F468592

General Info

Members Datasets Scaffolds Average Seq Length
606 230 581 309

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10235468|Ga0157369_102354682
Length 358
Sequence MSATPESKPSEGPRDRTFRDARCLPDMIERVLTPVEVPSRTSGRRALIVAVGAIVVAALAALPWYGNSVFVQFGISVLLLATLAQGWNIIGGYTGYASFGNSVFYGLGAYGVAIAMVQFKLPFWVGMIAGLVLAVLFAAALGAAVLRLKGHYFAICTLALAFIMTAIVSNLEIAGSNIGLVLPLLKSDVLFYELALGLLVLATITVWWLANSRFGLGLISIRENEEGAAVMGVNTTLYKILAFMLSAAFTGLAGGIYAYYITFIDPVGVFDIALNVKMIIMAVFGGPGTVLGPVVGALILSTISEILATKVTSVASMFFGIVIVIAVVFMPRGIADVVRRAGRSPLRYFAANVRTHRL

Samples

Sample ID Description Type Environment
1 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
2 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
3 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
4 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
5 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
6 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
7 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
8 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
9 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
10 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
11 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
12 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
13 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
14 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
15 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
16 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
17 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
69 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
217 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
218 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
224 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
225 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
226 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
227 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
228 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
229 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
230 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 0.17
Isolates 4.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 3.3
Rhizoplane 0.99
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10134588 3300005288 Unclassified 1220
2 Ga0065712_10008621 3300005290 Bacteria 4566
3 Ga0065715_10022830 3300005293 Bacteria 1908
4 Ga0065715_10099295 3300005293 Bacteria 3431
5 Ga0070658_10025149 3300005327 Bacteria 4772
6 Ga0070658_10029764 3300005327 Bacteria 4388
7 Ga0070658_10041813 3300005327 Bacteria 3698
8 Ga0070658_10315017 3300005327 Bacteria 1335
9 Ga0070683_100003578 3300005329 Bacteria 12645
10 Ga0070683_100027645 3300005329 Bacteria 5118
11 Ga0070670_100001233 3300005331 Bacteria 20349
12 Ga0068869_100309599 3300005334 Unclassified 1278
13 Ga0070680_100014750 3300005336 Bacteria 6112
14 Ga0070680_100015275 3300005336 Bacteria 6017
15 Ga0070680_100030551 3300005336 Bacteria 4328
16 Ga0070680_100160556 3300005336 Bacteria 1889
17 Ga0070660_100007517 3300005339 Bacteria 7598
18 Ga0070660_100022097 3300005339 Bacteria 4700
19 Ga0070660_100030028 3300005339 Bacteria 4076
20 Ga0070660_100061926 3300005339 Bacteria 2906
21 Ga0070660_100195813 3300005339 Bacteria 1638
22 Ga0070689_100216498 3300005340 Bacteria 1570
23 Ga0070691_10023065 3300005341 Bacteria 2890
24 Ga0070661_100014691 3300005344 Bacteria 5522
25 Ga0070661_100058093 3300005344 Bacteria 2835
26 Ga0070661_100114909 3300005344 Bacteria 2012
27 Ga0070675_100155464 3300005354 Bacteria 1963
28 Ga0070671_100193197 3300005355 Bacteria 1725
29 Ga0070673_100208220 3300005364 Bacteria 1687
30 Ga0070659_100027339 3300005366 Bacteria 4395
31 Ga0070659_100047753 3300005366 Bacteria 3360
32 Ga0070659_100075754 3300005366 Bacteria 2682
33 Ga0070659_100120517 3300005366 Bacteria 2124
34 Ga0070709_10005732 3300005434 Bacteria 6735
35 Ga0070709_10067789 3300005434 Bacteria 2292
36 Ga0070714_100096279 3300005435 Bacteria 2600
37 Ga0070713_100014183 3300005436 Bacteria 5905
38 Ga0070710_10013706 3300005437 Bacteria 4067
39 Ga0070705_100001534 3300005440 Bacteria 12163
40 Ga0070705_100121421 3300005440 Bacteria 1688
41 Ga0070694_100047034 3300005444 Bacteria 2898
42 Ga0070694_100093475 3300005444 Bacteria 2114
43 Ga0070708_100058850 3300005445 Bacteria 3425
44 Ga0070663_100016228 3300005455 Bacteria 4830
45 Ga0070663_100055219 3300005455 Bacteria 2842
46 Ga0070663_100068642 3300005455 Bacteria 2574
47 Ga0070662_100198270 3300005457 Bacteria 1591
48 Ga0070681_10003478 3300005458 Bacteria 14754
49 Ga0070681_10004519 3300005458 Bacteria 13273
50 Ga0070681_10007047 3300005458 Bacteria 10946
51 Ga0070681_10017923 3300005458 Bacteria 7078
52 Ga0070681_10024165 3300005458 Bacteria 6117
53 Ga0070681_10076061 3300005458 Bacteria 3316
54 Ga0070681_10098041 3300005458 Bacteria 2877
55 Ga0070681_10152881 3300005458 Bacteria 2234
56 Ga0070681_10205188 3300005458 Bacteria 1888
57 Ga0068867_100049636 3300005459 Bacteria 3090
58 Ga0070706_100008849 3300005467 Bacteria 9378
59 Ga0070706_100191838 3300005467 Bacteria 1909
60 Ga0070707_100001104 3300005468 Bacteria 26642
61 Ga0070699_100001129 3300005518 Bacteria 24878
62 Ga0070699_100132653 3300005518 Bacteria 2196
63 Ga0070679_100001628 3300005530 Bacteria 20213
64 Ga0070679_100003375 3300005530 Bacteria 14634
65 Ga0070679_100027472 3300005530 Bacteria 5601
66 Ga0070679_100037821 3300005530 Bacteria 4796
67 Ga0070679_100061036 3300005530 Bacteria 3758
68 Ga0070679_100099090 3300005530 Bacteria 2902
69 Ga0070679_100106547 3300005530 Bacteria 2789
70 Ga0070679_100161535 3300005530 Bacteria 2215
71 Ga0070679_100169546 3300005530 Bacteria 2156
72 Ga0070679_100318553 3300005530 Bacteria 1504
73 Ga0070679_100332971 3300005530 Bacteria 1467
74 Ga0070684_100040291 3300005535 Bacteria 4021
75 Ga0070684_100073771 3300005535 Bacteria 3007
76 Ga0070684_100130411 3300005535 Bacteria 2267
77 Ga0070684_100142984 3300005535 Bacteria 2164
78 Ga0070684_100198145 3300005535 Bacteria 1829
79 Ga0070684_100514145 3300005535 Bacteria 1110
80 Ga0070697_100003818 3300005536 Bacteria 11569
81 Ga0068853_100012850 3300005539 Bacteria 6822
82 Ga0068853_100014496 3300005539 Bacteria 6458
83 Ga0068853_100046945 3300005539 Bacteria 3705
84 Ga0068853_100100502 3300005539 Bacteria 2557
85 Ga0068853_100116989 3300005539 Bacteria 2374
86 Ga0068853_100138965 3300005539 Bacteria 2180
87 Ga0070672_100011815 3300005543 Bacteria 6101
88 Ga0070695_100007046 3300005545 Bacteria 6663
89 Ga0070695_100011240 3300005545 Bacteria 5354
90 Ga0070696_100059783 3300005546 Bacteria 2664
91 Ga0070696_100102310 3300005546 Bacteria 2054
92 Ga0070696_100164293 3300005546 Bacteria 1637
93 Ga0070693_100004537 3300005547 Bacteria 6581
94 Ga0070693_100108234 3300005547 Bacteria 1705
95 Ga0070693_100172615 3300005547 Bacteria 1386
96 Ga0070704_100004097 3300005549 Bacteria 8417
97 Ga0068855_100001151 3300005563 Bacteria 32758
98 Ga0068855_100005260 3300005563 Bacteria 15798
99 Ga0068855_100049765 3300005563 Bacteria 4942
100 Ga0068855_100254394 3300005563 Bacteria 1958
101 Ga0070664_100001998 3300005564 Bacteria 16361
102 Ga0070664_100002113 3300005564 Bacteria 15889
103 Ga0070664_100004806 3300005564 Bacteria 10826
104 Ga0070664_100049426 3300005564 Bacteria 3557
105 Ga0070664_100099830 3300005564 Bacteria 2523
106 Ga0068857_100017376 3300005577 Bacteria 6302
107 Ga0068857_100036141 3300005577 Bacteria 4377
108 Ga0068857_100054993 3300005577 Bacteria 3532
109 Ga0068854_100000264 3300005578 Bacteria 35701
110 Ga0068854_100012869 3300005578 Bacteria 5480
111 Ga0068856_100000201 3300005614 Bacteria 63742
112 Ga0068856_100006419 3300005614 Bacteria 11538
113 Ga0068856_100012512 3300005614 Bacteria 8215
114 Ga0068856_100068368 3300005614 Bacteria 3511
115 Ga0068856_100068792 3300005614 Bacteria 3500
116 Ga0068856_100127749 3300005614 Bacteria 2546
117 Ga0068856_100381876 3300005614 Bacteria 1428
118 Ga0068856_100642818 3300005614 Bacteria 1081
119 Ga0068852_100102146 3300005616 Bacteria 2590
120 Ga0068852_100109770 3300005616 Bacteria 2506
121 Ga0068852_100517282 3300005616 Bacteria 1190
122 Ga0068864_100131179 3300005618 Bacteria 2251
123 Ga0070716_100063054 3300006173 Bacteria 2151
124 Ga0075433_10006491 3300006852 Bacteria 9249
125 Ga0075434_100002299 3300006871 Bacteria 16720
126 Ga0075434_100005263 3300006871 Bacteria 11759
127 Ga0075434_100051987 3300006871 Bacteria 4071
128 Ga0075434_100069766 3300006871 Bacteria 3504
129 Ga0075434_100100111 3300006871 Bacteria 2904
130 Ga0075436_100026407 3300006914 Bacteria 3999
131 Ga0075436_100068833 3300006914 Bacteria 2445
132 Ga0099825_1025006 3300006941 Bacteria 3391
133 Ga0099823_1000008 3300006944 Bacteria 105646
134 Ga0075435_100010407 3300007076 Bacteria 6804
135 Ga0075435_100067305 3300007076 Bacteria 2916
136 Ga0075435_100111485 3300007076 Bacteria 2276
137 Ga0105240_10006475 3300009093 Bacteria 17201
138 Ga0105240_10121985 3300009093 Bacteria 3137
139 Ga0105240_10155013 3300009093 Bacteria 2725
140 Ga0105240_10271117 3300009093 Bacteria 1954
141 Ga0105240_10380529 3300009093 Bacteria 1594
142 Ga0105240_10420259 3300009093 Bacteria 1502
143 Ga0111539_10066735 3300009094 Bacteria 4250
144 Ga0105245_10063726 3300009098 Bacteria 3329
145 Ga0114129_10040825 3300009147 Bacteria 6541
146 Ga0105241_10000844 3300009174 Bacteria 23215
147 Ga0105241_10114320 3300009174 Bacteria 2165
148 Ga0105237_10027219 3300009545 Bacteria 5838
149 Ga0105237_10032654 3300009545 Bacteria 5270
150 Ga0105237_10066329 3300009545 Bacteria 3604
151 Ga0105237_10080591 3300009545 Bacteria 3245
152 Ga0105237_10380554 3300009545 Bacteria 1416
153 Ga0105237_10429953 3300009545 Bacteria 1326
154 Ga0105238_10023932 3300009551 Bacteria 6225
155 Ga0105238_10092080 3300009551 Bacteria 3019
156 Ga0105239_10019472 3300010375 Bacteria 7492
157 Ga0105239_10024356 3300010375 Bacteria 6668
158 Ga0105239_10025431 3300010375 Bacteria 6519
159 Ga0105239_10071273 3300010375 Bacteria 3819
160 Ga0105239_10074352 3300010375 Bacteria 3736
161 Ga0105246_10236995 3300011119 Unclassified 1440
162 Ga0157373_10012847 3300013100 Bacteria 6150
163 Ga0157373_10029138 3300013100 Bacteria 3979
164 Ga0157373_10151692 3300013100 Bacteria 1630
165 Ga0157373_10202814 3300013100 Bacteria 1398
166 Ga0157373_10208557 3300013100 Bacteria 1378
167 Ga0157370_10009405 3300013104 Bacteria 10447
168 Ga0157370_10026460 3300013104 Bacteria 5728
169 Ga0157370_10029531 3300013104 Bacteria 5377
170 Ga0157370_10104751 3300013104 Bacteria 2648
171 Ga0157370_10238853 3300013104 Bacteria 1681
172 Ga0157370_10249078 3300013104 Bacteria 1643
173 Ga0157369_10005734 3300013105 Bacteria 14431
174 Ga0157369_10009833 3300013105 Bacteria 10930
175 Ga0157369_10016178 3300013105 Bacteria 8397
176 Ga0157369_10031111 3300013105 Bacteria 5880
177 Ga0157369_10091814 3300013105 Bacteria 3241
178 Ga0157369_10175220 3300013105 Bacteria 2258
179 Ga0157369_10200017 3300013105 Bacteria 2097
180 Ga0157369_10235468 3300013105 Bacteria 1913
181 Ga0157369_10247776 3300013105 Bacteria 1860
182 Ga0157369_10357670 3300013105 Bacteria 1516
183 Ga0157378_10169711 3300013297 Bacteria 2045
184 Ga0163162_10062510 3300013306 Bacteria 3764
185 Ga0157372_10030805 3300013307 Bacteria 5869
186 Ga0157372_10199181 3300013307 Bacteria 2320
187 Ga0157372_10205399 3300013307 Bacteria 2283
188 Ga0157372_10248400 3300013307 Bacteria 2065
189 Ga0157372_10280813 3300013307 Bacteria 1936
190 Ga0157372_10299886 3300013307 Bacteria 1869
191 Ga0157372_10316644 3300013307 Bacteria 1816
192 Ga0157372_10473316 3300013307 Bacteria 1460
193 Ga0157376_10063838 3300014969 Bacteria 3104
194 Ga0182007_10028002 3300015262 Bacteria 1939
195 Ga0206356_10381972 3300020070 Bacteria 1373
196 Ga0207697_10004842 3300025315 Bacteria 6354
197 Ga0207692_10006965 3300025898 Bacteria 4612
198 Ga0207688_10038207 3300025901 Bacteria 2663
199 Ga0207680_10104168 3300025903 Bacteria 1828
200 Ga0207647_10185813 3300025904 Bacteria 1205
201 Ga0207699_10132728 3300025906 Bacteria 1626
202 Ga0207645_10014549 3300025907 Bacteria 5263
203 Ga0207705_10015290 3300025909 Bacteria 5509
204 Ga0207705_10078777 3300025909 Bacteria 2399
205 Ga0207654_10000309 3300025911 Bacteria 29439
206 Ga0207707_10003406 3300025912 Bacteria 14100
207 Ga0207707_10007038 3300025912 Bacteria 9807
208 Ga0207707_10010070 3300025912 Bacteria 8201
209 Ga0207707_10013786 3300025912 Bacteria 7049
210 Ga0207707_10016582 3300025912 Bacteria 6422
211 Ga0207707_10093039 3300025912 Bacteria 2633
212 Ga0207707_10109710 3300025912 Bacteria 2412
213 Ga0207707_10160785 3300025912 Bacteria 1964
214 Ga0207707_10246560 3300025912 Bacteria 1552
215 Ga0207695_10038008 3300025913 Bacteria 5189
216 Ga0207695_10054744 3300025913 Bacteria 4163
217 Ga0207695_10072865 3300025913 Bacteria 3502
218 Ga0207695_10128963 3300025913 Bacteria 2488
219 Ga0207695_10151164 3300025913 Bacteria 2261
220 Ga0207671_10029908 3300025914 Bacteria 4064
221 Ga0207671_10048639 3300025914 Bacteria 3138
222 Ga0207671_10149278 3300025914 Bacteria 1805
223 Ga0207693_10052739 3300025915 Bacteria 3190
224 Ga0207693_10056465 3300025915 Bacteria 3078
225 Ga0207663_10104571 3300025916 Bacteria 1909
226 Ga0207663_10214484 3300025916 Bacteria 1397
227 Ga0207660_10009716 3300025917 Bacteria 6226
228 Ga0207660_10022445 3300025917 Bacteria 4252
229 Ga0207660_10031312 3300025917 Bacteria 3661
230 Ga0207660_10038448 3300025917 Bacteria 3341
231 Ga0207660_10044027 3300025917 Bacteria 3139
232 Ga0207660_10049884 3300025917 Bacteria 2970
233 Ga0207657_10001238 3300025919 Bacteria 27306
234 Ga0207657_10001822 3300025919 Bacteria 22989
235 Ga0207657_10021498 3300025919 Bacteria 6069
236 Ga0207657_10038756 3300025919 Bacteria 4239
237 Ga0207657_10051018 3300025919 Bacteria 3597
238 Ga0207657_10086295 3300025919 Bacteria 2627
239 Ga0207657_10208102 3300025919 Bacteria 1571
240 Ga0207649_10040850 3300025920 Bacteria 2822
241 Ga0207649_10043045 3300025920 Bacteria 2758
242 Ga0207649_10043283 3300025920 Bacteria 2752
243 Ga0207649_10096261 3300025920 Bacteria 1950
244 Ga0207649_10112253 3300025920 Bacteria 1823
245 Ga0207649_10136573 3300025920 Bacteria 1673
246 Ga0207649_10142021 3300025920 Bacteria 1644
247 Ga0207649_10260550 3300025920 Bacteria 1253
248 Ga0207652_10001455 3300025921 Bacteria 20964
249 Ga0207652_10017515 3300025921 Bacteria 5863
250 Ga0207652_10017994 3300025921 Bacteria 5790
251 Ga0207652_10020173 3300025921 Bacteria 5487
252 Ga0207652_10037175 3300025921 Bacteria 4120
253 Ga0207652_10090575 3300025921 Bacteria 2688
254 Ga0207652_10101041 3300025921 Bacteria 2547
255 Ga0207652_10109710 3300025921 Bacteria 2447
256 Ga0207652_10130850 3300025921 Bacteria 2238
257 Ga0207652_10176378 3300025921 Bacteria 1919
258 Ga0207652_10185077 3300025921 Bacteria 1873
259 Ga0207646_10020871 3300025922 Bacteria 6061
260 Ga0207694_10015610 3300025924 Bacteria 5728
261 Ga0207694_10020462 3300025924 Bacteria 5007
262 Ga0207650_10002518 3300025925 Bacteria 12718
263 Ga0207659_10061228 3300025926 Bacteria 2712
264 Ga0207687_10010369 3300025927 Bacteria 6088
265 Ga0207700_10019523 3300025928 Bacteria 4579
266 Ga0207664_10069115 3300025929 Bacteria 2839
267 Ga0207664_10073712 3300025929 Bacteria 2756
268 Ga0207690_10016009 3300025932 Bacteria 4557
269 Ga0207690_10045003 3300025932 Bacteria 2913
270 Ga0207690_10076227 3300025932 Bacteria 2328
271 Ga0207706_10014809 3300025933 Bacteria 7060
272 Ga0207706_10167436 3300025933 Bacteria 1931
273 Ga0207691_10129972 3300025940 Bacteria 2225
274 Ga0207689_10159859 3300025942 Bacteria 1856
275 Ga0207661_10004708 3300025944 Bacteria 9556
276 Ga0207661_10054294 3300025944 Bacteria 3209
277 Ga0207661_10065873 3300025944 Bacteria 2941
278 Ga0207661_10134332 3300025944 Bacteria 2123
279 Ga0207679_10036156 3300025945 Bacteria 3501
280 Ga0207679_10077970 3300025945 Bacteria 2523
281 Ga0207679_10229389 3300025945 Bacteria 1567
282 Ga0207667_10002177 3300025949 Bacteria 24573
283 Ga0207667_10005378 3300025949 Bacteria 15614
284 Ga0207667_10031897 3300025949 Bacteria 5682
285 Ga0207667_10035767 3300025949 Bacteria 5327
286 Ga0207667_10053979 3300025949 Bacteria 4227
287 Ga0207667_10083916 3300025949 Bacteria 3298
288 Ga0207651_10106617 3300025960 Bacteria 2092
289 Ga0207640_10005700 3300025981 Bacteria 6786
290 Ga0207640_10038773 3300025981 Bacteria 3010
291 Ga0207639_10060459 3300026041 Bacteria 2923
292 Ga0207639_10119720 3300026041 Bacteria 2161
293 Ga0207639_10122806 3300026041 Bacteria 2136
294 Ga0207639_10134171 3300026041 Bacteria 2053
295 Ga0207639_10138544 3300026041 Bacteria 2024
296 Ga0207639_10354545 3300026041 Bacteria 1311
297 Ga0207678_10019937 3300026067 Bacteria 5894
298 Ga0207678_10029166 3300026067 Bacteria 4816
299 Ga0207678_10036269 3300026067 Bacteria 4292
300 Ga0207678_10052319 3300026067 Bacteria 3524
301 Ga0207678_10151377 3300026067 Bacteria 1981
302 Ga0207702_10000666 3300026078 Bacteria 37333
303 Ga0207702_10033011 3300026078 Bacteria 4321
304 Ga0207702_10047646 3300026078 Bacteria 3612
305 Ga0207702_10050662 3300026078 Bacteria 3506
306 Ga0207702_10188434 3300026078 Bacteria 1904
307 Ga0207702_10511779 3300026078 Bacteria 1171
308 Ga0207674_10000511 3300026116 Bacteria 50839
309 Ga0207674_10028513 3300026116 Bacteria 5892
310 Ga0207674_10035463 3300026116 Bacteria 5205
311 Ga0207674_10044550 3300026116 Bacteria 4569
312 Ga0207683_10023348 3300026121 Bacteria 5320
313 Ga0207698_10106559 3300026142 Bacteria 2338
314 Ga0209389_1000032 3300027296 Bacteria 134064
315 Ga0209489_100035 3300027361 Bacteria 168255
316 Ga0209700_100005 3300027363 Bacteria 573969
317 Ga0207428_10158798 3300027907 Bacteria 1718
318 Ga0268266_10182621 3300028379 Bacteria 1911
319 Ga0265338_10002421 3300028800 Bacteria 28057
320 Ga0265338_10007612 3300028800 Bacteria 13371
321 Ga0265324_10008319 3300029957 Bacteria 4131
322 Ga0265342_10064861 3300031712 Bacteria 2142
323 Ga0316583_10000402 3300032133 Bacteria 12632
324 Ga0373951_0040426 3300035091 Unclassified 1123
325 Ga0373932_0004582 3300035112 Bacteria 3264
326 Ga0373946_0057359 3300035171 Bacteria 1647
327 Ga0373931_0075732 3300035691 Bacteria 1846
328 Ga0373935_0034517 3300035692 Bacteria 3153
329 Ga0373947_0005237 3300035725 Bacteria 7580
330 Ga0373937_0324504 3300036401 Bacteria 1457
331 Ga0373925_0019790 3300037068 Bacteria 4899
332 Ga0395899_0012468 3300037312 Bacteria 6511
333 Ga0395899_0125746 3300037312 Bacteria 1834
334 Ga0395900_0005282 3300037418 Bacteria 13539
335 Ga0395900_0005920 3300037418 Bacteria 12764
336 Ga0395900_0006728 3300037418 Bacteria 11933
337 Ga0395900_0016908 3300037418 Bacteria 7445
338 Ga0395900_0103217 3300037418 Bacteria 2929
339 Ga0395900_0127646 3300037418 Bacteria 2607
340 Ga0395898_0000466 3300037466 Bacteria 80988
341 Ga0395898_0006357 3300037466 Bacteria 12619
342 Ga0395898_0008548 3300037466 Bacteria 10814
343 Ga0395898_0012577 3300037466 Bacteria 8752
344 Ga0395898_0021484 3300037466 Bacteria 6545
345 Ga0395898_0040118 3300037466 Bacteria 4631
346 Ga0395898_0076468 3300037466 Bacteria 3233
347 Ga0395898_0095440 3300037466 Bacteria 2857
348 Ga0395905_0056850 3300037471 Bacteria 3659
349 Ga0395901_0016687 3300038443 Bacteria 7482
350 Ga0395901_0018929 3300038443 Bacteria 7039
351 Ga0395901_0023198 3300038443 Bacteria 6361
352 Ga0395901_0023233 3300038443 Bacteria 6355
353 Ga0395901_0046220 3300038443 Bacteria 4521
354 Ga0395901_0056445 3300038443 Bacteria 4085
355 Ga0451577_0054925 3300042876 Bacteria 3555
356 Ga0453683_0009299 3300044673 Bacteria 6570
357 Ga0466966_0086759 3300044684 Bacteria 1945
358 Ga0466963_0019393 3300044694 Bacteria 4264
359 Ga0466964_0010444 3300044706 Bacteria 3502
360 Ga0453684_0613969 3300044712 Unclassified 1190
361 Ga0466970_0022445 3300044765 Bacteria 3293
362 Ga0466959_0000132 3300045049 Bacteria 48490
363 Ga0451576_0011652 3300045051 Bacteria 9959
364 Ga0451576_0324420 3300045051 Bacteria 1611
365 Ga0451576_0438934 3300045051 Bacteria 1370
366 Ga0466958_0150357 3300045836 Bacteria 1469
367 Ga0466967_0029801 3300045976 Bacteria 4572
368 Ga0495651_0028704 3300046462 Bacteria 4335
369 Ga0495653_0007087 3300046463 Bacteria 9192
370 Ga0495580_0013886 3300046472 Bacteria 6132
371 Ga0495580_0054729 3300046472 Bacteria 2813
372 Ga0495608_0003455 3300046511 Bacteria 11309
373 Ga0495628_0001036 3300046516 Bacteria 25436
374 Ga0495628_0024449 3300046516 Bacteria 4945
375 Ga0495652_0007912 3300046529 Bacteria 9759
376 Ga0495652_0011412 3300046529 Bacteria 8036
377 Ga0495645_0003363 3300046543 Bacteria 10842
378 Ga0495645_0107882 3300046543 Bacteria 1973
379 Ga0495645_0196985 3300046543 Bacteria 1369
380 Ga0495623_0002357 3300046679 Bacteria 12571
381 Ga0495646_0000769 3300046680 Bacteria 17863
382 Ga0495624_0006878 3300046690 Bacteria 8030
383 Ga0495600_0000302 3300046809 Bacteria 26375
384 Ga0495604_0014293 3300047317 Bacteria 6329
385 Ga0495602_0010154 3300048088 Bacteria 9775
386 Ga0496101_0310694 3300048904 Bacteria 1236
387 Ga0496104_0013101 3300048907 Bacteria 7472
388 Ga0496104_0475040 3300048907 Bacteria 1162
389 Ga0496108_0146183 3300048911 Bacteria 2038
390 Ga0496109_0083823 3300048912 Bacteria 2940
391 Ga0496113_0086652 3300048916 Bacteria 2407
392 Ga0501031_0001433 3300049568 Bacteria 14778
393 Ga0501031_0031155 3300049568 Bacteria 3479
394 Ga0501031_0063469 3300049568 Bacteria 2406
395 Ga0501031_0157334 3300049568 Bacteria 1485
396 Ga0501031_0160933 3300049568 Bacteria 1467
397 Ga0501031_0175832 3300049568 Bacteria 1398
398 Ga0501032_0002972 3300049569 Bacteria 13158
399 Ga0501032_0005831 3300049569 Bacteria 9110
400 Ga0501032_0006330 3300049569 Bacteria 8725
401 Ga0501032_0021807 3300049569 Bacteria 4448
402 Ga0501032_0096140 3300049569 Bacteria 1963
403 Ga0501032_0127365 3300049569 Bacteria 1681
404 Ga0501032_0230738 3300049569 Bacteria 1203
405 Ga0501033_0000491 3300049570 Bacteria 37247
406 Ga0501033_0001064 3300049570 Bacteria 25051
407 Ga0501033_0003048 3300049570 Bacteria 13930
408 Ga0501033_0003984 3300049570 Bacteria 11956
409 Ga0501033_0005930 3300049570 Bacteria 9591
410 Ga0501033_0023300 3300049570 Bacteria 4669
411 Ga0501033_0036508 3300049570 Bacteria 3682
412 Ga0501033_0106610 3300049570 Bacteria 2041
413 Ga0501033_0263873 3300049570 Bacteria 1218
414 Ga0501034_0003792 3300049571 Bacteria 17058
415 Ga0501034_0038995 3300049571 Bacteria 4811
416 Ga0501034_0052570 3300049571 Bacteria 4103
417 Ga0501034_0067154 3300049571 Bacteria 3599
418 Ga0501034_0120230 3300049571 Bacteria 2613
419 Ga0501034_0139543 3300049571 Bacteria 2404
420 Ga0501034_0245942 3300049571 Bacteria 1734
421 Ga0501034_0531234 3300049571 Bacteria 1087
422 Ga0501036_0000389 3300049572 Bacteria 30927
423 Ga0501036_0008161 3300049572 Bacteria 8582
424 Ga0501036_0106474 3300049572 Bacteria 2371
425 Ga0501036_0177867 3300049572 Bacteria 1791
426 Ga0501036_0311257 3300049572 Bacteria 1316
427 Ga0501037_0000242 3300049573 Bacteria 46822
428 Ga0501037_0003351 3300049573 Bacteria 11642
429 Ga0501037_0016606 3300049573 Bacteria 5417
430 Ga0501037_0026335 3300049573 Bacteria 4297
431 Ga0501037_0054713 3300049573 Bacteria 2918
432 Ga0501037_0091008 3300049573 Bacteria 2206
433 Ga0501037_0144447 3300049573 Bacteria 1702
434 Ga0501037_0153892 3300049573 Bacteria 1642
435 Ga0501037_0238703 3300049573 Bacteria 1274
436 Ga0501038_0000414 3300049574 Bacteria 36995
437 Ga0501038_0002561 3300049574 Bacteria 16947
438 Ga0501038_0019665 3300049574 Bacteria 6079
439 Ga0501038_0027799 3300049574 Bacteria 5027
440 Ga0501038_0029545 3300049574 Bacteria 4855
441 Ga0501038_0093349 3300049574 Bacteria 2518
442 Ga0501038_0115907 3300049574 Bacteria 2214
443 Ga0501038_0146812 3300049574 Bacteria 1925
444 Ga0501038_0192341 3300049574 Bacteria 1641
445 Ga0501038_0294714 3300049574 Bacteria 1274
446 Ga0501038_0387886 3300049574 Bacteria 1082
447 Ga0501039_0001213 3300049575 Bacteria 18933
448 Ga0501039_0030366 3300049575 Bacteria 4168
449 Ga0501042_0017171 3300049578 Bacteria 4987
450 Ga0501042_0032243 3300049578 Bacteria 3709
451 Ga0501043_0000440 3300049579 Bacteria 37461
452 Ga0501043_0003602 3300049579 Bacteria 12716
453 Ga0501043_0017774 3300049579 Bacteria 5575
454 Ga0501043_0024562 3300049579 Bacteria 4729
455 Ga0501043_0030180 3300049579 Bacteria 4259
456 Ga0501043_0130489 3300049579 Bacteria 1969
457 Ga0501043_0244376 3300049579 Bacteria 1384
458 Ga0501046_0002040 3300049580 Bacteria 19198
459 Ga0501046_0011601 3300049580 Bacteria 7532
460 Ga0501046_0034190 3300049580 Bacteria 4103
461 Ga0501046_0053544 3300049580 Bacteria 3178
462 Ga0501046_0132282 3300049580 Bacteria 1892
463 Ga0501047_0002605 3300049581 Bacteria 17170
464 Ga0501047_0009900 3300049581 Bacteria 9012
465 Ga0501047_0016670 3300049581 Bacteria 7017
466 Ga0501047_0023058 3300049581 Bacteria 5975
467 Ga0501047_0075304 3300049581 Bacteria 3248
468 Ga0501047_0086803 3300049581 Bacteria 3006
469 Ga0501047_0099405 3300049581 Bacteria 2788
470 Ga0501047_0118030 3300049581 Bacteria 2534
471 Ga0501047_0187925 3300049581 Bacteria 1930
472 Ga0501047_0215415 3300049581 Bacteria 1777
473 Ga0501047_0319574 3300049581 Bacteria 1392
474 Ga0501047_0422343 3300049581 Bacteria 1164
475 Ga0501048_0005338 3300049582 Bacteria 9782
476 Ga0501048_0091049 3300049582 Bacteria 2151
477 Ga0501067_0004016 3300049583 Bacteria 8118
478 Ga0501067_0010466 3300049583 Bacteria 5133
479 Ga0501067_0016242 3300049583 Bacteria 4114
480 Ga0501068_0001262 3300049584 Bacteria 13425
481 Ga0501068_0217868 3300049584 Bacteria 1213
482 Ga0501069_0000017 3300049585 Bacteria 141492
483 Ga0501069_0000794 3300049585 Bacteria 14862
484 Ga0501069_0007385 3300049585 Bacteria 5766
485 Ga0501069_0011751 3300049585 Bacteria 4643
486 Ga0501070_0000236 3300049586 Bacteria 52046
487 Ga0501070_0005231 3300049586 Bacteria 11062
488 Ga0501070_0015091 3300049586 Bacteria 6503
489 Ga0501070_0017988 3300049586 Bacteria 5931
490 Ga0501070_0024284 3300049586 Bacteria 5083
491 Ga0501070_0029667 3300049586 Bacteria 4584
492 Ga0501070_0029743 3300049586 Bacteria 4578
493 Ga0501070_0033111 3300049586 Bacteria 4323
494 Ga0501070_0119429 3300049586 Bacteria 2179
495 Ga0501071_0010292 3300049587 Bacteria 6263
496 Ga0501071_0055828 3300049587 Bacteria 2852
497 Ga0501071_0325431 3300049587 Bacteria 1168
498 Ga0501072_0075689 3300049588 Bacteria 2662
499 Ga0501073_0002155 3300049589 Bacteria 14722
500 Ga0501073_0003198 3300049589 Bacteria 12293
501 Ga0501073_0010573 3300049589 Bacteria 6759
502 Ga0501073_0062199 3300049589 Bacteria 2604
503 Ga0501073_0118087 3300049589 Bacteria 1838
504 Ga0501074_0000038 3300049590 Bacteria 62674
505 Ga0501074_0002336 3300049590 Bacteria 13194
506 Ga0501074_0004592 3300049590 Bacteria 9889
507 Ga0501074_0005206 3300049590 Bacteria 9349
508 Ga0501074_0142947 3300049590 Bacteria 1711
509 Ga0501074_0265627 3300049590 Bacteria 1220
510 Ga0501076_0146160 3300049592 Bacteria 1922
511 Ga0501076_0155044 3300049592 Bacteria 1864
512 Ga0501077_0082730 3300049593 Bacteria 2034
513 Ga0501077_0118646 3300049593 Bacteria 1676
514 Ga0501079_0010982 3300049741 Bacteria 6901
515 Ga0501080_0001489 3300049742 Bacteria 19766
516 Ga0501080_0006975 3300049742 Bacteria 10197
517 Ga0501080_0017659 3300049742 Bacteria 6598
518 Ga0501080_0046542 3300049742 Bacteria 4039
519 Ga0501080_0071145 3300049742 Bacteria 3235
520 Ga0501080_0105910 3300049742 Bacteria 2607
521 Ga0501080_0112520 3300049742 Bacteria 2523
522 Ga0501080_0281358 3300049742 Bacteria 1512
523 Ga0501080_0363557 3300049742 Bacteria 1305
524 Ga0501080_0474102 3300049742 Bacteria 1120
525 Ga0501083_0000486 3300049744 Bacteria 25482
526 Ga0501083_0010008 3300049744 Bacteria 6690
527 Ga0501083_0011161 3300049744 Bacteria 6305
528 Ga0501035_0000101 3300049822 Bacteria 106949
529 Ga0501035_0000686 3300049822 Bacteria 36991
530 Ga0501035_0002218 3300049822 Bacteria 19286
531 Ga0501035_0011639 3300049822 Bacteria 8156
532 Ga0501035_0016562 3300049822 Bacteria 6796
533 Ga0501035_0018627 3300049822 Bacteria 6394
534 Ga0501035_0024168 3300049822 Bacteria 5574
535 Ga0501035_0045011 3300049822 Bacteria 3971
536 Ga0501035_0051220 3300049822 Bacteria 3697
537 Ga0501035_0053810 3300049822 Bacteria 3598
538 Ga0501035_0060913 3300049822 Bacteria 3359
539 Ga0501035_0075393 3300049822 Bacteria 2983
540 Ga0501035_0121434 3300049822 Bacteria 2283
541 Ga0501035_0143815 3300049822 Bacteria 2072
542 Ga0501044_0000010 3300049823 Bacteria 260121
543 Ga0501044_0001117 3300049823 Bacteria 31880
544 Ga0501044_0019527 3300049823 Bacteria 7247
545 Ga0501044_0025725 3300049823 Bacteria 6239
546 Ga0501044_0027422 3300049823 Bacteria 6020
547 Ga0501044_0028193 3300049823 Bacteria 5927
548 Ga0501044_0035088 3300049823 Bacteria 5254
549 Ga0501044_0039182 3300049823 Bacteria 4944
550 Ga0501044_0039379 3300049823 Bacteria 4932
551 Ga0501044_0050998 3300049823 Bacteria 4268
552 Ga0501044_0051330 3300049823 Bacteria 4252
553 Ga0501044_0063192 3300049823 Bacteria 3783
554 Ga0501044_0063279 3300049823 Bacteria 3780
555 Ga0501044_0103204 3300049823 Bacteria 2866
556 Ga0501044_0293731 3300049823 Bacteria 1556
557 Ga0501044_0317042 3300049823 Bacteria 1484
558 Ga0501045_0020998 3300049824 Bacteria 4668
559 nmdc:mga05p37_225037_c1 3300050507 Bacteria 2262
560 nmdc:mga05p37_63026_c1 3300050507 Bacteria 4563
561 nmdc:mga0n895_123350_c1 3300050512 Bacteria 2613
562 nmdc:mga0n895_8216_c1 3300050512 Bacteria 9024
563 nmdc:mga0n895_9728_c1 3300050512 Bacteria 8432
564 nmdc:mga0rr50_55912_c1 3300050513 Bacteria 2946
565 nmdc:mga08x19_101844_c1 3300050514 Bacteria 1906
566 nmdc:mga08x19_44118_c1 3300050514 Bacteria 2846
567 nmdc:mga0a205_12057_c1 3300050515 Bacteria 7986
568 nmdc:mga0a205_33819_c1 3300050515 Bacteria 4902
569 Ga0495601_0217340 3300053077 Bacteria 1248
570 Ga0495612_0031680 3300053078 Bacteria 2133
571 Ga0500578_0041140 3300053086 Bacteria 2969
572 Ga0500574_000145 3300053141 Bacteria 8097
573 Ga0500619_001229 3300053154 Bacteria 4470
574 Ga0500645_005630 3300053730 Bacteria 4579
575 Ga0501084_0014581 3300054114 Bacteria 6516
576 Ga0501084_0029695 3300054114 Bacteria 4574
577 Ga0501082_0008643 3300060353 Bacteria 8781
578 Ga0501082_0071799 3300060353 Bacteria 2981
579 Ga0501082_0154953 3300060353 Bacteria 1990
580 Ga0466962_0015181 3300061719 Bacteria 3713
581 Ga0466962_0033595 3300061719 Bacteria 2455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10051018 Ga0207657_100510182 269
2 3300006914 Ga0075436_100026407 Ga0075436_1000264073 270
3 3300050514 nmdc:mga08x19_44118_c1 nmdc:mga08x19_44118_c1_613_1563 270
4 3300005564 Ga0070664_100002113 Ga0070664_10000211313 271
5 3300010375 Ga0105239_10071273 Ga0105239_100712733 271
6 3300020070 Ga0206356_10381972 Ga0206356_103819721 271
7 3300025924 Ga0207694_10015610 Ga0207694_100156105 271
8 3300026116 Ga0207674_10000511 Ga0207674_100005116 271
9 3300049823 Ga0501044_0293731 Ga0501044_0293731_14_901 273
10 3300005563 Ga0068855_100049765 Ga0068855_1000497652 275
11 3300025949 Ga0207667_10083916 Ga0207667_100839163 275
12 3300049573 Ga0501037_0054713 Ga0501037_0054713_1480_2427 277
13 3300005336 Ga0070680_100030551 Ga0070680_1000305514 278
14 3300005366 Ga0070659_100047753 Ga0070659_1000477533 278
15 3300005440 Ga0070705_100001534 Ga0070705_1000015348 278
16 3300005444 Ga0070694_100093475 Ga0070694_1000934751 278
17 3300005445 Ga0070708_100058850 Ga0070708_1000588503 278
18 3300005458 Ga0070681_10024165 Ga0070681_100241654 278
19 3300005467 Ga0070706_100008849 Ga0070706_1000088498 278
20 3300005468 Ga0070707_100001104 Ga0070707_1000011044 278
21 3300005518 Ga0070699_100001129 Ga0070699_1000011293 278
22 3300005530 Ga0070679_100003375 Ga0070679_10000337513 278
23 3300005536 Ga0070697_100003818 Ga0070697_1000038182 278
24 3300005539 Ga0068853_100100502 Ga0068853_1001005023 278
25 3300005545 Ga0070695_100007046 Ga0070695_1000070464 278
26 3300005546 Ga0070696_100164293 Ga0070696_1001642932 278
27 3300005547 Ga0070693_100004537 Ga0070693_1000045374 278
28 3300005549 Ga0070704_100004097 Ga0070704_1000040974 278
29 3300005563 Ga0068855_100001151 Ga0068855_10000115125 278
30 3300005614 Ga0068856_100012512 Ga0068856_10001251210 278
31 3300006173 Ga0070716_100063054 Ga0070716_1000630542 278
32 3300025911 Ga0207654_10000309 Ga0207654_1000030918 278
33 3300025912 Ga0207707_10013786 Ga0207707_100137864 278
34 3300025913 Ga0207695_10054744 Ga0207695_100547444 278
35 3300025914 Ga0207671_10149278 Ga0207671_101492782 278
36 3300025915 Ga0207693_10056465 Ga0207693_100564652 278
37 3300025917 Ga0207660_10022445 Ga0207660_100224452 278
38 3300025920 Ga0207649_10260550 Ga0207649_102605502 278
39 3300025921 Ga0207652_10017515 Ga0207652_100175153 278
40 3300025922 Ga0207646_10020871 Ga0207646_100208713 278
41 3300025927 Ga0207687_10010369 Ga0207687_100103692 278
42 3300025949 Ga0207667_10035767 Ga0207667_100357674 278
43 3300025981 Ga0207640_10005700 Ga0207640_100057002 278
44 3300026078 Ga0207702_10033011 Ga0207702_100330114 278
45 3300046543 Ga0495645_0107882 Ga0495645_0107882_480_1439 278
46 3300005614 Ga0068856_100381876 Ga0068856_1003818762 279
47 3300013105 Ga0157369_10175220 Ga0157369_101752203 279
48 3300037466 Ga0395898_0006357 Ga0395898_0006357_7113_8111 279
49 3300038443 Ga0395901_0023198 Ga0395901_0023198_5256_6254 279
50 3300005434 Ga0070709_10005732 Ga0070709_100057324 280
51 3300005434 Ga0070709_10067789 Ga0070709_100677892 280
52 3300005436 Ga0070713_100014183 Ga0070713_1000141835 280
53 3300005437 Ga0070710_10013706 Ga0070710_100137064 280
54 3300005518 Ga0070699_100132653 Ga0070699_1001326532 280
55 3300005530 Ga0070679_100332971 Ga0070679_1003329712 280
56 3300005546 Ga0070696_100102310 Ga0070696_1001023101 280
57 3300005578 Ga0068854_100000264 Ga0068854_1000002644 280
58 3300009093 Ga0105240_10155013 Ga0105240_101550134 280
59 3300009545 Ga0105237_10080591 Ga0105237_100805913 280
60 3300013307 Ga0157372_10205399 Ga0157372_102053992 280
61 3300025898 Ga0207692_10006965 Ga0207692_100069656 280
62 3300025906 Ga0207699_10132728 Ga0207699_101327282 280
63 3300025916 Ga0207663_10104571 Ga0207663_101045712 280
64 3300025919 Ga0207657_10208102 Ga0207657_102081022 280
65 3300025921 Ga0207652_10101041 Ga0207652_101010413 280
66 3300027296 Ga0209389_1000032 Ga0209389_100003247 281
67 3300027361 Ga0209489_100035 Ga0209489_100035132 281
68 3300027363 Ga0209700_100005 Ga0209700_100005135 281
69 3300009098 Ga0105245_10063726 Ga0105245_100637263 283
70 3300009174 Ga0105241_10000844 Ga0105241_100008444 283
71 3300009545 Ga0105237_10429953 Ga0105237_104299532 283
72 3300010375 Ga0105239_10024356 Ga0105239_100243566 283
73 3300013100 Ga0157373_10029138 Ga0157373_100291382 283
74 3300013104 Ga0157370_10009405 Ga0157370_100094058 283
75 3300013104 Ga0157370_10026460 Ga0157370_100264605 283
76 3300013104 Ga0157370_10249078 Ga0157370_102490782 283
77 3300013307 Ga0157372_10280813 Ga0157372_102808132 283
78 3300025912 Ga0207707_10160785 Ga0207707_101607852 283
79 3300025916 Ga0207663_10214484 Ga0207663_102144842 283
80 iso_pu_bacteria 2513237139 2513876285 283
81 iso_pu_bacteria 2841941048 2841946277 283
82 3300025913 Ga0207695_10151164 Ga0207695_101511642 284
83 3300049570 Ga0501033_0003048 Ga0501033_0003048_10506_11456 284
84 3300049570 Ga0501033_0263873 Ga0501033_0263873_218_1168 284
85 3300049581 Ga0501047_0086803 Ga0501047_0086803_895_1845 284
86 3300049585 Ga0501069_0011751 Ga0501069_0011751_2432_3382 284
87 3300049586 Ga0501070_0000236 Ga0501070_0000236_41398_42348 284
88 3300049590 Ga0501074_0005206 Ga0501074_0005206_6031_6981 284
89 3300049742 Ga0501080_0006975 Ga0501080_0006975_6478_7428 284
90 3300049822 Ga0501035_0000686 Ga0501035_0000686_31590_32540 284
91 3300049823 Ga0501044_0035088 Ga0501044_0035088_3595_4545 284
92 3300049823 Ga0501044_0103204 Ga0501044_0103204_69_1019 284
93 3300005530 Ga0070679_100161535 Ga0070679_1001615352 285
94 3300005616 Ga0068852_100102146 Ga0068852_1001021462 285
95 3300013105 Ga0157369_10091814 Ga0157369_100918142 285
96 3300049570 Ga0501033_0005930 Ga0501033_0005930_8370_9317 286
97 3300049573 Ga0501037_0144447 Ga0501037_0144447_49_996 286
98 3300049574 Ga0501038_0294714 Ga0501038_0294714_22_969 286
99 3300049579 Ga0501043_0024562 Ga0501043_0024562_2588_3535 286
100 3300049822 Ga0501035_0016562 Ga0501035_0016562_5197_6144 286
101 3300050513 nmdc:mga0rr50_55912_c1 nmdc:mga0rr50_55912_c1_1956_2882 286
102 3300050514 nmdc:mga08x19_101844_c1 nmdc:mga08x19_101844_c1_264_1190 286
103 3300050515 nmdc:mga0a205_33819_c1 nmdc:mga0a205_33819_c1_2060_2986 286
104 3300006941 Ga0099825_1025006 Ga0099825_10250065 287
105 3300006944 Ga0099823_1000008 Ga0099823_100000868 287
106 3300049586 Ga0501070_0033111 Ga0501070_0033111_2696_3733 287
107 3300049590 Ga0501074_0004592 Ga0501074_0004592_5235_6272 287
108 3300005530 Ga0070679_100001628 Ga0070679_1000016283 288
109 3300046472 Ga0495580_0013886 Ga0495580_0013886_392_1342 288
110 3300005564 Ga0070664_100049426 Ga0070664_1000494264 289
111 3300005614 Ga0068856_100127749 Ga0068856_1001277493 289
112 3300025945 Ga0207679_10036156 Ga0207679_100361562 289
113 iso_pu_bacteria 2671180139 2671693064 289
114 iso_pu_bacteria 2824617872 2824618605 289
115 iso_pu_bacteria 2824626560 2824627180 289
116 iso_pu_bacteria 2824635225 2824635604 289
117 iso_pu_bacteria 2824644064 2824644440 289
118 iso_pu_bacteria 2824679649 2824680171 289
119 iso_pu_bacteria 2824714736 2824715472 289
120 iso_pu_bacteria 2824723954 2824724893 289
121 iso_pu_bacteria 2881147464 2881154397 289
122 iso_pu_bacteria 2881665667 2881670020 289
123 iso_pu_bacteria 2881927736 2881928509 289
124 iso_pu_bacteria 2935785616 2935788631 289
125 iso_pu_bacteria 2935793552 2935795743 289
126 iso_pu_bacteria 2941531003 2941533340 289
127 iso_pu_bacteria 3005718088 3005724528 289
128 iso_pu_bacteria 8016522445 8016523583 289
129 iso_pu_bacteria 8016530956 8016537096 289
130 iso_pu_bacteria 8016539877 8016541357 289
131 iso_pu_bacteria 8016548790 8016551892 289
132 iso_pu_bacteria 8016557553 8016560278 289
133 iso_pu_bacteria 8016566248 8016566750 289
134 iso_pu_bacteria 8016575299 8016579485 289
135 iso_pu_bacteria 8016595262 8016598193 289
136 3300006852 Ga0075433_10006491 Ga0075433_100064917 290
137 3300006871 Ga0075434_100002299 Ga0075434_1000022993 290
138 3300009093 Ga0105240_10006475 Ga0105240_100064758 290
139 3300009545 Ga0105237_10027219 Ga0105237_100272194 290
140 3300028800 Ga0265338_10002421 Ga0265338_1000242114 290
141 3300035091 Ga0373951_0040426 Ga0373951_0040426_99_1049 290
142 3300035112 Ga0373932_0004582 Ga0373932_0004582_1426_2376 290
143 3300045051 Ga0451576_0438934 Ga0451576_0438934_93_1043 290
144 3300050512 nmdc:mga0n895_8216_c1 nmdc:mga0n895_8216_c1_2012_2962 290
145 3300050515 nmdc:mga0a205_12057_c1 nmdc:mga0a205_12057_c1_2077_3027 290
146 3300053078 Ga0495612_0031680 Ga0495612_0031680_168_1106 290
147 3300048907 Ga0496104_0013101 Ga0496104_0013101_413_1360 291
148 3300006871 Ga0075434_100005263 Ga0075434_10000526310 292
149 3300006871 Ga0075434_100069766 Ga0075434_1000697663 292
150 3300007076 Ga0075435_100111485 Ga0075435_1001114852 292
151 3300027907 Ga0207428_10158798 Ga0207428_101587981 292
152 3300029957 Ga0265324_10008319 Ga0265324_100083193 292
153 3300037418 Ga0395900_0127646 Ga0395900_0127646_899_1843 292
154 3300037466 Ga0395898_0012577 Ga0395898_0012577_3641_4585 292
155 3300037466 Ga0395898_0040118 Ga0395898_0040118_2349_3293 292
156 3300038443 Ga0395901_0016687 Ga0395901_0016687_6238_7182 292
157 3300044673 Ga0453683_0009299 Ga0453683_0009299_2565_3518 292
158 3300046543 Ga0495645_0196985 Ga0495645_0196985_161_1105 292
159 3300049568 Ga0501031_0175832 Ga0501031_0175832_375_1322 292
160 3300049569 Ga0501032_0021807 Ga0501032_0021807_80_1027 292
161 3300049569 Ga0501032_0230738 Ga0501032_0230738_147_1094 292
162 3300049571 Ga0501034_0067154 Ga0501034_0067154_11_958 292
163 3300049572 Ga0501036_0177867 Ga0501036_0177867_92_1039 292
164 3300049572 Ga0501036_0311257 Ga0501036_0311257_278_1225 292
165 3300049573 Ga0501037_0238703 Ga0501037_0238703_98_1045 292
166 3300049574 Ga0501038_0115907 Ga0501038_0115907_92_1039 292
167 3300049574 Ga0501038_0192341 Ga0501038_0192341_224_1171 292
168 3300049574 Ga0501038_0387886 Ga0501038_0387886_37_984 292
169 3300049581 Ga0501047_0016670 Ga0501047_0016670_82_1029 292
170 3300049581 Ga0501047_0118030 Ga0501047_0118030_420_1367 292
171 3300049582 Ga0501048_0091049 Ga0501048_0091049_700_1647 292
172 3300049742 Ga0501080_0474102 Ga0501080_0474102_25_969 292
173 3300049823 Ga0501044_0051330 Ga0501044_0051330_793_1740 292
174 3300049824 Ga0501045_0020998 Ga0501045_0020998_2921_3868 292
175 3300050512 nmdc:mga0n895_9728_c1 nmdc:mga0n895_9728_c1_2925_3875 292
176 3300005327 Ga0070658_10025149 Ga0070658_100251494 293
177 3300005327 Ga0070658_10041813 Ga0070658_100418133 293
178 3300005327 Ga0070658_10315017 Ga0070658_103150172 293
179 3300005329 Ga0070683_100003578 Ga0070683_1000035787 293
180 3300005336 Ga0070680_100015275 Ga0070680_1000152754 293
181 3300005336 Ga0070680_100160556 Ga0070680_1001605562 293
182 3300005339 Ga0070660_100007517 Ga0070660_1000075175 293
183 3300005339 Ga0070660_100030028 Ga0070660_1000300284 293
184 3300005339 Ga0070660_100061926 Ga0070660_1000619263 293
185 3300005339 Ga0070660_100195813 Ga0070660_1001958132 293
186 3300005341 Ga0070691_10023065 Ga0070691_100230652 293
187 3300005344 Ga0070661_100014691 Ga0070661_1000146912 293
188 3300005344 Ga0070661_100058093 Ga0070661_1000580933 293
189 3300005366 Ga0070659_100027339 Ga0070659_1000273393 293
190 3300005366 Ga0070659_100075754 Ga0070659_1000757543 293
191 3300005455 Ga0070663_100016228 Ga0070663_1000162283 293
192 3300005458 Ga0070681_10076061 Ga0070681_100760612 293
193 3300005458 Ga0070681_10205188 Ga0070681_102051882 293
194 3300005467 Ga0070706_100191838 Ga0070706_1001918382 293
195 3300005530 Ga0070679_100027472 Ga0070679_1000274724 293
196 3300005530 Ga0070679_100061036 Ga0070679_1000610364 293
197 3300005530 Ga0070679_100106547 Ga0070679_1001065472 293
198 3300005530 Ga0070679_100169546 Ga0070679_1001695463 293
199 3300005535 Ga0070684_100040291 Ga0070684_1000402915 293
200 3300005535 Ga0070684_100130411 Ga0070684_1001304112 293
201 3300005539 Ga0068853_100012850 Ga0068853_1000128503 293
202 3300005539 Ga0068853_100046945 Ga0068853_1000469454 293
203 3300005539 Ga0068853_100116989 Ga0068853_1001169892 293
204 3300005547 Ga0070693_100108234 Ga0070693_1001082342 293
205 3300005563 Ga0068855_100005260 Ga0068855_1000052607 293
206 3300005563 Ga0068855_100254394 Ga0068855_1002543942 293
207 3300005564 Ga0070664_100099830 Ga0070664_1000998303 293
208 3300005577 Ga0068857_100054993 Ga0068857_1000549933 293
209 3300005578 Ga0068854_100012869 Ga0068854_1000128693 293
210 3300005614 Ga0068856_100000201 Ga0068856_10000020136 293
211 3300005614 Ga0068856_100068368 Ga0068856_1000683682 293
212 3300005614 Ga0068856_100642818 Ga0068856_1006428181 293
213 3300005616 Ga0068852_100109770 Ga0068852_1001097703 293
214 3300005616 Ga0068852_100517282 Ga0068852_1005172822 293
215 3300009093 Ga0105240_10121985 Ga0105240_101219853 293
216 3300009093 Ga0105240_10271117 Ga0105240_102711172 293
217 3300009093 Ga0105240_10380529 Ga0105240_103805292 293
218 3300009545 Ga0105237_10380554 Ga0105237_103805542 293
219 3300009551 Ga0105238_10023932 Ga0105238_100239325 293
220 3300009551 Ga0105238_10092080 Ga0105238_100920802 293
221 3300010375 Ga0105239_10019472 Ga0105239_1001947211 293
222 3300010375 Ga0105239_10025431 Ga0105239_100254313 293
223 3300013100 Ga0157373_10151692 Ga0157373_101516922 293
224 3300013105 Ga0157369_10005734 Ga0157369_1000573414 293
225 3300013105 Ga0157369_10016178 Ga0157369_100161785 293
226 3300013105 Ga0157369_10031111 Ga0157369_100311113 293
227 3300013105 Ga0157369_10235468 Ga0157369_102354682 293
228 3300013105 Ga0157369_10247776 Ga0157369_102477762 293
229 3300013307 Ga0157372_10299886 Ga0157372_102998862 293
230 3300013307 Ga0157372_10316644 Ga0157372_103166441 293
231 3300015262 Ga0182007_10028002 Ga0182007_100280022 293
232 3300025909 Ga0207705_10078777 Ga0207705_100787773 293
233 3300025912 Ga0207707_10007038 Ga0207707_100070385 293
234 3300025912 Ga0207707_10016582 Ga0207707_100165826 293
235 3300025913 Ga0207695_10128963 Ga0207695_101289633 293
236 3300025915 Ga0207693_10052739 Ga0207693_100527393 293
237 3300025917 Ga0207660_10031312 Ga0207660_100313125 293
238 3300025917 Ga0207660_10038448 Ga0207660_100384483 293
239 3300025919 Ga0207657_10021498 Ga0207657_100214986 293
240 3300025919 Ga0207657_10038756 Ga0207657_100387562 293
241 3300025919 Ga0207657_10086295 Ga0207657_100862953 293
242 3300025920 Ga0207649_10040850 Ga0207649_100408502 293
243 3300025920 Ga0207649_10096261 Ga0207649_100962612 293
244 3300025920 Ga0207649_10142021 Ga0207649_101420212 293
245 3300025921 Ga0207652_10037175 Ga0207652_100371753 293
246 3300025921 Ga0207652_10090575 Ga0207652_100905753 293
247 3300025921 Ga0207652_10185077 Ga0207652_101850772 293
248 3300025924 Ga0207694_10020462 Ga0207694_100204624 293
249 3300025929 Ga0207664_10073712 Ga0207664_100737123 293
250 3300025932 Ga0207690_10045003 Ga0207690_100450033 293
251 3300025932 Ga0207690_10076227 Ga0207690_100762273 293
252 3300025944 Ga0207661_10054294 Ga0207661_100542944 293
253 3300025944 Ga0207661_10134332 Ga0207661_101343322 293
254 3300025945 Ga0207679_10077970 Ga0207679_100779702 293
255 3300025949 Ga0207667_10005378 Ga0207667_1000537816 293
256 3300025949 Ga0207667_10053979 Ga0207667_100539794 293
257 3300025981 Ga0207640_10038773 Ga0207640_100387732 293
258 3300026041 Ga0207639_10060459 Ga0207639_100604593 293
259 3300026041 Ga0207639_10119720 Ga0207639_101197202 293
260 3300026041 Ga0207639_10138544 Ga0207639_101385442 293
261 3300026041 Ga0207639_10354545 Ga0207639_103545451 293
262 3300026067 Ga0207678_10029166 Ga0207678_100291664 293
263 3300026067 Ga0207678_10052319 Ga0207678_100523193 293
264 3300026067 Ga0207678_10151377 Ga0207678_101513772 293
265 3300026078 Ga0207702_10000666 Ga0207702_1000066610 293
266 3300026078 Ga0207702_10050662 Ga0207702_100506621 293
267 3300026116 Ga0207674_10035463 Ga0207674_100354633 293
268 3300026116 Ga0207674_10044550 Ga0207674_100445502 293
269 3300026142 Ga0207698_10106559 Ga0207698_101065592 293
270 3300028800 Ga0265338_10007612 Ga0265338_100076123 293
271 3300031712 Ga0265342_10064861 Ga0265342_100648612 293
272 3300036401 Ga0373937_0324504 Ga0373937_0324504_135_1082 293
273 3300037312 Ga0395899_0012468 Ga0395899_0012468_1170_2117 293
274 3300037418 Ga0395900_0005920 Ga0395900_0005920_10269_11216 293
275 3300037418 Ga0395900_0006728 Ga0395900_0006728_7849_8796 293
276 3300037418 Ga0395900_0016908 Ga0395900_0016908_1285_2232 293
277 3300037418 Ga0395900_0103217 Ga0395900_0103217_1321_2268 293
278 3300037466 Ga0395898_0000466 Ga0395898_0000466_5101_6060 293
279 3300037466 Ga0395898_0021484 Ga0395898_0021484_4922_5869 293
280 3300037466 Ga0395898_0076468 Ga0395898_0076468_294_1241 293
281 3300037466 Ga0395898_0095440 Ga0395898_0095440_1364_2311 293
282 3300038443 Ga0395901_0018929 Ga0395901_0018929_1252_2199 293
283 3300038443 Ga0395901_0023233 Ga0395901_0023233_967_1914 293
284 3300038443 Ga0395901_0046220 Ga0395901_0046220_3073_4020 293
285 3300038443 Ga0395901_0056445 Ga0395901_0056445_3064_4011 293
286 3300044684 Ga0466966_0086759 Ga0466966_0086759_352_1299 293
287 3300044694 Ga0466963_0019393 Ga0466963_0019393_1887_2834 293
288 3300044706 Ga0466964_0010444 Ga0466964_0010444_1079_2026 293
289 3300044765 Ga0466970_0022445 Ga0466970_0022445_40_987 293
290 3300045049 Ga0466959_0000132 Ga0466959_0000132_45696_46643 293
291 3300045976 Ga0466967_0029801 Ga0466967_0029801_3162_4109 293
292 3300046462 Ga0495651_0028704 Ga0495651_0028704_2528_3475 293
293 3300046463 Ga0495653_0007087 Ga0495653_0007087_5464_6411 293
294 3300046511 Ga0495608_0003455 Ga0495608_0003455_9386_10333 293
295 3300046516 Ga0495628_0001036 Ga0495628_0001036_11759_12715 293
296 3300046516 Ga0495628_0024449 Ga0495628_0024449_3642_4589 293
297 3300046529 Ga0495652_0007912 Ga0495652_0007912_3315_4271 293
298 3300046529 Ga0495652_0011412 Ga0495652_0011412_2670_3617 293
299 3300046543 Ga0495645_0003363 Ga0495645_0003363_3065_4012 293
300 3300046679 Ga0495623_0002357 Ga0495623_0002357_2015_2971 293
301 3300046680 Ga0495646_0000769 Ga0495646_0000769_13288_14235 293
302 3300046690 Ga0495624_0006878 Ga0495624_0006878_2797_3744 293
303 3300046809 Ga0495600_0000302 Ga0495600_0000302_11000_11947 293
304 3300047317 Ga0495604_0014293 Ga0495604_0014293_1995_2942 293
305 3300048088 Ga0495602_0010154 Ga0495602_0010154_7904_8851 293
306 3300049568 Ga0501031_0001433 Ga0501031_0001433_13403_14350 293
307 3300049568 Ga0501031_0031155 Ga0501031_0031155_471_1418 293
308 3300049568 Ga0501031_0063469 Ga0501031_0063469_1142_2092 293
309 3300049568 Ga0501031_0157334 Ga0501031_0157334_29_979 293
310 3300049568 Ga0501031_0160933 Ga0501031_0160933_328_1275 293
311 3300049569 Ga0501032_0002972 Ga0501032_0002972_11263_12213 293
312 3300049569 Ga0501032_0005831 Ga0501032_0005831_6678_7625 293
313 3300049569 Ga0501032_0006330 Ga0501032_0006330_4517_5464 293
314 3300049569 Ga0501032_0096140 Ga0501032_0096140_633_1580 293
315 3300049570 Ga0501033_0000491 Ga0501033_0000491_21489_22436 293
316 3300049570 Ga0501033_0001064 Ga0501033_0001064_6340_7290 293
317 3300049570 Ga0501033_0003984 Ga0501033_0003984_5268_6215 293
318 3300049570 Ga0501033_0023300 Ga0501033_0023300_1793_2740 293
319 3300049570 Ga0501033_0036508 Ga0501033_0036508_694_1641 293
320 3300049570 Ga0501033_0106610 Ga0501033_0106610_629_1576 293
321 3300049571 Ga0501034_0003792 Ga0501034_0003792_7080_8027 293
322 3300049571 Ga0501034_0038995 Ga0501034_0038995_1914_2861 293
323 3300049571 Ga0501034_0052570 Ga0501034_0052570_861_1808 293
324 3300049571 Ga0501034_0120230 Ga0501034_0120230_751_1698 293
325 3300049571 Ga0501034_0245942 Ga0501034_0245942_383_1333 293
326 3300049571 Ga0501034_0531234 Ga0501034_0531234_99_1046 293
327 3300049572 Ga0501036_0000389 Ga0501036_0000389_14890_15837 293
328 3300049572 Ga0501036_0008161 Ga0501036_0008161_2520_3467 293
329 3300049572 Ga0501036_0106474 Ga0501036_0106474_736_1686 293
330 3300049573 Ga0501037_0000242 Ga0501037_0000242_14465_15415 293
331 3300049573 Ga0501037_0003351 Ga0501037_0003351_5089_6036 293
332 3300049573 Ga0501037_0016606 Ga0501037_0016606_4031_4978 293
333 3300049573 Ga0501037_0026335 Ga0501037_0026335_494_1441 293
334 3300049573 Ga0501037_0091008 Ga0501037_0091008_545_1492 293
335 3300049573 Ga0501037_0153892 Ga0501037_0153892_410_1360 293
336 3300049574 Ga0501038_0000414 Ga0501038_0000414_13722_14669 293
337 3300049574 Ga0501038_0002561 Ga0501038_0002561_2453_3400 293
338 3300049574 Ga0501038_0019665 Ga0501038_0019665_813_1760 293
339 3300049574 Ga0501038_0027799 Ga0501038_0027799_2158_3105 293
340 3300049574 Ga0501038_0029545 Ga0501038_0029545_1613_2560 293
341 3300049574 Ga0501038_0093349 Ga0501038_0093349_1459_2409 293
342 3300049575 Ga0501039_0001213 Ga0501039_0001213_3689_4636 293
343 3300049575 Ga0501039_0030366 Ga0501039_0030366_2510_3457 293
344 3300049578 Ga0501042_0017171 Ga0501042_0017171_2037_2984 293
345 3300049578 Ga0501042_0032243 Ga0501042_0032243_400_1347 293
346 3300049579 Ga0501043_0000440 Ga0501043_0000440_21708_22658 293
347 3300049579 Ga0501043_0003602 Ga0501043_0003602_9031_9978 293
348 3300049579 Ga0501043_0017774 Ga0501043_0017774_561_1508 293
349 3300049579 Ga0501043_0030180 Ga0501043_0030180_2741_3688 293
350 3300049579 Ga0501043_0130489 Ga0501043_0130489_183_1133 293
351 3300049580 Ga0501046_0002040 Ga0501046_0002040_17244_18191 293
352 3300049580 Ga0501046_0011601 Ga0501046_0011601_3787_4734 293
353 3300049580 Ga0501046_0034190 Ga0501046_0034190_2296_3243 293
354 3300049580 Ga0501046_0132282 Ga0501046_0132282_150_1100 293
355 3300049581 Ga0501047_0002605 Ga0501047_0002605_13791_14738 293
356 3300049581 Ga0501047_0009900 Ga0501047_0009900_3451_4401 293
357 3300049581 Ga0501047_0023058 Ga0501047_0023058_3789_4736 293
358 3300049581 Ga0501047_0075304 Ga0501047_0075304_1395_2342 293
359 3300049581 Ga0501047_0099405 Ga0501047_0099405_49_996 293
360 3300049581 Ga0501047_0215415 Ga0501047_0215415_65_1012 293
361 3300049581 Ga0501047_0319574 Ga0501047_0319574_63_1013 293
362 3300049581 Ga0501047_0422343 Ga0501047_0422343_182_1129 293
363 3300049582 Ga0501048_0005338 Ga0501048_0005338_5084_6031 293
364 3300049583 Ga0501067_0004016 Ga0501067_0004016_3753_4700 293
365 3300049583 Ga0501067_0016242 Ga0501067_0016242_2352_3302 293
366 3300049584 Ga0501068_0001262 Ga0501068_0001262_8167_9114 293
367 3300049585 Ga0501069_0000017 Ga0501069_0000017_40339_41289 293
368 3300049585 Ga0501069_0000794 Ga0501069_0000794_6970_7917 293
369 3300049585 Ga0501069_0007385 Ga0501069_0007385_2913_3863 293
370 3300049586 Ga0501070_0005231 Ga0501070_0005231_7935_8885 293
371 3300049586 Ga0501070_0024284 Ga0501070_0024284_1914_2861 293
372 3300049586 Ga0501070_0029743 Ga0501070_0029743_2842_3792 293
373 3300049586 Ga0501070_0119429 Ga0501070_0119429_516_1463 293
374 3300049587 Ga0501071_0010292 Ga0501071_0010292_1375_2325 293
375 3300049587 Ga0501071_0055828 Ga0501071_0055828_665_1612 293
376 3300049587 Ga0501071_0325431 Ga0501071_0325431_144_1091 293
377 3300049588 Ga0501072_0075689 Ga0501072_0075689_1660_2607 293
378 3300049589 Ga0501073_0003198 Ga0501073_0003198_5469_6419 293
379 3300049589 Ga0501073_0010573 Ga0501073_0010573_4573_5520 293
380 3300049590 Ga0501074_0000038 Ga0501074_0000038_9240_10190 293
381 3300049590 Ga0501074_0002336 Ga0501074_0002336_8472_9419 293
382 3300049590 Ga0501074_0265627 Ga0501074_0265627_121_1068 293
383 3300049592 Ga0501076_0155044 Ga0501076_0155044_486_1436 293
384 3300049593 Ga0501077_0118646 Ga0501077_0118646_162_1109 293
385 3300049741 Ga0501079_0010982 Ga0501079_0010982_2629_3576 293
386 3300049742 Ga0501080_0001489 Ga0501080_0001489_4360_5310 293
387 3300049742 Ga0501080_0017659 Ga0501080_0017659_3738_4685 293
388 3300049742 Ga0501080_0046542 Ga0501080_0046542_1606_2556 293
389 3300049742 Ga0501080_0071145 Ga0501080_0071145_543_1493 293
390 3300049742 Ga0501080_0112520 Ga0501080_0112520_862_1812 293
391 3300049742 Ga0501080_0363557 Ga0501080_0363557_47_994 293
392 3300049744 Ga0501083_0000486 Ga0501083_0000486_11288_12238 293
393 3300049744 Ga0501083_0010008 Ga0501083_0010008_1990_2937 293
394 3300049744 Ga0501083_0011161 Ga0501083_0011161_1606_2553 293
395 3300049822 Ga0501035_0000101 Ga0501035_0000101_14807_15757 293
396 3300049822 Ga0501035_0002218 Ga0501035_0002218_5609_6556 293
397 3300049822 Ga0501035_0011639 Ga0501035_0011639_733_1683 293
398 3300049822 Ga0501035_0018627 Ga0501035_0018627_4444_5391 293
399 3300049822 Ga0501035_0024168 Ga0501035_0024168_561_1508 293
400 3300049822 Ga0501035_0051220 Ga0501035_0051220_2530_3480 293
401 3300049822 Ga0501035_0053810 Ga0501035_0053810_2306_3253 293
402 3300049822 Ga0501035_0060913 Ga0501035_0060913_117_1064 293
403 3300049822 Ga0501035_0075393 Ga0501035_0075393_587_1537 293
404 3300049822 Ga0501035_0121434 Ga0501035_0121434_733_1683 293
405 3300049822 Ga0501035_0143815 Ga0501035_0143815_494_1441 293
406 3300049823 Ga0501044_0000010 Ga0501044_0000010_148401_149351 293
407 3300049823 Ga0501044_0001117 Ga0501044_0001117_13105_14052 293
408 3300049823 Ga0501044_0019527 Ga0501044_0019527_3755_4702 293
409 3300049823 Ga0501044_0025725 Ga0501044_0025725_4938_5885 293
410 3300049823 Ga0501044_0028193 Ga0501044_0028193_4420_5367 293
411 3300049823 Ga0501044_0039182 Ga0501044_0039182_3314_4264 293
412 3300049823 Ga0501044_0050998 Ga0501044_0050998_1011_1958 293
413 3300049823 Ga0501044_0063192 Ga0501044_0063192_1050_1997 293
414 3300049823 Ga0501044_0063279 Ga0501044_0063279_28_978 293
415 3300049823 Ga0501044_0317042 Ga0501044_0317042_237_1184 293
416 3300053077 Ga0495601_0217340 Ga0495601_0217340_28_984 293
417 3300053086 Ga0500578_0041140 Ga0500578_0041140_1186_2133 293
418 3300053141 Ga0500574_000145 Ga0500574_000145_3605_4552 293
419 3300053154 Ga0500619_001229 Ga0500619_001229_1366_2313 293
420 3300053730 Ga0500645_005630 Ga0500645_005630_2292_3239 293
421 3300054114 Ga0501084_0014581 Ga0501084_0014581_2365_3312 293
422 3300054114 Ga0501084_0029695 Ga0501084_0029695_1310_2257 293
423 3300060353 Ga0501082_0008643 Ga0501082_0008643_3661_4608 293
424 3300060353 Ga0501082_0071799 Ga0501082_0071799_1678_2628 293
425 3300060353 Ga0501082_0154953 Ga0501082_0154953_78_1025 293
426 3300061719 Ga0466962_0015181 Ga0466962_0015181_2157_3104 293
427 3300005288 Ga0065714_10134588 Ga0065714_101345881 294
428 3300005290 Ga0065712_10008621 Ga0065712_100086212 294
429 3300005293 Ga0065715_10022830 Ga0065715_100228302 294
430 3300005293 Ga0065715_10099295 Ga0065715_100992952 294
431 3300005327 Ga0070658_10029764 Ga0070658_100297645 294
432 3300005329 Ga0070683_100027645 Ga0070683_1000276453 294
433 3300005331 Ga0070670_100001233 Ga0070670_1000012338 294
434 3300005334 Ga0068869_100309599 Ga0068869_1003095991 294
435 3300005336 Ga0070680_100014750 Ga0070680_1000147505 294
436 3300005339 Ga0070660_100022097 Ga0070660_1000220972 294
437 3300005340 Ga0070689_100216498 Ga0070689_1002164982 294
438 3300005344 Ga0070661_100114909 Ga0070661_1001149091 294
439 3300005354 Ga0070675_100155464 Ga0070675_1001554642 294
440 3300005355 Ga0070671_100193197 Ga0070671_1001931972 294
441 3300005364 Ga0070673_100208220 Ga0070673_1002082202 294
442 3300005366 Ga0070659_100120517 Ga0070659_1001205172 294
443 3300005435 Ga0070714_100096279 Ga0070714_1000962793 294
444 3300005440 Ga0070705_100121421 Ga0070705_1001214212 294
445 3300005444 Ga0070694_100047034 Ga0070694_1000470343 294
446 3300005455 Ga0070663_100055219 Ga0070663_1000552192 294
447 3300005455 Ga0070663_100068642 Ga0070663_1000686422 294
448 3300005457 Ga0070662_100198270 Ga0070662_1001982702 294
449 3300005458 Ga0070681_10003478 Ga0070681_1000347811 294
450 3300005458 Ga0070681_10004519 Ga0070681_100045193 294
451 3300005458 Ga0070681_10007047 Ga0070681_100070474 294
452 3300005458 Ga0070681_10017923 Ga0070681_100179235 294
453 3300005458 Ga0070681_10098041 Ga0070681_100980413 294
454 3300005458 Ga0070681_10152881 Ga0070681_101528812 294
455 3300005459 Ga0068867_100049636 Ga0068867_1000496363 294
456 3300005530 Ga0070679_100037821 Ga0070679_1000378213 294
457 3300005530 Ga0070679_100099090 Ga0070679_1000990903 294
458 3300005530 Ga0070679_100318553 Ga0070679_1003185532 294
459 3300005535 Ga0070684_100073771 Ga0070684_1000737713 294
460 3300005535 Ga0070684_100142984 Ga0070684_1001429842 294
461 3300005535 Ga0070684_100198145 Ga0070684_1001981452 294
462 3300005535 Ga0070684_100514145 Ga0070684_1005141451 294
463 3300005539 Ga0068853_100014496 Ga0068853_1000144962 294
464 3300005539 Ga0068853_100138965 Ga0068853_1001389652 294
465 3300005543 Ga0070672_100011815 Ga0070672_1000118153 294
466 3300005545 Ga0070695_100011240 Ga0070695_1000112403 294
467 3300005546 Ga0070696_100059783 Ga0070696_1000597832 294
468 3300005547 Ga0070693_100172615 Ga0070693_1001726152 294
469 3300005564 Ga0070664_100001998 Ga0070664_1000019983 294
470 3300005564 Ga0070664_100004806 Ga0070664_10000480611 294
471 3300005577 Ga0068857_100017376 Ga0068857_1000173767 294
472 3300005577 Ga0068857_100036141 Ga0068857_1000361412 294
473 3300005614 Ga0068856_100006419 Ga0068856_1000064198 294
474 3300005614 Ga0068856_100068792 Ga0068856_1000687922 294
475 3300005618 Ga0068864_100131179 Ga0068864_1001311793 294
476 3300006871 Ga0075434_100051987 Ga0075434_1000519873 294
477 3300006871 Ga0075434_100100111 Ga0075434_1001001112 294
478 3300006914 Ga0075436_100068833 Ga0075436_1000688332 294
479 3300007076 Ga0075435_100010407 Ga0075435_1000104077 294
480 3300007076 Ga0075435_100067305 Ga0075435_1000673052 294
481 3300009093 Ga0105240_10420259 Ga0105240_104202592 294
482 3300009094 Ga0111539_10066735 Ga0111539_100667353 294
483 3300009147 Ga0114129_10040825 Ga0114129_100408254 294
484 3300009174 Ga0105241_10114320 Ga0105241_101143202 294
485 3300009545 Ga0105237_10032654 Ga0105237_100326542 294
486 3300009545 Ga0105237_10066329 Ga0105237_100663292 294
487 3300010375 Ga0105239_10074352 Ga0105239_100743522 294
488 3300011119 Ga0105246_10236995 Ga0105246_102369952 294
489 3300013100 Ga0157373_10012847 Ga0157373_100128476 294
490 3300013100 Ga0157373_10202814 Ga0157373_102028142 294
491 3300013100 Ga0157373_10208557 Ga0157373_102085571 294
492 3300013104 Ga0157370_10029531 Ga0157370_100295313 294
493 3300013104 Ga0157370_10104751 Ga0157370_101047513 294
494 3300013104 Ga0157370_10238853 Ga0157370_102388531 294
495 3300013105 Ga0157369_10009833 Ga0157369_100098337 294
496 3300013105 Ga0157369_10200017 Ga0157369_102000172 294
497 3300013105 Ga0157369_10357670 Ga0157369_103576702 294
498 3300013297 Ga0157378_10169711 Ga0157378_101697112 294
499 3300013306 Ga0163162_10062510 Ga0163162_100625105 294
500 3300013307 Ga0157372_10030805 Ga0157372_100308055 294
501 3300013307 Ga0157372_10199181 Ga0157372_101991812 294
502 3300013307 Ga0157372_10248400 Ga0157372_102484002 294
503 3300013307 Ga0157372_10473316 Ga0157372_104733161 294
504 3300014969 Ga0157376_10063838 Ga0157376_100638382 294
505 3300025315 Ga0207697_10004842 Ga0207697_100048427 294
506 3300025901 Ga0207688_10038207 Ga0207688_100382072 294
507 3300025903 Ga0207680_10104168 Ga0207680_101041682 294
508 3300025904 Ga0207647_10185813 Ga0207647_101858132 294
509 3300025907 Ga0207645_10014549 Ga0207645_100145491 294
510 3300025909 Ga0207705_10015290 Ga0207705_100152902 294
511 3300025912 Ga0207707_10003406 Ga0207707_100034069 294
512 3300025912 Ga0207707_10010070 Ga0207707_100100703 294
513 3300025912 Ga0207707_10093039 Ga0207707_100930392 294
514 3300025912 Ga0207707_10109710 Ga0207707_101097102 294
515 3300025912 Ga0207707_10246560 Ga0207707_102465602 294
516 3300025913 Ga0207695_10038008 Ga0207695_100380085 294
517 3300025913 Ga0207695_10072865 Ga0207695_100728653 294
518 3300025914 Ga0207671_10029908 Ga0207671_100299082 294
519 3300025914 Ga0207671_10048639 Ga0207671_100486395 294
520 3300025917 Ga0207660_10009716 Ga0207660_100097166 294
521 3300025917 Ga0207660_10044027 Ga0207660_100440273 294
522 3300025917 Ga0207660_10049884 Ga0207660_100498843 294
523 3300025919 Ga0207657_10001238 Ga0207657_100012389 294
524 3300025919 Ga0207657_10001822 Ga0207657_100018225 294
525 3300025920 Ga0207649_10043045 Ga0207649_100430453 294
526 3300025920 Ga0207649_10043283 Ga0207649_100432833 294
527 3300025920 Ga0207649_10112253 Ga0207649_101122532 294
528 3300025920 Ga0207649_10136573 Ga0207649_101365732 294
529 3300025921 Ga0207652_10001455 Ga0207652_1000145524 294
530 3300025921 Ga0207652_10017994 Ga0207652_100179946 294
531 3300025921 Ga0207652_10020173 Ga0207652_100201732 294
532 3300025921 Ga0207652_10109710 Ga0207652_101097102 294
533 3300025921 Ga0207652_10130850 Ga0207652_101308502 294
534 3300025921 Ga0207652_10176378 Ga0207652_101763782 294
535 3300025925 Ga0207650_10002518 Ga0207650_100025187 294
536 3300025926 Ga0207659_10061228 Ga0207659_100612282 294
537 3300025928 Ga0207700_10019523 Ga0207700_100195233 294
538 3300025929 Ga0207664_10069115 Ga0207664_100691153 294
539 3300025932 Ga0207690_10016009 Ga0207690_100160092 294
540 3300025933 Ga0207706_10014809 Ga0207706_100148093 294
541 3300025933 Ga0207706_10167436 Ga0207706_101674362 294
542 3300025940 Ga0207691_10129972 Ga0207691_101299721 294
543 3300025942 Ga0207689_10159859 Ga0207689_101598592 294
544 3300025944 Ga0207661_10004708 Ga0207661_100047082 294
545 3300025944 Ga0207661_10065873 Ga0207661_100658733 294
546 3300025945 Ga0207679_10229389 Ga0207679_102293892 294
547 3300025949 Ga0207667_10002177 Ga0207667_1000217720 294
548 3300025949 Ga0207667_10031897 Ga0207667_100318972 294
549 3300025960 Ga0207651_10106617 Ga0207651_101066172 294
550 3300026041 Ga0207639_10122806 Ga0207639_101228063 294
551 3300026041 Ga0207639_10134171 Ga0207639_101341711 294
552 3300026067 Ga0207678_10019937 Ga0207678_100199375 294
553 3300026067 Ga0207678_10036269 Ga0207678_100362693 294
554 3300026078 Ga0207702_10047646 Ga0207702_100476462 294
555 3300026078 Ga0207702_10188434 Ga0207702_101884342 294
556 3300026078 Ga0207702_10511779 Ga0207702_105117792 294
557 3300026116 Ga0207674_10028513 Ga0207674_100285136 294
558 3300026121 Ga0207683_10023348 Ga0207683_100233483 294
559 3300028379 Ga0268266_10182621 Ga0268266_101826212 294
560 3300032133 Ga0316583_10000402 Ga0316583_100004023 294
561 3300035171 Ga0373946_0057359 Ga0373946_0057359_356_1306 294
562 3300035691 Ga0373931_0075732 Ga0373931_0075732_340_1290 294
563 3300035692 Ga0373935_0034517 Ga0373935_0034517_329_1279 294
564 3300035725 Ga0373947_0005237 Ga0373947_0005237_1428_2378 294
565 3300037068 Ga0373925_0019790 Ga0373925_0019790_2014_2964 294
566 3300037312 Ga0395899_0125746 Ga0395899_0125746_183_1136 294
567 3300037418 Ga0395900_0005282 Ga0395900_0005282_5617_6570 294
568 3300037466 Ga0395898_0008548 Ga0395898_0008548_5044_5997 294
569 3300037471 Ga0395905_0056850 Ga0395905_0056850_2317_3267 294
570 3300042876 Ga0451577_0054925 Ga0451577_0054925_902_1852 294
571 3300044712 Ga0453684_0613969 Ga0453684_0613969_109_1059 294
572 3300045051 Ga0451576_0011652 Ga0451576_0011652_707_1657 294
573 3300045051 Ga0451576_0324420 Ga0451576_0324420_269_1219 294
574 3300045836 Ga0466958_0150357 Ga0466958_0150357_272_1222 294
575 3300046472 Ga0495580_0054729 Ga0495580_0054729_1795_2745 294
576 3300048904 Ga0496101_0310694 Ga0496101_0310694_13_963 294
577 3300048907 Ga0496104_0475040 Ga0496104_0475040_180_1130 294
578 3300048911 Ga0496108_0146183 Ga0496108_0146183_698_1648 294
579 3300048912 Ga0496109_0083823 Ga0496109_0083823_1636_2586 294
580 3300048916 Ga0496113_0086652 Ga0496113_0086652_1143_2093 294
581 3300049569 Ga0501032_0127365 Ga0501032_0127365_184_1134 294
582 3300049571 Ga0501034_0139543 Ga0501034_0139543_983_1933 294
583 3300049574 Ga0501038_0146812 Ga0501038_0146812_883_1833 294
584 3300049579 Ga0501043_0244376 Ga0501043_0244376_108_1058 294
585 3300049580 Ga0501046_0053544 Ga0501046_0053544_1967_2917 294
586 3300049581 Ga0501047_0187925 Ga0501047_0187925_362_1312 294
587 3300049583 Ga0501067_0010466 Ga0501067_0010466_3416_4366 294
588 3300049584 Ga0501068_0217868 Ga0501068_0217868_230_1180 294
589 3300049586 Ga0501070_0015091 Ga0501070_0015091_270_1220 294
590 3300049586 Ga0501070_0017988 Ga0501070_0017988_148_1098 294
591 3300049586 Ga0501070_0029667 Ga0501070_0029667_2089_3039 294
592 3300049589 Ga0501073_0002155 Ga0501073_0002155_5668_6618 294
593 3300049589 Ga0501073_0062199 Ga0501073_0062199_27_992 294
594 3300049589 Ga0501073_0118087 Ga0501073_0118087_572_1522 294
595 3300049590 Ga0501074_0142947 Ga0501074_0142947_362_1312 294
596 3300049592 Ga0501076_0146160 Ga0501076_0146160_142_1098 294
597 3300049593 Ga0501077_0082730 Ga0501077_0082730_152_1102 294
598 3300049742 Ga0501080_0105910 Ga0501080_0105910_976_1926 294
599 3300049742 Ga0501080_0281358 Ga0501080_0281358_111_1061 294
600 3300049822 Ga0501035_0045011 Ga0501035_0045011_2160_3110 294
601 3300049823 Ga0501044_0027422 Ga0501044_0027422_1649_2599 294
602 3300049823 Ga0501044_0039379 Ga0501044_0039379_1310_2260 294
603 3300050507 nmdc:mga05p37_225037_c1 nmdc:mga05p37_225037_c1_831_1781 294
604 3300050507 nmdc:mga05p37_63026_c1 nmdc:mga05p37_63026_c1_3576_4526 294
605 3300050512 nmdc:mga0n895_123350_c1 nmdc:mga0n895_123350_c1_1395_2345 294
606 3300061719 Ga0466962_0033595 Ga0466962_0033595_1168_2118 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

69

327

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6za9-assembly1.cif.gz_N fo domain of ovine atp synthase 0.3282 90 199
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.3055 36 244
2wbi-assembly1.cif.gz_B-2 crystal structure of human acyl-coa dehydrogenase 11 0.2828 88 244
4o93-assembly1.cif.gz_B crystal structure of thermus thermophilis transhydrogeanse domain ii dimer 0.2489 1 222
6sor-assembly1.cif.gz_A 20 minute fe2+ soaked structure of synftn variant e62a 0.233 90 221
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.4188 29 274 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.3961 29 262 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.3858 29 261 1.10.3470.10
af_O62140_286_459_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.3707 90 246 1.20.140.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.363 29 257 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3N5GBV6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.6685 2 197 GO:0005886
GO:0015658
AF-A0A7H9ULR0-F1-model_v4 deleted 0.65 4 192
AF-A0A6F8Q2Y9-F1-model_v4 deleted 0.6443 5 225
AF-A0A3D2D9L0-F1-model_v4 deleted 0.6425 5 197
AF-A0A519G9L9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.6415 2 197 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
57.22 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map