0105245_100931181 312
384 3300009101 Ga0105247_10008842 Ga0105247_100088422 312
385 3300009176 Ga0105242_10017112 Ga0105242_100171123 312
386 3300009176 Ga0105242_10090156 Ga0105242_100901562 312
387 3300009177 Ga0105248_10103220 Ga0105248_101032203 312
388 3300009545 Ga0105237_10138676 Ga0105237_101386762 312
389 3300009551 Ga0105238_10047234 Ga0105238_100472342 312
390 3300009553 Ga0105249_10065096 Ga0105249_100650963 312
391 3300009553 Ga0105249_10217934 Ga0105249_102179342 312
392 3300010375 Ga0105239_10037129 Ga0105239_100371292 312
393 3300011119 Ga0105246_10028938 Ga0105246_100289382 312
394 3300013102 Ga0157371_10030789 Ga0157371_100307893 312
395 3300013102 Ga0157371_10147389 Ga0157371_101473891 312
396 3300013104 Ga0157370_10211987 Ga0157370_102119871 312
397 3300013105 Ga0157369_10020526 Ga0157369_100205263 312
398 3300013105 Ga0157369_10054306 Ga0157369_100543062 312
399 3300013296 Ga0157374_10003798 Ga0157374_100037984 312
400 3300013296 Ga0157374_10030833 Ga0157374_100308333 312
401 3300013296 Ga0157374_10125330 Ga0157374_101253302 312
402 3300013306 Ga0163162_10001428 Ga0163162_1000142814 312
403 3300013306 Ga0163162_10011666 Ga0163162_100116663 312
404 3300013306 Ga0163162_10044920 Ga0163162_100449202 312
405 3300013307 Ga0157372_10103965 Ga0157372_101039652 312
406 3300013307 Ga0157372_10137739 Ga0157372_101377392 312
407 3300013308 Ga0157375_10035580 Ga0157375_100355802 312
408 3300013308 Ga0157375_10046278 Ga0157375_100462781 312
409 3300014325 Ga0163163_10006112 Ga0163163_100061123 312
410 3300014325 Ga0163163_10065491 Ga0163163_100654912 312
411 3300014497 Ga0182008_10109766 Ga0182008_101097662 312
412 3300014745 Ga0157377_10000614 Ga0157377_100006143 312
413 3300014968 Ga0157379_10023879 Ga0157379_100238793 312
414 3300014968 Ga0157379_10055413 Ga0157379_100554132 312
415 3300014969 Ga0157376_10011866 Ga0157376_100118661 312
416 3300014969 Ga0157376_10057479 Ga0157376_100574792 312
417 3300014969 Ga0157376_10265707 Ga0157376_102657072 312
418 3300015262 Ga0182007_10050112 Ga0182007_100501121 312
419 3300017792 Ga0163161_10027204 Ga0163161_100272043 312
420 3300021377 Ga0213874_10018325 Ga0213874_100183252 312
421 3300025315 Ga0207697_10067147 Ga0207697_100671471 312
422 3300025898 Ga0207692_10010172 Ga0207692_100101722 312
423 3300025900 Ga0207710_10084511 Ga0207710_100845112 312
424 3300025901 Ga0207688_10012559 Ga0207688_100125593 312
425 3300025903 Ga0207680_10043851 Ga0207680_100438511 312
426 3300025904 Ga0207647_10007542 Ga0207647_100075423 312
427 3300025905 Ga0207685_10004629 Ga0207685_100046293 312
428 3300025905 Ga0207685_10013294 Ga0207685_100132943 312
429 3300025906 Ga0207699_10033977 Ga0207699_100339772 312
430 3300025906 Ga0207699_10089759 Ga0207699_100897591 312
431 3300025906 Ga0207699_10216893 Ga0207699_102168931 312
432 3300025907 Ga0207645_10001951 Ga0207645_100019519 312
433 3300025907 Ga0207645_10071089 Ga0207645_100710892 312
434 3300025908 Ga0207643_10000194 Ga0207643_100001942 312
435 3300025910 Ga0207684_10003742 Ga0207684_100037428 312
436 3300025911 Ga0207654_10019831 Ga0207654_100198313 312
437 3300025912 Ga0207707_10078102 Ga0207707_100781022 312
438 3300025913 Ga0207695_10045283 Ga0207695_100452832 312
439 3300025914 Ga0207671_10146482 Ga0207671_101464822 312
440 3300025915 Ga0207693_10000937 Ga0207693_1000093715 312
441 3300025915 Ga0207693_10008342 Ga0207693_100083423 312
442 3300025915 Ga0207693_10014649 Ga0207693_100146492 312
443 3300025916 Ga0207663_10030112 Ga0207663_100301122 312
444 3300025916 Ga0207663_10405545 Ga0207663_104055451 312
445 3300025918 Ga0207662_10030655 Ga0207662_100306552 312
446 3300025919 Ga0207657_10017994 Ga0207657_100179943 312
447 3300025919 Ga0207657_10019624 Ga0207657_100196243 312
448 3300025920 Ga0207649_10000353 Ga0207649_1000035317 312
449 3300025920 Ga0207649_10128855 Ga0207649_101288551 312
450 3300025925 Ga0207650_10000216 Ga0207650_1000021648 312
451 3300025925 Ga0207650_10331274 Ga0207650_103312742 312
452 3300025927 Ga0207687_10031558 Ga0207687_100315583 312
453 3300025927 Ga0207687_10104582 Ga0207687_101045822 312
454 3300025933 Ga0207706_10000958 Ga0207706_1000095814 312
455 3300025933 Ga0207706_10002606 Ga0207706_100026065 312
456 3300025934 Ga0207686_10044790 Ga0207686_100447902 312
457 3300025934 Ga0207686_10179926 Ga0207686_101799261 312
458 3300025937 Ga0207669_10063658 Ga0207669_100636582 312
459 3300025938 Ga0207704_10097904 Ga0207704_100979042 312
460 3300025939 Ga0207665_10000508 Ga0207665_100005082 312
461 3300025939 Ga0207665_10025080 Ga0207665_100250803 312
462 3300025939 Ga0207665_10029298 Ga0207665_100292983 312
463 3300025940 Ga0207691_10000459 Ga0207691_100004599 312
464 3300025942 Ga0207689_10019987 Ga0207689_100199873 312
465 3300025944 Ga0207661_10000423 Ga0207661_100004235 312
466 3300025945 Ga0207679_10000544 Ga0207679_100005449 312
467 3300025949 Ga0207667_10008105 Ga0207667_100081058 312
468 3300025960 Ga0207651_10000651 Ga0207651_100006512 312
469 3300025961 Ga0207712_10267492 Ga0207712_102674922 312
470 3300025981 Ga0207640_10022990 Ga0207640_100229903 312
471 3300025986 Ga0207658_10013736 Ga0207658_100137362 312
472 3300026023 Ga0207677_10084338 Ga0207677_100843382 312
473 3300026023 Ga0207677_10142153 Ga0207677_101421532 312
474 3300026035 Ga0207703_10046013 Ga0207703_100460132 312
475 3300026041 Ga0207639_10118402 Ga0207639_101184022 312
476 3300026067 Ga0207678_10003748 Ga0207678_100037483 312
477 3300026067 Ga0207678_10022906 Ga0207678_100229062 312
478 3300026078 Ga0207702_10037998 Ga0207702_100379983 312
479 3300026088 Ga0207641_10000309 Ga0207641_1000030917 312
480 3300026089 Ga0207648_10000826 Ga0207648_100008263 312
481 3300026089 Ga0207648_10004830 Ga0207648_1000483010 312
482 3300026095 Ga0207676_10000058 Ga0207676_1000005893 312
483 3300026095 Ga0207676_10221279 Ga0207676_102212791 312
484 3300026116 Ga0207674_10000148 Ga0207674_100001488 312
485 3300026116 Ga0207674_10155073 Ga0207674_101550732 312
486 3300026118 Ga0207675_100034888 Ga0207675_1000348883 312
487 3300026121 Ga0207683_10000913 Ga0207683_100009133 312
488 3300026121 Ga0207683_10063889 Ga0207683_100638892 312
489 3300026142 Ga0207698_10447245 Ga0207698_104472452 312
490 3300028379 Ga0268266_10003073 Ga0268266_100030733 312
491 3300028379 Ga0268266_10092376 Ga0268266_100923762 312
492 3300028381 Ga0268264_10036105 Ga0268264_100361052 312
493 3300028381 Ga0268264_10130310 Ga0268264_101303102 312
494 3300035691 Ga0373931_0012086 Ga0373931_0012086_2129_3073 312
495 3300036401 Ga0373937_0162682 Ga0373937_0162682_1097_2044 312
496 3300044712 Ga0453684_0376094 Ga0453684_0376094_233_1177 312
497 3300045051 Ga0451576_0015714 Ga0451576_0015714_3697_4641 312
498 3300046455 Ga0495603_0148320 Ga0495603_0148320_20_964 312
499 3300046472 Ga0495580_0003298 Ga0495580_0003298_5129_6073 312
500 3300046472 Ga0495580_0004264 Ga0495580_0004264_3498_4442 312
501 3300046472 Ga0495580_0085659 Ga0495580_0085659_178_1215 312
502 3300046684 Ga0495669_0137724 Ga0495669_0137724_14_958 312
503 3300048903 Ga0496100_0148132 Ga0496100_0148132_386_1333 312
504 3300048904 Ga0496101_0091276 Ga0496101_0091276_261_1211 312
505 3300048905 Ga0496102_0049234 Ga0496102_0049234_415_1359 312
506 3300048905 Ga0496102_0163548 Ga0496102_0163548_273_1217 312
507 3300048907 Ga0496104_0133906 Ga0496104_0133906_1211_2155 312
508 3300048907 Ga0496104_0194167 Ga0496104_0194167_876_1823 312
509 3300048909 Ga0496106_0193612 Ga0496106_0193612_263_1207 312
510 3300048910 Ga0496107_0119428 Ga0496107_0119428_719_1663 312
511 3300048911 Ga0496108_0000170 Ga0496108_0000170_47938_48882 312
512 3300048912 Ga0496109_0000055 Ga0496109_0000055_20918_21862 312
513 3300048913 Ga0496110_0013379 Ga0496110_0013379_5022_5966 312
514 3300048914 Ga0496111_0162228 Ga0496111_0162228_484_1428 312
515 3300048914 Ga0496111_0286541 Ga0496111_0286541_185_1129 312
516 3300048915 Ga0496112_0000409 Ga0496112_0000409_16007_16951 312
517 3300048915 Ga0496112_0062523 Ga0496112_0062523_654_1598 312
518 3300048916 Ga0496113_0003411 Ga0496113_0003411_7570_8514 312
519 3300048916 Ga0496113_0034189 Ga0496113_0034189_886_1830 312
520 3300048917 Ga0496114_0004334 Ga0496114_0004334_5381_6328 312
521 3300049572 Ga0501036_0326779 Ga0501036_0326779_40_990 312
522 3300049576 Ga0501040_0211460 Ga0501040_0211460_77_1042 312
523 3300049577 Ga0501041_0029499 Ga0501041_0029499_1190_2155 312
524 3300049580 Ga0501046_0214221 Ga0501046_0214221_198_1163 312
525 3300049587 Ga0501071_0211783 Ga0501071_0211783_413_1378 312
526 3300049588 Ga0501072_0012975 Ga0501072_0012975_497_1462 312
527 3300049591 Ga0501075_0227078 Ga0501075_0227078_382_1347 312
528 3300049592 Ga0501076_0086301 Ga0501076_0086301_344_1309 312
529 3300049824 Ga0501045_0045081 Ga0501045_0045081_2073_3023 312
530 3300050514 nmdc:mga08x19_199609_c1 nmdc:mga08x19_199609_c1_389_1333 312
531 3300053085 Ga0495619_0011117 Ga0495619_0011117_2709_3656 312
532 2162886007 SwRhRL2b_contig_1245215 SwRhRL2b_0010.00003270 313
533 3300005289 Ga0065704_10001431 Ga0065704_1000143114 313
534 3300005295 Ga0065707_10000488 Ga0065707_1000048812 313
535 3300005295 Ga0065707_10102424 Ga0065707_101024241 313
536 3300005441 Ga0070700_100010690 Ga0070700_1000106903 313
537 3300005444 Ga0070694_100116629 Ga0070694_1001166292 313
538 3300005467 Ga0070706_100274240 Ga0070706_1002742402 313
539 3300005471 Ga0070698_100010298 Ga0070698_1000102982 313
540 3300005518 Ga0070699_100010311 Ga0070699_1000103112 313
541 3300005518 Ga0070699_100111233 Ga0070699_1001112332 313
542 3300005518 Ga0070699_100520355 Ga0070699_1005203551 313
543 3300005545 Ga0070695_100050200 Ga0070695_1000502003 313
544 3300005545 Ga0070695_100101420 Ga0070695_1001014202 313
545 3300005549 Ga0070704_100273874 Ga0070704_1002738742 313
546 3300006844 Ga0075428_100086806 Ga0075428_1000868062 313
547 3300006846 Ga0075430_100097625 Ga0075430_1000976252 313
548 3300006847 Ga0075431_100014657 Ga0075431_1000146573 313
549 3300006847 Ga0075431_100070666 Ga0075431_1000706663 313
550 3300006852 Ga0075433_10016481 Ga0075433_100164813 313
551 3300006871 Ga0075434_100072354 Ga0075434_1000723543 313
552 3300006880 Ga0075429_100090951 Ga0075429_1000909512 313
553 3300006880 Ga0075429_100158867 Ga0075429_1001588671 313
554 3300006880 Ga0075429_100503152 Ga0075429_1005031521 313
555 3300009147 Ga0114129_10008846 Ga0114129_100088467 313
556 3300009147 Ga0114129_10017172 Ga0114129_100171724 313
557 3300009147 Ga0114129_10134165 Ga0114129_101341653 313
558 3300009147 Ga0114129_10769492 Ga0114129_107694922 313
559 3300009174 Ga0105241_10215948 Ga0105241_102159482 313
560 3300010375 Ga0105239_10289717 Ga0105239_102897172 313
561 3300025922 Ga0207646_10051464 Ga0207646_100514644 313
562 3300028380 Ga0268265_10046910 Ga0268265_100469103 313
563 3300028556 Ga0265337_1019754 Ga0265337_10197542 313
564 3300028558 Ga0265326_10023685 Ga0265326_100236852 313
565 3300028577 Ga0265318_10001824 Ga0265318_100018244 313
566 3300028577 Ga0265318_10038149 Ga0265318_100381492 313
567 3300028800 Ga0265338_10078642 Ga0265338_100786421 313
568 3300031235 Ga0265330_10027242 Ga0265330_100272423 313
569 3300031240 Ga0265320_10050827 Ga0265320_100508272 313
570 3300031247 Ga0265340_10053609 Ga0265340_100536092 313
571 3300031250 Ga0265331_10010434 Ga0265331_100104342 313
572 3300031344 Ga0265316_10028435 Ga0265316_100284352 313
573 3300031595 Ga0265313_10117572 Ga0265313_101175721 313
574 3300031691 Ga0316579_10019085 Ga0316579_100190852 313
575 3300032002 Ga0307416_100403204 Ga0307416_1004032042 313
576 3300042876 Ga0451577_0413380 Ga0451577_0413380_89_1057 313
577 3300044673 Ga0453683_0055218 Ga0453683_0055218_1286_2227 313
578 3300044712 Ga0453684_0034328 Ga0453684_0034328_5506_6456 313
579 3300044712 Ga0453684_0251748 Ga0453684_0251748_345_1286 313
580 3300045051 Ga0451576_0003866 Ga0451576_0003866_2518_3504 313
581 3300045051 Ga0451576_0008409 Ga0451576_0008409_9105_10055 313
582 3300045051 Ga0451576_0028115 Ga0451576_0028115_2447_3388 313
583 3300045051 Ga0451576_0028283 Ga0451576_0028283_2196_3137 313
584 3300045051 Ga0451576_0322011 Ga0451576_0322011_290_1231 313
585 3300046472 Ga0495580_0093791 Ga0495580_0093791_814_1776 313
586 3300049572 Ga0501036_0077420 Ga0501036_0077420_1455_2432 313
587 3300049576 Ga0501040_0141402 Ga0501040_0141402_318_1295 313
588 3300049587 Ga0501071_0101746 Ga0501071_0101746_295_1272 313
589 3300049591 Ga0501075_0037744 Ga0501075_0037744_2135_3076 313
590 3300049741 Ga0501079_0071730 Ga0501079_0071730_689_1666 313
591 3300049741 Ga0501079_0130715 Ga0501079_0130715_309_1304 313
592 3300049743 Ga0501081_0062697 Ga0501081_0062697_58_1035 313
593 3300049824 Ga0501045_0022527 Ga0501045_0022527_1105_2082 313
594 3300050507 nmdc:mga05p37_255327_c1 nmdc:mga05p37_255327_c1_427_1377 313
595 3300050507 nmdc:mga05p37_618047_c1 nmdc:mga05p37_618047_c1_141_1082 313
596 3300050507 nmdc:mga05p37_71069_c1 nmdc:mga05p37_71069_c1_1127_2131 313
597 3300050508 nmdc:mga09592_117344_c1 nmdc:mga09592_117344_c1_442_1410 313
598 3300050508 nmdc:mga09592_214597_c1 nmdc:mga09592_214597_c1_600_1604 313
599 3300050508 nmdc:mga09592_293269_c1 nmdc:mga09592_293269_c1_340_1344 313
600 3300050508 nmdc:mga09592_91762_c1 nmdc:mga09592_91762_c1_1629_2579 313
601 3300050509 nmdc:mga0qj67_118376_c1 nmdc:mga0qj67_118376_c1_567_1535 313
602 3300050509 nmdc:mga0qj67_95046_c1 nmdc:mga0qj67_95046_c1_1140_2090 313
603 3300050510 nmdc:mga06r32_11276_c1 nmdc:mga06r32_11276_c1_5271_6236 313
604 3300050510 nmdc:mga06r32_158640_c1 nmdc:mga06r32_158640_c1_431_1399 313
605 3300050512 nmdc:mga0n895_70888_c1 nmdc:mga0n895_70888_c1_1997_2938 313
606 3300050515 nmdc:mga0a205_71255_c1 nmdc:mga0a205_71255_c1_2169_3110 313
607 3300061734 Ga0530510_0116647 Ga0530510_0116647_695_1636 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

82

313

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u0g-assembly1.cif.gz_C crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei 0.9775 5 303
2ej2-assembly1.cif.gz_A crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate 0.9775 5 306
6nst-assembly1.cif.gz_B crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9772 1 304
2ej2-assembly1.cif.gz_F crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate 0.9769 4 306
2eiy-assembly1.cif.gz_A crystal structure of t.th.hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid 0.9769 5 306
ID Description Score Start End Superfamily
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.982 129 294 3.20.10.10
af_P0AB80_137_302_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9791 137 295 3.30.470.10
5mr0A02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9778 137 290 3.20.10.10
6h65B02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9762 137 290 3.20.10.10
af_I1JRF2_385_551_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9749 135 289 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A532D543-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9957 169 301 GO:0005829
GO:0008652
GO:0009082
GO:0052655
GO:0052656
AF-A0A349S5M3-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9953 172 301 GO:0005829
GO:0006532
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A532E8X2-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9947 138 301 GO:0005829
GO:0008652
GO:0009082
GO:0052655
GO:0052656
AF-A0A259LQ31-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9938 148 301 GO:0004084
GO:0005829
GO:0006532
GO:0009098
GO:0009099
AF-A0A7C7H999-F1-model_v4 Branched chain amino acid aminotransferase 0.9926 173 295 GO:0003824
GO:0005829
GO:0008652
GO:0009082

Feature Viewer

pLDDT pTM Quality
92.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map