F468636

General Info

Members Datasets Scaffolds Average Seq Length
606 259 1212 145

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0203724|Ga0501070_0203724_1072_1590
Length 172
Sequence VITPRRSSSPALGSSDEQRRGGPDKALSVVLVLNGPNLGRLGRRQPEIYGTTNHQELAALCQQWGQALGLEVRVRQTNHEGELLDWLNQAADEEVPVVLNAAAWTHYSLALYDACAQLTAPLVEVHISDPQSRPEEFRHTSVVTPHALAVFAGHGIDGYRMALEKIAATPVT

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
143 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
149 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2643221576 Nocardioides sp. Root614 Isolate Unclassified
246 2643221590 Nocardioides sp. Root682 Isolate Unclassified
247 2643221604 Nocardioides sp. Root190 Isolate Unclassified
248 2643221617 Nocardioides sp. Root79 Isolate Unclassified
249 2643221620 Nocardioides sp. Root240 Isolate Unclassified
250 2643221641 Nocardioides sp. Root122 Isolate Unclassified
251 2738541305 Nocardioides sp. CF167 Isolate Unclassified
252 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
253 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
254 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
255 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
256 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
257 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
258 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
259 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0.5
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 14.19
Nodule 0
Rhizoplane 8.09
Rhizosphere 72.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0203724 3300049586 Bacteria 1625
2 LJQas_1003538 3300000549 Bacteria 2085
3 JGI24735J21928_10068409 3300002067 Bacteria 1018
4 rootH2_10051943 3300003320 Bacteria 1064
5 rootH2_10150517 3300003320 Bacteria 1187
6 Ga0006562J51391_1158218 3300003578 Bacteria 980
7 Ga0070658_10069898 3300005327 Bacteria 2873
8 Ga0070658_10095098 3300005327 Bacteria 2459
9 Ga0070683_100126104 3300005329 Bacteria 2420
10 Ga0070683_100226253 3300005329 Bacteria 1778
11 Ga0070683_100447882 3300005329 Bacteria 1232
12 Ga0070690_101103047 3300005330 Bacteria 629
13 Ga0070666_10020888 3300005335 Bacteria 4238
14 Ga0070682_100134778 3300005337 Bacteria 1676
15 Ga0070682_100385106 3300005337 Bacteria 1056
16 Ga0068868_100395547 3300005338 Bacteria 1191
17 Ga0068868_102205460 3300005338 Bacteria 525
18 Ga0070660_100019965 3300005339 Bacteria 4916
19 Ga0070660_100044102 3300005339 Bacteria 3409
20 Ga0070660_100387008 3300005339 Bacteria 1155
21 Ga0070661_100882111 3300005344 Bacteria 738
22 Ga0070661_101382997 3300005344 Bacteria 592
23 Ga0070692_10032542 3300005345 Bacteria 2622
24 Ga0070692_10447717 3300005345 Bacteria 826
25 Ga0070692_11420478 3300005345 Bacteria 502
26 Ga0070669_100510506 3300005353 Bacteria 998
27 Ga0070675_100204382 3300005354 Bacteria 1715
28 Ga0070675_101195559 3300005354 Bacteria 700
29 Ga0070675_101204798 3300005354 Bacteria 697
30 Ga0070671_100016755 3300005355 Bacteria 5926
31 Ga0070674_101276091 3300005356 Bacteria 654
32 Ga0070673_100932494 3300005364 Bacteria 806
33 Ga0070659_100011591 3300005366 Bacteria 6526
34 Ga0070659_100609396 3300005366 Bacteria 939
35 Ga0070667_100187333 3300005367 Bacteria 1832
36 Ga0070667_100196831 3300005367 Bacteria 1787
37 Ga0070667_100314109 3300005367 Bacteria 1413
38 Ga0070667_101015349 3300005367 Bacteria 774
39 Ga0070700_100044455 3300005441 Bacteria 2736
40 Ga0070700_100849419 3300005441 Bacteria 739
41 Ga0070663_100149663 3300005455 Bacteria 1789
42 Ga0070663_100204524 3300005455 Bacteria 1543
43 Ga0070678_100757283 3300005456 Bacteria 879
44 Ga0070678_100891177 3300005456 Bacteria 813
45 Ga0070678_100934651 3300005456 Bacteria 794
46 Ga0068867_100046921 3300005459 Bacteria 3174
47 Ga0068867_100704828 3300005459 Bacteria 891
48 Ga0068867_100791056 3300005459 Bacteria 845
49 Ga0068867_101104820 3300005459 Bacteria 724
50 Ga0070685_10779637 3300005466 Bacteria 703
51 Ga0070707_100087309 3300005468 Bacteria 3017
52 Ga0070684_100006116 3300005535 Bacteria 9274
53 Ga0070684_101072205 3300005535 Bacteria 757
54 Ga0070684_101158671 3300005535 Bacteria 727
55 Ga0070684_101557390 3300005535 Bacteria 623
56 Ga0070665_100001408 3300005548 Bacteria 28272
57 Ga0070665_100231730 3300005548 Bacteria 1847
58 Ga0070665_100234578 3300005548 Bacteria 1835
59 Ga0070664_100088867 3300005564 Bacteria 2672
60 Ga0070664_100710327 3300005564 Bacteria 937
61 Ga0068857_100244072 3300005577 Bacteria 1645
62 Ga0068854_101743772 3300005578 Bacteria 570
63 Ga0068856_100808491 3300005614 Bacteria 957
64 Ga0068856_101444504 3300005614 Bacteria 702
65 Ga0070702_100250538 3300005615 Bacteria 1200
66 Ga0068852_100532119 3300005616 Bacteria 1174
67 Ga0068864_100100278 3300005618 Bacteria 2566
68 Ga0068861_100086783 3300005719 Bacteria 2461
69 Ga0068851_10147136 3300005834 Bacteria 1285
70 Ga0068870_10291250 3300005840 Bacteria 1027
71 Ga0068863_100001795 3300005841 Bacteria 21299
72 Ga0068860_100000043 3300005843 Bacteria 225862
73 Ga0068860_100002879 3300005843 Bacteria 17853
74 Ga0068860_100370731 3300005843 Bacteria 1412
75 Ga0068862_100117441 3300005844 Bacteria 2341
76 Ga0068862_100754469 3300005844 Bacteria 947
77 Ga0081455_10003050 3300005937 Bacteria 19509
78 Ga0075365_10003255 3300006038 Bacteria 8323
79 Ga0075365_10015128 3300006038 Bacteria 4660
80 Ga0075365_10021785 3300006038 Bacteria 4004
81 Ga0075365_10034886 3300006038 Bacteria 3252
82 Ga0075365_10078443 3300006038 Bacteria 2233
83 Ga0075365_10103486 3300006038 Bacteria 1951
84 Ga0075365_10122231 3300006038 Bacteria 1797
85 Ga0075365_10305234 3300006038 Bacteria 1120
86 Ga0075365_10306338 3300006038 Bacteria 1118
87 Ga0075365_10390014 3300006038 Bacteria 982
88 Ga0075365_10425941 3300006038 Bacteria 937
89 Ga0075365_10600682 3300006038 Bacteria 778
90 Ga0075365_10695401 3300006038 Bacteria 718
91 Ga0075365_10833075 3300006038 Bacteria 651
92 Ga0075368_10000275 3300006042 Bacteria 14747
93 Ga0075368_10031885 3300006042 Bacteria 2045
94 Ga0075368_10071702 3300006042 Bacteria 1400
95 Ga0075368_10204575 3300006042 Bacteria 836
96 Ga0075363_100018043 3300006048 Bacteria 3510
97 Ga0075363_100077642 3300006048 Bacteria 1812
98 Ga0075363_100245988 3300006048 Bacteria 1029
99 Ga0075363_100376769 3300006048 Bacteria 831
100 Ga0075364_10189625 3300006051 Bacteria 1392
101 Ga0075364_10236517 3300006051 Bacteria 1240
102 Ga0075364_10288566 3300006051 Bacteria 1116
103 Ga0075364_10668882 3300006051 Bacteria 709
104 Ga0075364_10738761 3300006051 Bacteria 671
105 Ga0075362_10017019 3300006177 Bacteria 2988
106 Ga0075362_10227411 3300006177 Bacteria 913
107 Ga0075367_10021521 3300006178 Bacteria 3605
108 Ga0075367_10041991 3300006178 Bacteria 2675
109 Ga0075367_10100278 3300006178 Bacteria 1769
110 Ga0075367_10206816 3300006178 Bacteria 1227
111 Ga0075370_10012167 3300006353 Bacteria 4540
112 Ga0075370_10028344 3300006353 Bacteria 3112
113 Ga0075370_10178241 3300006353 Bacteria 1250
114 Ga0075370_10271266 3300006353 Bacteria 1007
115 Ga0075370_10390119 3300006353 Bacteria 835
116 Ga0075370_10532527 3300006353 Bacteria 710
117 Ga0068865_100155677 3300006881 Bacteria 1738
118 Ga0068865_100413630 3300006881 Bacteria 1107
119 Ga0068865_100680780 3300006881 Bacteria 877
120 Ga0075435_101122565 3300007076 Bacteria 687
121 Ga0111539_12652723 3300009094 Bacteria 581
122 Ga0105245_10301667 3300009098 Bacteria 1572
123 Ga0105245_10440906 3300009098 Bacteria 1309
124 Ga0105245_10699575 3300009098 Bacteria 1047
125 Ga0105245_11022954 3300009098 Bacteria 871
126 Ga0105245_13149251 3300009098 Bacteria 511
127 Ga0114129_10733322 3300009147 Bacteria 1267
128 Ga0105243_10078758 3300009148 Bacteria 2684
129 Ga0105243_10123875 3300009148 Bacteria 2184
130 Ga0105243_10252918 3300009148 Bacteria 1574
131 Ga0105243_11216086 3300009148 Bacteria 767
132 Ga0105249_10420402 3300009553 Bacteria 1370
133 Ga0105249_10568524 3300009553 Bacteria 1186
134 Ga0105249_11080372 3300009553 Bacteria 872
135 Ga0105239_10081372 3300010375 Bacteria 3565
136 Ga0105239_10581261 3300010375 Bacteria 1277
137 Ga0105239_10716922 3300010375 Bacteria 1144
138 Ga0105246_10677544 3300011119 Bacteria 901
139 Ga0105246_11361132 3300011119 Bacteria 660
140 Ga0157342_1027801 3300012507 Bacteria 696
141 Ga0157371_10271250 3300013102 Bacteria 1224
142 Ga0157371_10636938 3300013102 Bacteria 795
143 Ga0157369_10821874 3300013105 Bacteria 954
144 Ga0157374_10524675 3300013296 Bacteria 1190
145 Ga0157374_12084391 3300013296 Bacteria 594
146 Ga0163162_10185153 3300013306 Bacteria 2209
147 Ga0163162_11241387 3300013306 Bacteria 846
148 Ga0163162_13369505 3300013306 Bacteria 511
149 Ga0157372_10251663 3300013307 Bacteria 2051
150 Ga0157372_10465818 3300013307 Bacteria 1473
151 Ga0157372_11313956 3300013307 Bacteria 834
152 Ga0157375_10070849 3300013308 Bacteria 3498
153 Ga0157375_10647090 3300013308 Bacteria 1213
154 Ga0157375_11492145 3300013308 Bacteria 798
155 Ga0157375_11886820 3300013308 Bacteria 709
156 Ga0157375_13699120 3300013308 Bacteria 508
157 Ga0163163_10089406 3300014325 Bacteria 3092
158 Ga0163163_10924131 3300014325 Bacteria 936
159 Ga0163163_11608024 3300014325 Bacteria 711
160 Ga0182008_10033226 3300014497 Bacteria 2589
161 Ga0182008_10111086 3300014497 Bacteria 1358
162 Ga0182008_10268772 3300014497 Bacteria 884
163 Ga0157377_10068390 3300014745 Bacteria 2047
164 Ga0157379_10050573 3300014968 Bacteria 3711
165 Ga0157379_10953498 3300014968 Bacteria 816
166 Ga0157379_11052655 3300014968 Bacteria 778
167 Ga0157376_10656640 3300014969 Bacteria 1050
168 Ga0157376_12158425 3300014969 Bacteria 596
169 Ga0163161_10007315 3300017792 Bacteria 7619
170 Ga0163161_10267575 3300017792 Bacteria 1336
171 Ga0206353_11090623 3300020082 Bacteria 3353
172 Ga0213873_10000212 3300021358 Bacteria 10312
173 Ga0213875_10000079 3300021388 Bacteria 114698
174 Ga0213875_10302308 3300021388 Bacteria 757
175 Ga0224712_10034576 3300022467 Bacteria 1860
176 Ga0207642_10954326 3300025899 Bacteria 551
177 Ga0207688_10700319 3300025901 Bacteria 640
178 Ga0207680_10005979 3300025903 Bacteria 5847
179 Ga0207647_10014304 3300025904 Bacteria 5473
180 Ga0207705_10056162 3300025909 Bacteria 2838
181 Ga0207705_10094313 3300025909 Bacteria 2195
182 Ga0207671_10447989 3300025914 Bacteria 1028
183 Ga0207662_10302433 3300025918 Bacteria 1064
184 Ga0207657_10036453 3300025919 Bacteria 4402
185 Ga0207657_10038575 3300025919 Bacteria 4251
186 Ga0207657_10178826 3300025919 Bacteria 1716
187 Ga0207652_10390950 3300025921 Bacteria 1255
188 Ga0207659_10235469 3300025926 Bacteria 1479
189 Ga0207687_11200116 3300025927 Bacteria 652
190 Ga0207644_10158650 3300025931 Bacteria 1756
191 Ga0207644_10402066 3300025931 Bacteria 1120
192 Ga0207690_10068287 3300025932 Bacteria 2441
193 Ga0207690_10350223 3300025932 Bacteria 1168
194 Ga0207706_10036060 3300025933 Bacteria 4394
195 Ga0207706_11033439 3300025933 Bacteria 689
196 Ga0207686_10395201 3300025934 Bacteria 1052
197 Ga0207709_10140373 3300025935 Bacteria 1660
198 Ga0207670_11228900 3300025936 Bacteria 634
199 Ga0207670_11917079 3300025936 Bacteria 504
200 Ga0207669_10468647 3300025937 Bacteria 1002
201 Ga0207704_10091877 3300025938 Bacteria 1996
202 Ga0207704_10164514 3300025938 Bacteria 1583
203 Ga0207665_10361786 3300025939 Bacteria 1097
204 Ga0207711_11682734 3300025941 Bacteria 578
205 Ga0207689_10486777 3300025942 Bacteria 1033
206 Ga0207689_10520938 3300025942 Bacteria 997
207 Ga0207661_10024446 3300025944 Bacteria 4580
208 Ga0207661_10034445 3300025944 Bacteria 3938
209 Ga0207661_10127886 3300025944 Bacteria 2172
210 Ga0207661_10693079 3300025944 Bacteria 937
211 Ga0207661_10924200 3300025944 Bacteria 804
212 Ga0207679_10100091 3300025945 Bacteria 2265
213 Ga0207679_10651630 3300025945 Bacteria 952
214 Ga0207679_11449954 3300025945 Bacteria 630
215 Ga0207667_10287919 3300025949 Bacteria 1679
216 Ga0207667_11199004 3300025949 Bacteria 739
217 Ga0207651_11601255 3300025960 Bacteria 587
218 Ga0207712_10306419 3300025961 Bacteria 1305
219 Ga0207712_10694277 3300025961 Bacteria 888
220 Ga0207712_11520006 3300025961 Bacteria 600
221 Ga0207668_10454709 3300025972 Bacteria 1094
222 Ga0207640_11460563 3300025981 Bacteria 614
223 Ga0207658_10191645 3300025986 Bacteria 1700
224 Ga0207658_10379663 3300025986 Bacteria 1237
225 Ga0207677_10779777 3300026023 Bacteria 854
226 Ga0207703_10005342 3300026035 Bacteria 10346
227 Ga0207703_10126648 3300026035 Bacteria 2200
228 Ga0207678_10088459 3300026067 Bacteria 2647
229 Ga0207678_10342866 3300026067 Bacteria 1288
230 Ga0207708_10021675 3300026075 Bacteria 4846
231 Ga0207708_10748157 3300026075 Bacteria 839
232 Ga0207708_11378632 3300026075 Bacteria 618
233 Ga0207702_10254532 3300026078 Bacteria 1650
234 Ga0207702_10690123 3300026078 Bacteria 1006
235 Ga0207702_11284840 3300026078 Bacteria 726
236 Ga0207702_11302787 3300026078 Bacteria 720
237 Ga0207641_10002966 3300026088 Bacteria 15352
238 Ga0207648_10003443 3300026089 Bacteria 16597
239 Ga0207648_10815404 3300026089 Bacteria 869
240 Ga0207676_10075090 3300026095 Bacteria 2726
241 Ga0207676_10523928 3300026095 Bacteria 1129
242 Ga0207674_10286621 3300026116 Bacteria 1595
243 Ga0207674_11654603 3300026116 Bacteria 608
244 Ga0207675_100041053 3300026118 Bacteria 4321
245 Ga0207675_100065912 3300026118 Bacteria 3384
246 Ga0207675_100185323 3300026118 Bacteria 1994
247 Ga0207683_10060869 3300026121 Bacteria 3320
248 Ga0207683_11136293 3300026121 Bacteria 724
249 Ga0207698_10704996 3300026142 Bacteria 1005
250 Ga0209813_10001318 3300027866 Bacteria 5554
251 Ga0209813_10002378 3300027866 Bacteria 4316
252 Ga0268266_10001171 3300028379 Bacteria 32402
253 Ga0268266_10085012 3300028379 Bacteria 2764
254 Ga0268266_10272340 3300028379 Bacteria 1572
255 Ga0268265_10226427 3300028380 Bacteria 1640
256 Ga0268265_11464285 3300028380 Bacteria 686
257 Ga0268264_10000027 3300028381 Bacteria 440852
258 Ga0268264_10001770 3300028381 Bacteria 19745
259 Ga0268264_10429566 3300028381 Bacteria 1275
260 Ga0316181_1110179 3300030744 Bacteria 1401
261 Ga0316181_1151896 3300030744 Bacteria 730
262 Ga0316182_1158283 3300030745 Bacteria 1650
263 Ga0307405_10464522 3300031731 Bacteria 1007
264 Ga0307413_11394357 3300031824 Bacteria 616
265 Ga0307410_10044113 3300031852 Bacteria 2960
266 Ga0307410_10940671 3300031852 Bacteria 742
267 Ga0307407_10037189 3300031903 Bacteria 2688
268 Ga0307407_10055759 3300031903 Bacteria 2285
269 Ga0307407_10232917 3300031903 Bacteria 1252
270 Ga0307407_10268733 3300031903 Bacteria 1176
271 Ga0307407_10462278 3300031903 Bacteria 923
272 Ga0307407_10543199 3300031903 Bacteria 858
273 Ga0307412_10115804 3300031911 Bacteria 1922
274 Ga0307412_10653500 3300031911 Bacteria 897
275 Ga0307409_100298512 3300031995 Bacteria 1497
276 Ga0307409_100411449 3300031995 Bacteria 1295
277 Ga0307409_100676202 3300031995 Bacteria 1029
278 Ga0307409_100806699 3300031995 Bacteria 946
279 Ga0307409_100908974 3300031995 Bacteria 894
280 Ga0307416_100003769 3300032002 Bacteria 8994
281 Ga0307416_100042058 3300032002 Bacteria 3564
282 Ga0307416_100613029 3300032002 Bacteria 1169
283 Ga0307416_101303260 3300032002 Bacteria 832
284 Ga0307411_10331117 3300032005 Bacteria 1234
285 Ga0307411_10734831 3300032005 Bacteria 863
286 Ga0307411_11128530 3300032005 Bacteria 708
287 Ga0307415_100063889 3300032126 Bacteria 2560
288 Ga0307415_100273063 3300032126 Bacteria 1386
289 Ga0307415_101277058 3300032126 Bacteria 694
290 Ga0373962_0183219 3300035242 Bacteria 701
291 Ga0395900_0578704 3300037418 Bacteria 1065
292 Ga0395900_0611140 3300037418 Bacteria 1030
293 Ga0395900_1671340 3300037418 Bacteria 548
294 Ga0395898_0014276 3300037466 Bacteria 8162
295 Ga0395898_0802729 3300037466 Bacteria 881
296 Ga0395898_1359544 3300037466 Bacteria 639
297 Ga0436364_0493174 3300037853 Bacteria 1112
298 Ga0436364_0812095 3300037853 Bacteria 152428
299 Ga0395901_0056137 3300038443 Bacteria 4097
300 Ga0395901_0069525 3300038443 Bacteria 3667
301 Ga0395901_0802676 3300038443 Bacteria 930
302 Ga0395901_1282910 3300038443 Bacteria 695
303 Ga0436365_1323783 3300039437 Bacteria 5965
304 Ga0436365_1424412 3300039437 Bacteria 7308
305 Ga0436365_1902545 3300039437 Bacteria 1895
306 Ga0436362_0827280 3300039453 Bacteria 14089
307 Ga0439436_0046354 3300041404 Bacteria 1236
308 Ga0439438_019680 3300041405 Bacteria 1906
309 Ga0439447_041552 3300041407 Bacteria 1119
310 Ga0439461_0014520 3300041410 Bacteria 1499
311 Ga0439466_0256961 3300041411 Bacteria 529
312 Ga0439465_0022613 3300041413 Bacteria 1976
313 Ga0439465_0033785 3300041413 Bacteria 1636
314 Ga0439465_0098486 3300041413 Bacteria 1007
315 Ga0439465_0152571 3300041413 Bacteria 826
316 Ga0451791_1516584 3300041451 Bacteria 654
317 Ga0451797_0463566 3300041453 Bacteria 836
318 Ga0451797_0892603 3300041453 Bacteria 602
319 Ga0451798_0403468 3300041458 Bacteria 573
320 Ga0451800_1365070 3300041459 Bacteria 969
321 Ga0451806_763312 3300041462 Bacteria 788
322 Ga0451807_0903062 3300041486 Bacteria 775
323 Ga0451807_1226135 3300041486 Bacteria 831
324 Ga0451833_0618061 3300041491 Bacteria 2285
325 Ga0451837_0032520 3300041494 Bacteria 784
326 Ga0451837_1692105 3300041494 Bacteria 1623
327 Ga0451839_0202603 3300041496 Bacteria 2306
328 Ga0451855_0340058 3300041511 Bacteria 586
329 Ga0451853_2701301 3300041512 Bacteria 869
330 Ga0451853_3745626 3300041512 Bacteria 745
331 Ga0439431_0041983 3300041997 Bacteria 1167
332 Ga0439442_035175 3300042002 Bacteria 1047
333 Ga0439445_0167343 3300042004 Bacteria 643
334 Ga0439432_063582 3300042006 Bacteria 1134
335 Ga0439434_0003966 3300042435 Bacteria 4319
336 Ga0439464_0033388 3300042439 Bacteria 1449
337 Ga0466972_0041294 3300044658 Bacteria 2246
338 Ga0466972_0142183 3300044658 Bacteria 1129
339 Ga0466972_0212537 3300044658 Bacteria 905
340 Ga0466965_0018939 3300044683 Bacteria 3304
341 Ga0466965_0062498 3300044683 Bacteria 1863
342 Ga0466965_0266090 3300044683 Bacteria 922
343 Ga0466965_0323939 3300044683 Bacteria 840
344 Ga0466966_0001654 3300044684 Bacteria 14373
345 Ga0466966_0195719 3300044684 Bacteria 1224
346 Ga0466966_0206840 3300044684 Bacteria 1187
347 Ga0466961_0016597 3300044693 Bacteria 4735
348 Ga0466961_0062208 3300044693 Bacteria 2372
349 Ga0466961_0139796 3300044693 Bacteria 1516
350 Ga0466961_0241494 3300044693 Bacteria 1110
351 Ga0466961_0244250 3300044693 Bacteria 1103
352 Ga0466961_0449122 3300044693 Bacteria 780
353 Ga0466961_0493312 3300044693 Bacteria 740
354 Ga0466963_0000014 3300044694 Bacteria 62519
355 Ga0466963_0019825 3300044694 Bacteria 4223
356 Ga0466963_0128625 3300044694 Bacteria 1748
357 Ga0466963_0162579 3300044694 Bacteria 1554
358 Ga0466963_0320921 3300044694 Bacteria 1090
359 Ga0466963_0320933 3300044694 Bacteria 1090
360 Ga0466963_0331727 3300044694 Bacteria 1071
361 Ga0466963_0346851 3300044694 Bacteria 1045
362 Ga0466963_0817239 3300044694 Bacteria 657
363 Ga0466964_0040215 3300044706 Bacteria 1887
364 Ga0466964_0178891 3300044706 Bacteria 1004
365 Ga0466964_0202899 3300044706 Bacteria 953
366 Ga0466971_0036426 3300044719 Bacteria 2206
367 Ga0466971_0193359 3300044719 Bacteria 959
368 Ga0466971_0505988 3300044719 Bacteria 596
369 Ga0466971_0517165 3300044719 Bacteria 590
370 Ga0466970_0018644 3300044765 Bacteria 3595
371 Ga0466970_0067805 3300044765 Bacteria 1916
372 Ga0466970_0186920 3300044765 Bacteria 1150
373 Ga0466970_0286217 3300044765 Bacteria 927
374 Ga0466970_0289419 3300044765 Bacteria 922
375 Ga0466970_0294629 3300044765 Bacteria 914
376 Ga0466970_0439479 3300044765 Bacteria 747
377 Ga0466957_0001217 3300044842 Bacteria 13421
378 Ga0466957_0009450 3300044842 Bacteria 5566
379 Ga0466957_0013716 3300044842 Bacteria 4706
380 Ga0466957_0303359 3300044842 Bacteria 1073
381 Ga0466957_0904518 3300044842 Bacteria 631
382 Ga0466960_0015018 3300044901 Bacteria 3331
383 Ga0466960_0016088 3300044901 Bacteria 3238
384 Ga0466960_0047754 3300044901 Bacteria 2054
385 Ga0466960_0217244 3300044901 Bacteria 1051
386 Ga0466960_0294517 3300044901 Bacteria 913
387 Ga0466960_0384018 3300044901 Bacteria 806
388 Ga0466960_1054388 3300044901 Bacteria 501
389 Ga0466959_0162845 3300045049 Bacteria 1567
390 Ga0466958_0000257 3300045836 Bacteria 20547
391 Ga0466958_0024910 3300045836 Bacteria 3523
392 Ga0466958_0275254 3300045836 Bacteria 1078
393 Ga0466967_0015695 3300045976 Bacteria 5948
394 Ga0466967_0039656 3300045976 Bacteria 4051
395 Ga0466967_0047745 3300045976 Bacteria 3734
396 Ga0466967_0066979 3300045976 Bacteria 3201
397 Ga0466967_0097695 3300045976 Bacteria 2680
398 Ga0466967_0110226 3300045976 Bacteria 2528
399 Ga0466967_0127945 3300045976 Bacteria 2355
400 Ga0466967_0131620 3300045976 Bacteria 2323
401 Ga0466967_0153408 3300045976 Bacteria 2155
402 Ga0466967_0510335 3300045976 Bacteria 1181
403 Ga0466967_1041446 3300045976 Bacteria 815
404 Ga0466967_1833689 3300045976 Bacteria 604
405 Ga0466967_2077376 3300045976 Bacteria 564
406 Ga0495603_0071522 3300046455 Bacteria 2039
407 Ga0495641_0178226 3300046461 Bacteria 951
408 Ga0495639_0462274 3300046475 Bacteria 645
409 Ga0495620_0077171 3300046515 Bacteria 1353
410 Ga0495667_0284258 3300046559 Bacteria 1050
411 Ga0495658_0766093 3300046683 Bacteria 618
412 Ga0495670_0506513 3300046691 Bacteria 656
413 Ga0495676_1056338 3300047321 Bacteria 517
414 Ga0495680_0271546 3300047322 Bacteria 1197
415 Ga0495614_0362086 3300048089 Bacteria 677
416 Ga0496100_0077002 3300048903 Bacteria 2241
417 Ga0496101_0065131 3300048904 Bacteria 2656
418 Ga0496101_0090567 3300048904 Bacteria 2275
419 Ga0496101_1082611 3300048904 Bacteria 630
420 Ga0496102_0119388 3300048905 Bacteria 2462
421 Ga0496102_0131610 3300048905 Bacteria 2342
422 Ga0496102_0141817 3300048905 Bacteria 2253
423 Ga0496102_0227066 3300048905 Bacteria 1760
424 Ga0496102_0287654 3300048905 Bacteria 1549
425 Ga0496102_0307099 3300048905 Bacteria 1495
426 Ga0496103_0020498 3300048906 Bacteria 3971
427 Ga0496103_0122947 3300048906 Bacteria 1654
428 Ga0496103_0229564 3300048906 Bacteria 1194
429 Ga0496103_0286176 3300048906 Bacteria 1060
430 Ga0496104_0184657 3300048907 Bacteria 1996
431 Ga0496105_0001223 3300048908 Bacteria 17907
432 Ga0496106_0033977 3300048909 Bacteria 3807
433 Ga0496107_0037831 3300048910 Bacteria 3463
434 Ga0496107_0061624 3300048910 Bacteria 2716
435 Ga0496107_0268571 3300048910 Bacteria 1270
436 Ga0496107_0296848 3300048910 Bacteria 1203
437 Ga0496108_0036606 3300048911 Bacteria 4084
438 Ga0496108_0050759 3300048911 Bacteria 3473
439 Ga0496108_0090516 3300048911 Bacteria 2601
440 Ga0496109_0030734 3300048912 Bacteria 4814
441 Ga0496109_0040098 3300048912 Bacteria 4241
442 Ga0496109_0069340 3300048912 Bacteria 3233
443 Ga0496109_0246172 3300048912 Bacteria 1683
444 Ga0496110_0040613 3300048913 Bacteria 4055
445 Ga0496110_0943990 3300048913 Bacteria 769
446 Ga0496110_1325412 3300048913 Bacteria 629
447 Ga0496111_0180759 3300048914 Bacteria 1568
448 Ga0496111_0778023 3300048914 Bacteria 693
449 Ga0496112_0780700 3300048915 Bacteria 881
450 Ga0496113_0917469 3300048916 Bacteria 692
451 Ga0496113_1120539 3300048916 Bacteria 617
452 Ga0496114_0026671 3300048917 Bacteria 4732
453 Ga0496114_0038923 3300048917 Bacteria 3935
454 Ga0496114_0183049 3300048917 Bacteria 1830
455 Ga0496115_0057866 3300048918 Bacteria 3118
456 Ga0496115_0143464 3300048918 Bacteria 1970
457 Ga0496124_0249545 3300048927 Bacteria 1314
458 Ga0501033_0389043 3300049570 Bacteria 974
459 Ga0501034_0039025 3300049571 Bacteria 4810
460 Ga0501034_0474763 3300049571 Bacteria 1166
461 Ga0501037_0354463 3300049573 Bacteria 1012
462 Ga0501037_0454227 3300049573 Bacteria 874
463 Ga0501037_1043065 3300049573 Bacteria 531
464 Ga0501038_0304496 3300049574 Bacteria 1250
465 Ga0501038_0931750 3300049574 Bacteria 640
466 Ga0501039_0021684 3300049575 Bacteria 4929
467 Ga0501039_0069472 3300049575 Bacteria 2736
468 Ga0501039_0281569 3300049575 Bacteria 1307
469 Ga0501039_0574558 3300049575 Bacteria 884
470 Ga0501040_0248719 3300049576 Bacteria 1268
471 Ga0501040_1144915 3300049576 Bacteria 564
472 Ga0501041_0014930 3300049577 Bacteria 4612
473 Ga0501041_0180020 3300049577 Bacteria 1323
474 Ga0501042_0067433 3300049578 Bacteria 2558
475 Ga0501042_0210949 3300049578 Bacteria 1401
476 Ga0501042_1030901 3300049578 Bacteria 600
477 Ga0501042_1286943 3300049578 Bacteria 533
478 Ga0501048_0686367 3300049582 Bacteria 735
479 Ga0501067_0000434 3300049583 Bacteria 22861
480 Ga0501067_0006928 3300049583 Bacteria 6288
481 Ga0501067_0050351 3300049583 Bacteria 2308
482 Ga0501067_0176006 3300049583 Bacteria 1191
483 Ga0501067_0221849 3300049583 Bacteria 1053
484 Ga0501067_0672673 3300049583 Bacteria 581
485 Ga0501068_0004332 3300049584 Bacteria 7715
486 Ga0501068_0053210 3300049584 Bacteria 2450
487 Ga0501068_0080724 3300049584 Bacteria 1996
488 Ga0501068_0122536 3300049584 Bacteria 1622
489 Ga0501068_0176011 3300049584 Bacteria 1352
490 Ga0501068_0226865 3300049584 Bacteria 1187
491 Ga0501069_0011868 3300049585 Bacteria 4620
492 Ga0501069_0087028 3300049585 Bacteria 1764
493 Ga0501069_0113195 3300049585 Bacteria 1547
494 Ga0501069_0203833 3300049585 Bacteria 1147
495 Ga0501069_0229016 3300049585 Bacteria 1082
496 Ga0501069_0251651 3300049585 Bacteria 1031
497 Ga0501069_0303474 3300049585 Bacteria 937
498 Ga0501070_0036002 3300049586 Bacteria 4133
499 Ga0501070_0060746 3300049586 Bacteria 3132
500 Ga0501070_0386683 3300049586 Bacteria 1133
501 Ga0501070_0400228 3300049586 Bacteria 1110
502 Ga0501070_0469868 3300049586 Bacteria 1012
503 Ga0501070_0548003 3300049586 Bacteria 926
504 Ga0501070_1098710 3300049586 Bacteria 613
505 Ga0501071_0004791 3300049587 Bacteria 8616
506 Ga0501071_0187114 3300049587 Bacteria 1552
507 Ga0501071_0247617 3300049587 Bacteria 1345
508 Ga0501071_0806656 3300049587 Bacteria 724
509 Ga0501072_0118173 3300049588 Bacteria 2112
510 Ga0501073_0006712 3300049589 Bacteria 8567
511 Ga0501074_0000659 3300049590 Bacteria 21547
512 Ga0501074_0180263 3300049590 Bacteria 1507
513 Ga0501074_0799659 3300049590 Bacteria 664
514 Ga0501075_0314756 3300049591 Bacteria 1193
515 Ga0501075_0326681 3300049591 Bacteria 1169
516 Ga0501075_0507677 3300049591 Bacteria 920
517 Ga0501076_0036376 3300049592 Bacteria 3858
518 Ga0501076_0775899 3300049592 Bacteria 791
519 Ga0501077_0038125 3300049593 Bacteria 3059
520 Ga0501077_0357872 3300049593 Bacteria 932
521 Ga0501079_0129915 3300049741 Bacteria 1960
522 Ga0501079_0372736 3300049741 Bacteria 1119
523 Ga0501080_0081397 3300049742 Bacteria 3008
524 Ga0501080_0230335 3300049742 Bacteria 1694
525 Ga0501080_0607284 3300049742 Bacteria 971
526 Ga0501080_0681599 3300049742 Bacteria 908
527 Ga0501081_0304873 3300049743 Bacteria 1169
528 Ga0501081_0371276 3300049743 Bacteria 1056
529 Ga0501081_0442664 3300049743 Bacteria 965
530 Ga0501081_0816513 3300049743 Bacteria 702
531 Ga0501083_0076350 3300049744 Bacteria 2224
532 Ga0501035_0211343 3300049822 Bacteria 1660
533 Ga0501045_0077873 3300049824 Bacteria 2444
534 nmdc:mga03683_12106_c1 3300050489 Bacteria 3141
535 nmdc:mga03n38_110961_c1 3300050490 Bacteria 1335
536 nmdc:mga03n38_142048_c1 3300050490 Bacteria 1200
537 nmdc:mga03n38_15687_c1 3300050490 Bacteria 2930
538 nmdc:mga03n38_213519_c1 3300050490 Bacteria 1004
539 nmdc:mga03n38_349291_c1 3300050490 Bacteria 805
540 nmdc:mga03n38_74952_c1 3300050490 Bacteria 1575
541 nmdc:mga00v17_20172_c1 3300050491 Bacteria 3816
542 nmdc:mga00v17_295449_c1 3300050491 Bacteria 1052
543 nmdc:mga00v17_323728_c1 3300050491 Bacteria 1002
544 nmdc:mga00v17_423104_c1 3300050491 Bacteria 865
545 nmdc:mga00v17_46551_c1 3300050491 Bacteria 2624
546 nmdc:mga00v17_6293_c2 3300050491 Bacteria 3802
547 nmdc:mga00v17_77633_c1 3300050491 Bacteria 2068
548 nmdc:mga0yw44_1114161_c1 3300050492 Bacteria 533
549 nmdc:mga0yw44_128414_c1 3300050492 Bacteria 1639
550 nmdc:mga0yw44_153014_c1 3300050492 Bacteria 1506
551 nmdc:mga0yw44_219488_c1 3300050492 Bacteria 1260
552 nmdc:mga0yw44_265289_c1 3300050492 Bacteria 1145
553 nmdc:mga0yw44_276516_c1 3300050492 Bacteria 1122
554 nmdc:mga0yw44_45566_c1 3300050492 Bacteria 2630
555 nmdc:mga0yw44_4724_c2 3300050492 Bacteria 5940
556 nmdc:mga0yw44_481565_c1 3300050492 Bacteria 842
557 nmdc:mga0yw44_48821_c1 3300050492 Bacteria 2553
558 nmdc:mga0yw44_9080_c1 3300050492 Bacteria 4999
559 nmdc:mga0yw44_973906_c1 3300050492 Bacteria 574
560 nmdc:mga0yw44_995750_c1 3300050492 Bacteria 567
561 nmdc:mga06z11_11461_c1 3300050494 Bacteria 3825
562 nmdc:mga06z11_162979_c1 3300050494 Bacteria 1275
563 nmdc:mga06z11_244109_c1 3300050494 Bacteria 1056
564 nmdc:mga06z11_34802_c1 3300050494 Bacteria 2474
565 nmdc:mga06z11_441647_c1 3300050494 Bacteria 785
566 nmdc:mga04h51_1471_c1 3300050495 Bacteria 5446
567 nmdc:mga04h51_17210_c1 3300050495 Bacteria 2111
568 nmdc:mga07m45_119735_c1 3300050496 Bacteria 1520
569 nmdc:mga07m45_122452_c1 3300050496 Bacteria 1502
570 nmdc:mga07m45_157771_c1 3300050496 Bacteria 1317
571 nmdc:mga07m45_182804_c1 3300050496 Bacteria 1219
572 nmdc:mga07m45_238731_c1 3300050496 Bacteria 1058
573 nmdc:mga07m45_268795_c1 3300050496 Bacteria 992
574 nmdc:mga07m45_367997_c1 3300050496 Bacteria 835
575 nmdc:mga07m45_51553_c1 3300050496 Bacteria 2321
576 nmdc:mga08y16_664612_c1 3300050511 Bacteria 1045
577 Ga0495619_0043837 3300053085 Bacteria 2934
578 Ga0495619_0480001 3300053085 Bacteria 856
579 Ga0500644_0005326 3300053088 Bacteria 3246
580 Ga0500556_0001967 3300053104 Bacteria 7255
581 Ga0500573_0414980 3300053140 Bacteria 633
582 Ga0501084_0022003 3300054114 Bacteria 5319
583 Ga0501084_0420487 3300054114 Bacteria 1130
584 Ga0501082_0021346 3300060353 Bacteria 5586
585 Ga0501082_0697106 3300060353 Bacteria 889
586 Ga0501082_0811243 3300060353 Bacteria 819
587 Ga0466962_0005074 3300061719 Bacteria 6334
588 Ga0466962_0009107 3300061719 Bacteria 4755
589 Ga0466962_0073165 3300061719 Bacteria 1638
590 Ga0466962_0591783 3300061719 Bacteria 565
591 Ga0530510_0884496 3300061734 Bacteria 682
592 2643891656 2643221576 Bacteria 5214352
593 2643960704 2643221590 Bacteria 5214697
594 2644035780 2643221604 Bacteria 5014917
595 2644102324 2643221617 Bacteria 5139111
596 2644115548 2643221620 Bacteria 5134593
597 2644229309 2643221641 Bacteria 4490190
598 2738868108 2738541305 Bacteria 4910150
599 2774392307 2773857762 Bacteria 5971770
600 2809196112 2808606439 Bacteria 5952208
601 2812333160 2811994874 Bacteria 5367947
602 2812351761 2811994878 Bacteria 5992952
603 2855386930 2855386786 Bacteria 4752232
604 2857484645 2857481737 Bacteria 4761446
605 2891970612 2891968417 Bacteria 5821697
606 2990260373 2990256926 Bacteria 4252839
607 Ga0501070_0203724
608 LJQas_1003538
609 JGI24735J21928_10068409
610 rootH2_10051943
611 rootH2_10150517
612 Ga0006562J51391_1158218
613 Ga0070658_10069898
614 Ga0070658_10095098
615 Ga0070683_100126104
616 Ga0070683_100226253
617 Ga0070683_100447882
618 Ga0070690_101103047
619 Ga0070666_10020888
620 Ga0070682_100134778
621 Ga0070682_100385106
622 Ga0068868_100395547
623 Ga0068868_102205460
624 Ga0070660_100019965
625 Ga0070660_100044102
626 Ga0070660_100387008
627 Ga0070661_100882111
628 Ga0070661_101382997
629 Ga0070692_10032542
630 Ga0070692_10447717
631 Ga0070692_11420478
632 Ga0070669_100510506
633 Ga0070675_100204382
634 Ga0070675_101195559
635 Ga0070675_101204798
636 Ga0070671_100016755
637 Ga0070674_101276091
638 Ga0070673_100932494
639 Ga0070659_100011591
640 Ga0070659_100609396
641 Ga0070667_100187333
642 Ga0070667_100196831
643 Ga0070667_100314109
644 Ga0070667_101015349
645 Ga0070700_100044455
646 Ga0070700_100849419
647 Ga0070663_100149663
648 Ga0070663_100204524
649 Ga0070678_100757283
650 Ga0070678_100891177
651 Ga0070678_100934651
652 Ga0068867_100046921
653 Ga0068867_100704828
654 Ga0068867_100791056
655 Ga0068867_101104820
656 Ga0070685_10779637
657 Ga0070707_100087309
658 Ga0070684_100006116
659 Ga0070684_101072205
660 Ga0070684_101158671
661 Ga0070684_101557390
662 Ga0070665_100001408
663 Ga0070665_100231730
664 Ga0070665_100234578
665 Ga0070664_100088867
666 Ga0070664_100710327
667 Ga0068857_100244072
668 Ga0068854_101743772
669 Ga0068856_100808491
670 Ga0068856_101444504
671 Ga0070702_100250538
672 Ga0068852_100532119
673 Ga0068864_100100278
674 Ga0068861_100086783
675 Ga0068851_10147136
676 Ga0068870_10291250
677 Ga0068863_100001795
678 Ga0068860_100000043
679 Ga0068860_100002879
680 Ga0068860_100370731
681 Ga0068862_100117441
682 Ga0068862_100754469
683 Ga0081455_10003050
684 Ga0075365_10003255
685 Ga0075365_10015128
686 Ga0075365_10021785
687 Ga0075365_10034886
688 Ga0075365_10078443
689 Ga0075365_10103486
690 Ga0075365_10122231
691 Ga0075365_10305234
692 Ga0075365_10306338
693 Ga0075365_10390014
694 Ga0075365_10425941
695 Ga0075365_10600682
696 Ga0075365_10695401
697 Ga0075365_10833075
698 Ga0075368_10000275
699 Ga0075368_10031885
700 Ga0075368_10071702
701 Ga0075368_10204575
702 Ga0075363_100018043
703 Ga0075363_100077642
704 Ga0075363_100245988
705 Ga0075363_100376769
706 Ga0075364_10189625
707 Ga0075364_10236517
708 Ga0075364_10288566
709 Ga0075364_10668882
710 Ga0075364_10738761
711 Ga0075362_10017019
712 Ga0075362_10227411
713 Ga0075367_10021521
714 Ga0075367_10041991
715 Ga0075367_10100278
716 Ga0075367_10206816
717 Ga0075370_10012167
718 Ga0075370_10028344
719 Ga0075370_10178241
720 Ga0075370_10271266
721 Ga0075370_10390119
722 Ga0075370_10532527
723 Ga0068865_100155677
724 Ga0068865_100413630
725 Ga0068865_100680780
726 Ga0075435_101122565
727 Ga0111539_12652723
728 Ga0105245_10301667
729 Ga0105245_10440906
730 Ga0105245_10699575
731 Ga0105245_11022954
732 Ga0105245_13149251
733 Ga0114129_10733322
734 Ga0105243_10078758
735 Ga0105243_10123875
736 Ga0105243_10252918
737 Ga0105243_11216086
738 Ga0105249_10420402
739 Ga0105249_10568524
740 Ga0105249_11080372
741 Ga0105239_10081372
742 Ga0105239_10581261
743 Ga0105239_10716922
744 Ga0105246_10677544
745 Ga0105246_11361132
746 Ga0157342_1027801
747 Ga0157371_10271250
748 Ga0157371_10636938
749 Ga0157369_10821874
750 Ga0157374_10524675
751 Ga0157374_12084391
752 Ga0163162_10185153
753 Ga0163162_11241387
754 Ga0163162_13369505
755 Ga0157372_10251663
756 Ga0157372_10465818
757 Ga0157372_11313956
758 Ga0157375_10070849
759 Ga0157375_10647090
760 Ga0157375_11492145
761 Ga0157375_11886820
762 Ga0157375_13699120
763 Ga0163163_10089406
764 Ga0163163_10924131
765 Ga0163163_11608024
766 Ga0182008_10033226
767 Ga0182008_10111086
768 Ga0182008_10268772
769 Ga0157377_10068390
770 Ga0157379_10050573
771 Ga0157379_10953498
772 Ga0157379_11052655
773 Ga0157376_10656640
774 Ga0157376_12158425
775 Ga0163161_10007315
776 Ga0163161_10267575
777 Ga0206353_11090623
778 Ga0213873_10000212
779 Ga0213875_10000079
780 Ga0213875_10302308
781 Ga0224712_10034576
782 Ga0207642_10954326
783 Ga0207688_10700319
784 Ga0207680_10005979
785 Ga0207647_10014304
786 Ga0207705_10056162
787 Ga0207705_10094313
788 Ga0207671_10447989
789 Ga0207662_10302433
790 Ga0207657_10036453
791 Ga0207657_10038575
792 Ga0207657_10178826
793 Ga0207652_10390950
794 Ga0207659_10235469
795 Ga0207687_11200116
796 Ga0207644_10158650
797 Ga0207644_10402066
798 Ga0207690_10068287
799 Ga0207690_10350223
800 Ga0207706_10036060
801 Ga0207706_11033439
802 Ga0207686_10395201
803 Ga0207709_10140373
804 Ga0207670_11228900
805 Ga0207670_11917079
806 Ga0207669_10468647
807 Ga0207704_10091877
808 Ga0207704_10164514
809 Ga0207665_10361786
810 Ga0207711_11682734
811 Ga0207689_10486777
812 Ga0207689_10520938
813 Ga0207661_10024446
814 Ga0207661_10034445
815 Ga0207661_10127886
816 Ga0207661_10693079
817 Ga0207661_10924200
818 Ga0207679_10100091
819 Ga0207679_10651630
820 Ga0207679_11449954
821 Ga0207667_10287919
822 Ga0207667_11199004
823 Ga0207651_11601255
824 Ga0207712_10306419
825 Ga0207712_10694277
826 Ga0207712_11520006
827 Ga0207668_10454709
828 Ga0207640_11460563
829 Ga0207658_10191645
830 Ga0207658_10379663
831 Ga0207677_10779777
832 Ga0207703_10005342
833 Ga0207703_10126648
834 Ga0207678_10088459
835 Ga0207678_10342866
836 Ga0207708_10021675
837 Ga0207708_10748157
838 Ga0207708_11378632
839 Ga0207702_10254532
840 Ga0207702_10690123
841 Ga0207702_11284840
842 Ga0207702_11302787
843 Ga0207641_10002966
844 Ga0207648_10003443
845 Ga0207648_10815404
846 Ga0207676_10075090
847 Ga0207676_10523928
848 Ga0207674_10286621
849 Ga0207674_11654603
850 Ga0207675_100041053
851 Ga0207675_100065912
852 Ga0207675_100185323
853 Ga0207683_10060869
854 Ga0207683_11136293
855 Ga0207698_10704996
856 Ga0209813_10001318
857 Ga0209813_10002378
858 Ga0268266_10001171
859 Ga0268266_10085012
860 Ga0268266_10272340
861 Ga0268265_10226427
862 Ga0268265_11464285
863 Ga0268264_10000027
864 Ga0268264_10001770
865 Ga0268264_10429566
866 Ga0316181_1110179
867 Ga0316181_1151896
868 Ga0316182_1158283
869 Ga0307405_10464522
870 Ga0307413_11394357
871 Ga0307410_10044113
872 Ga0307410_10940671
873 Ga0307407_10037189
874 Ga0307407_10055759
875 Ga0307407_10232917
876 Ga0307407_10268733
877 Ga0307407_10462278
878 Ga0307407_10543199
879 Ga0307412_10115804
880 Ga0307412_10653500
881 Ga0307409_100298512
882 Ga0307409_100411449
883 Ga0307409_100676202
884 Ga0307409_100806699
885 Ga0307409_100908974
886 Ga0307416_100003769
887 Ga0307416_100042058
888 Ga0307416_100613029
889 Ga0307416_101303260
890 Ga0307411_10331117
891 Ga0307411_10734831
892 Ga0307411_11128530
893 Ga0307415_100063889
894 Ga0307415_100273063
895 Ga0307415_101277058
896 Ga0373962_0183219
897 Ga0395900_0578704
898 Ga0395900_0611140
899 Ga0395900_1671340
900 Ga0395898_0014276
901 Ga0395898_0802729
902 Ga0395898_1359544
903 Ga0436364_0493174
904 Ga0436364_0812095
905 Ga0395901_0056137
906 Ga0395901_0069525
907 Ga0395901_0802676
908 Ga0395901_1282910
909 Ga0436365_1323783
910 Ga0436365_1424412
911 Ga0436365_1902545
912 Ga0436362_0827280
913 Ga0439436_0046354
914 Ga0439438_019680
915 Ga0439447_041552
916 Ga0439461_0014520
917 Ga0439466_0256961
918 Ga0439465_0022613
919 Ga0439465_0033785
920 Ga0439465_0098486
921 Ga0439465_0152571
922 Ga0451791_1516584
923 Ga0451797_0463566
924 Ga0451797_0892603
925 Ga0451798_0403468
926 Ga0451800_1365070
927 Ga0451806_763312
928 Ga0451807_0903062
929 Ga0451807_1226135
930 Ga0451833_0618061
931 Ga0451837_0032520
932 Ga0451837_1692105
933 Ga0451839_0202603
934 Ga0451855_0340058
935 Ga0451853_2701301
936 Ga0451853_3745626
937 Ga0439431_0041983
938 Ga0439442_035175
939 Ga0439445_0167343
940 Ga0439432_063582
941 Ga0439434_0003966
942 Ga0439464_0033388
943 Ga0466972_0041294
944 Ga0466972_0142183
945 Ga0466972_0212537
946 Ga0466965_0018939
947 Ga0466965_0062498
948 Ga0466965_0266090
949 Ga0466965_0323939
950 Ga0466966_0001654
951 Ga0466966_0195719
952 Ga0466966_0206840
953 Ga0466961_0016597
954 Ga0466961_0062208
955 Ga0466961_0139796
956 Ga0466961_0241494
957 Ga0466961_0244250
958 Ga0466961_0449122
959 Ga0466961_0493312
960 Ga0466963_0000014
961 Ga0466963_0019825
962 Ga0466963_0128625
963 Ga0466963_0162579
964 Ga0466963_0320921
965 Ga0466963_0320933
966 Ga0466963_0331727
967 Ga0466963_0346851
968 Ga0466963_0817239
969 Ga0466964_0040215
970 Ga0466964_0178891
971 Ga0466964_0202899
972 Ga0466971_0036426
973 Ga0466971_0193359
974 Ga0466971_0505988
975 Ga0466971_0517165
976 Ga0466970_0018644
977 Ga0466970_0067805
978 Ga0466970_0186920
979 Ga0466970_0286217
980 Ga0466970_0289419
981 Ga0466970_0294629
982 Ga0466970_0439479
983 Ga0466957_0001217
984 Ga0466957_0009450
985 Ga0466957_0013716
986 Ga0466957_0303359
987 Ga0466957_0904518
988 Ga0466960_0015018
989 Ga0466960_0016088
990 Ga0466960_0047754
991 Ga0466960_0217244
992 Ga0466960_0294517
993 Ga0466960_0384018
994 Ga0466960_1054388
995 Ga0466959_0162845
996 Ga0466958_0000257
997 Ga0466958_0024910
998 Ga0466958_0275254
999 Ga0466967_0015695
1000 Ga0466967_0039656
1001 Ga0466967_0047745
1002 Ga0466967_0066979
1003 Ga0466967_0097695
1004 Ga0466967_0110226
1005 Ga0466967_0127945
1006 Ga0466967_0131620
1007 Ga0466967_0153408
1008 Ga0466967_0510335
1009 Ga0466967_1041446
1010 Ga0466967_1833689
1011 Ga0466967_2077376
1012 Ga0495603_0071522
1013 Ga0495641_0178226
1014 Ga0495639_0462274
1015 Ga0495620_0077171
1016 Ga0495667_0284258
1017 Ga0495658_0766093
1018 Ga0495670_0506513
1019 Ga0495676_1056338
1020 Ga0495680_0271546
1021 Ga0495614_0362086
1022 Ga0496100_0077002
1023 Ga0496101_0065131
1024 Ga0496101_0090567
1025 Ga0496101_1082611
1026 Ga0496102_0119388
1027 Ga0496102_0131610
1028 Ga0496102_0141817
1029 Ga0496102_0227066
1030 Ga0496102_0287654
1031 Ga0496102_0307099
1032 Ga0496103_0020498
1033 Ga0496103_0122947
1034 Ga0496103_0229564
1035 Ga0496103_0286176
1036 Ga0496104_0184657
1037 Ga0496105_0001223
1038 Ga0496106_0033977
1039 Ga0496107_0037831
1040 Ga0496107_0061624
1041 Ga0496107_0268571
1042 Ga0496107_0296848
1043 Ga0496108_0036606
1044 Ga0496108_0050759
1045 Ga0496108_0090516
1046 Ga0496109_0030734
1047 Ga0496109_0040098
1048 Ga0496109_0069340
1049 Ga0496109_0246172
1050 Ga0496110_0040613
1051 Ga0496110_0943990
1052 Ga0496110_1325412
1053 Ga0496111_0180759
1054 Ga0496111_0778023
1055 Ga0496112_0780700
1056 Ga0496113_0917469
1057 Ga0496113_1120539
1058 Ga0496114_0026671
1059 Ga0496114_0038923
1060 Ga0496114_0183049
1061 Ga0496115_0057866
1062 Ga0496115_0143464
1063 Ga0496124_0249545
1064 Ga0501033_0389043
1065 Ga0501034_0039025
1066 Ga0501034_0474763
1067 Ga0501037_0354463
1068 Ga0501037_0454227
1069 Ga0501037_1043065
1070 Ga0501038_0304496
1071 Ga0501038_0931750
1072 Ga0501039_0021684
1073 Ga0501039_0069472
1074 Ga0501039_0281569
1075 Ga0501039_0574558
1076 Ga0501040_0248719
1077 Ga0501040_1144915
1078 Ga0501041_0014930
1079 Ga0501041_0180020
1080 Ga0501042_0067433
1081 Ga0501042_0210949
1082 Ga0501042_1030901
1083 Ga0501042_1286943
1084 Ga0501048_0686367
1085 Ga0501067_0000434
1086 Ga0501067_0006928
1087 Ga0501067_0050351
1088 Ga0501067_0176006
1089 Ga0501067_0221849
1090 Ga0501067_0672673
1091 Ga0501068_0004332
1092 Ga0501068_0053210
1093 Ga0501068_0080724
1094 Ga0501068_0122536
1095 Ga0501068_0176011
1096 Ga0501068_0226865
1097 Ga0501069_0011868
1098 Ga0501069_0087028
1099 Ga0501069_0113195
1100 Ga0501069_0203833
1101 Ga0501069_0229016
1102 Ga0501069_0251651
1103 Ga0501069_0303474
1104 Ga0501070_0036002
1105 Ga0501070_0060746
1106 Ga0501070_0386683
1107 Ga0501070_0400228
1108 Ga0501070_0469868
1109 Ga0501070_0548003
1110 Ga0501070_1098710
1111 Ga0501071_0004791
1112 Ga0501071_0187114
1113 Ga0501071_0247617
1114 Ga0501071_0806656
1115 Ga0501072_0118173
1116 Ga0501073_0006712
1117 Ga0501074_0000659
1118 Ga0501074_0180263
1119 Ga0501074_0799659
1120 Ga0501075_0314756
1121 Ga0501075_0326681
1122 Ga0501075_0507677
1123 Ga0501076_0036376
1124 Ga0501076_0775899
1125 Ga0501077_0038125
1126 Ga0501077_0357872
1127 Ga0501079_0129915
1128 Ga0501079_0372736
1129 Ga0501080_0081397
1130 Ga0501080_0230335
1131 Ga0501080_0607284
1132 Ga0501080_0681599
1133 Ga0501081_0304873
1134 Ga0501081_0371276
1135 Ga0501081_0442664
1136 Ga0501081_0816513
1137 Ga0501083_0076350
1138 Ga0501035_0211343
1139 Ga0501045_0077873
1140 nmdc:mga03683_12106_c1
1141 nmdc:mga03n38_110961_c1
1142 nmdc:mga03n38_142048_c1
1143 nmdc:mga03n38_15687_c1
1144 nmdc:mga03n38_213519_c1
1145 nmdc:mga03n38_349291_c1
1146 nmdc:mga03n38_74952_c1
1147 nmdc:mga00v17_20172_c1
1148 nmdc:mga00v17_295449_c1
1149 nmdc:mga00v17_323728_c1
1150 nmdc:mga00v17_423104_c1
1151 nmdc:mga00v17_46551_c1
1152 nmdc:mga00v17_6293_c2
1153 nmdc:mga00v17_77633_c1
1154 nmdc:mga0yw44_1114161_c1
1155 nmdc:mga0yw44_128414_c1
1156 nmdc:mga0yw44_153014_c1
1157 nmdc:mga0yw44_219488_c1
1158 nmdc:mga0yw44_265289_c1
1159 nmdc:mga0yw44_276516_c1
1160 nmdc:mga0yw44_45566_c1
1161 nmdc:mga0yw44_4724_c2
1162 nmdc:mga0yw44_481565_c1
1163 nmdc:mga0yw44_48821_c1
1164 nmdc:mga0yw44_9080_c1
1165 nmdc:mga0yw44_973906_c1
1166 nmdc:mga0yw44_995750_c1
1167 nmdc:mga06z11_11461_c1
1168 nmdc:mga06z11_162979_c1
1169 nmdc:mga06z11_244109_c1
1170 nmdc:mga06z11_34802_c1
1171 nmdc:mga06z11_441647_c1
1172 nmdc:mga04h51_1471_c1
1173 nmdc:mga04h51_17210_c1
1174 nmdc:mga07m45_119735_c1
1175 nmdc:mga07m45_122452_c1
1176 nmdc:mga07m45_157771_c1
1177 nmdc:mga07m45_182804_c1
1178 nmdc:mga07m45_238731_c1
1179 nmdc:mga07m45_268795_c1
1180 nmdc:mga07m45_367997_c1
1181 nmdc:mga07m45_51553_c1
1182 nmdc:mga08y16_664612_c1
1183 Ga0495619_0043837
1184 Ga0495619_0480001
1185 Ga0500644_0005326
1186 Ga0500556_0001967
1187 Ga0500573_0414980
1188 Ga0501084_0022003
1189 Ga0501084_0420487
1190 Ga0501082_0021346
1191 Ga0501082_0697106
1192 Ga0501082_0811243
1193 Ga0466962_0005074
1194 Ga0466962_0009107
1195 Ga0466962_0073165
1196 Ga0466962_0591783
1197 Ga0530510_0884496
1198 2643891656
1199 2643960704
1200 2644035780
1201 2644102324
1202 2644115548
1203 2644229309
1204 2738868108
1205 2774392307
1206 2809196112
1207 2812333160
1208 2812351761
1209 2855386930
1210 2857484645
1211 2891970612
1212 2990260373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

29

167

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y71-assembly1.cif.gz_A structure of mycobacterium tuberculosis type ii dehydroquinase complexed with (1r,4s,5r)-1,4,5-trihydroxy-3-((5-methylbenzo(b) thiophen-2-yl)methoxy)cyclohex-2-enecarboxylate 0.9587 3 141
4ckw-assembly2.cif.gz_B structure of the mycobacterium tuberculosis type ii dehydroquinase n12s mutant (crystal form 1) 0.9583 1 141
4ckz-assembly1.cif.gz_A structure of the mycobacterium tuberculosis type ii dehydroquinase d88n mutant 0.9579 3 141
4v0s-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis type ii dehydroquinase d88n mutant inhibited by a 3-dehydroquinic acid derivative 0.957 2 141
3n59-assembly2.cif.gz_P type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate 0.9569 3 141
ID Description Score Start End Superfamily
4ckwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9555 3 141 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9533 3 141 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9261 3 141 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9195 2 141 3.40.50.9100
4ckwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9152 3 141 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A1X2C0S6-F1-model_v4 deleted 0.9557 3 141
AF-B8ZUK3-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9545 1 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A653Q356-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9542 3 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A1X0K1G2-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9537 2 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A4U2YMS5-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9536 2 141 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631

Map