F468388

General Info

Members Datasets Scaffolds Average Seq Length
604 283 603 471

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10056817|Ga0207700_100568172
Length 468
Sequence MVARAASERAADVLVVFGITGDLARVMTFRSLYRLELHGLLDCPVVGVAVDDWTVEQLRAHARESIDASGETIDEETFARFSARLEYVSGDFADAATFERVAQTVGGARQPVFYLEVPPGLFATVVKGLAQAGLTEKARVVVEKPFGHDLASARALAAELHRYVGEPRLYRIDHFLGKMGLQEFLYLRFANKMLAPIWNRDHIQSVQITLAESFGVEDRGHFYDAVGALRDVVVNHLLQLLAVAAMEPPAAADAHALNAAKEAALRAIPTADAADYTRGQYEGYLAIAGVQPGSTTETYAALRLEIKNERWSGVPFLIRTGKLLPVTQTEVRLVFRHVPRLGFARHSGREPVANQLVVRLDPSTGIRLVVDALRADAAGPEPITLDMEFAEEGGEGATPYELLLHAAMVGDRSLFTDQGLVEESWRIVQPLITSPPPVESYAPGSWGPTGADRLAAAHGGWHDPWLGS

Samples

Sample ID Description Type Environment
1 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.66
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 14.4
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10027834 3300001990 Bacteria 1780
2 JGI24744J21845_10001909 3300002077 Bacteria 4203
3 JGI25407J50210_10001726 3300003373 Bacteria 5012
4 Ga0058859_11806834 3300004798 Bacteria 2723
5 Ga0058861_12062177 3300004800 Bacteria 2119
6 Ga0058860_10013857 3300004801 Bacteria 3578
7 Ga0058862_12330200 3300004803 Bacteria 1593
8 Ga0070683_100002616 3300005329 Bacteria 14404
9 Ga0070683_100008404 3300005329 Bacteria 8764
10 Ga0070683_100038966 3300005329 Bacteria 4359
11 Ga0070683_100102853 3300005329 Bacteria 2691
12 Ga0070680_100034742 3300005336 Bacteria 4066
13 Ga0070682_100000922 3300005337 Bacteria 17137
14 Ga0070682_100003904 3300005337 Bacteria 8276
15 Ga0068868_100019168 3300005338 Bacteria 5125
16 Ga0068868_100024499 3300005338 Bacteria 4580
17 Ga0068868_100030301 3300005338 Bacteria 4148
18 Ga0070687_100014361 3300005343 Bacteria 3557
19 Ga0070692_10004815 3300005345 Bacteria 5674
20 Ga0070674_100040772 3300005356 Bacteria 3143
21 Ga0070688_100000700 3300005365 Bacteria 16543
22 Ga0070659_100010230 3300005366 Bacteria 6897
23 Ga0070659_100236295 3300005366 Bacteria 1511
24 Ga0070667_100168084 3300005367 Bacteria 1935
25 Ga0070703_10000259 3300005406 Bacteria 25582
26 Ga0070714_100075236 3300005435 Bacteria 2930
27 Ga0070713_100029881 3300005436 Bacteria 4321
28 Ga0070713_100077838 3300005436 Bacteria 2821
29 Ga0070713_100158618 3300005436 Bacteria 2018
30 Ga0070710_10008309 3300005437 Bacteria 5052
31 Ga0070710_10021121 3300005437 Bacteria 3388
32 Ga0070701_10000968 3300005438 Bacteria 10385
33 Ga0070701_10065219 3300005438 Bacteria 1932
34 Ga0070711_100006754 3300005439 Bacteria 6944
35 Ga0070711_100042685 3300005439 Bacteria 3067
36 Ga0070711_100098629 3300005439 Bacteria 2121
37 Ga0070711_100149002 3300005439 Bacteria 1762
38 Ga0070705_100003497 3300005440 Bacteria 7688
39 Ga0070705_100006314 3300005440 Bacteria 5806
40 Ga0070705_100067331 3300005440 Bacteria 2151
41 Ga0070700_100001110 3300005441 Bacteria 13330
42 Ga0070700_100001301 3300005441 Bacteria 12417
43 Ga0070700_100016865 3300005441 Bacteria 4166
44 Ga0070700_100020813 3300005441 Bacteria 3807
45 Ga0070694_100013740 3300005444 Bacteria 5061
46 Ga0070694_100034679 3300005444 Bacteria 3329
47 Ga0070708_100000272 3300005445 Bacteria 38532
48 Ga0070708_100079894 3300005445 Bacteria 2959
49 Ga0070708_100166452 3300005445 Bacteria 2056
50 Ga0070663_100069555 3300005455 Bacteria 2558
51 Ga0070678_100018179 3300005456 Bacteria 4552
52 Ga0070678_100023705 3300005456 Bacteria 4095
53 Ga0070662_100030526 3300005457 Bacteria 3773
54 Ga0070662_100124053 3300005457 Bacteria 1983
55 Ga0068867_100036542 3300005459 Bacteria 3566
56 Ga0068867_100058556 3300005459 Bacteria 2855
57 Ga0070706_100000748 3300005467 Bacteria 36445
58 Ga0070706_100064581 3300005467 Bacteria 3383
59 Ga0070706_100075424 3300005467 Bacteria 3121
60 Ga0070707_100062761 3300005468 Bacteria 3565
61 Ga0070707_100225827 3300005468 Bacteria 1823
62 Ga0070698_100003904 3300005471 Bacteria 16391
63 Ga0070698_100005947 3300005471 Bacteria 13308
64 Ga0070698_100224338 3300005471 Bacteria 1812
65 Ga0070684_100000934 3300005535 Bacteria 20769
66 Ga0070684_100008843 3300005535 Bacteria 7897
67 Ga0070684_100058880 3300005535 Bacteria 3358
68 Ga0070684_100270414 3300005535 Bacteria 1556
69 Ga0070697_100024427 3300005536 Bacteria 4810
70 Ga0070686_100016752 3300005544 Bacteria 4268
71 Ga0070686_100018071 3300005544 Bacteria 4132
72 Ga0070695_100007621 3300005545 Bacteria 6413
73 Ga0070695_100049578 3300005545 Bacteria 2688
74 Ga0070696_100003346 3300005546 Bacteria 10698
75 Ga0070696_100022246 3300005546 Bacteria 4306
76 Ga0070696_100113211 3300005546 Bacteria 1956
77 Ga0070693_100031479 3300005547 Bacteria 2907
78 Ga0070665_100048464 3300005548 Bacteria 4266
79 Ga0070704_100031249 3300005549 Bacteria 3580
80 Ga0070704_100104785 3300005549 Bacteria 2140
81 Ga0068855_100369070 3300005563 Bacteria 1578
82 Ga0070664_100007619 3300005564 Bacteria 8742
83 Ga0068854_100065873 3300005578 Bacteria 2635
84 Ga0068856_100046759 3300005614 Bacteria 4262
85 Ga0068856_100096974 3300005614 Bacteria 2937
86 Ga0070702_100005021 3300005615 Bacteria 6111
87 Ga0070702_100013413 3300005615 Bacteria 4137
88 Ga0068852_100001464 3300005616 Bacteria 15962
89 Ga0068852_100195178 3300005616 Bacteria 1913
90 Ga0068859_100202381 3300005617 Bacteria 2070
91 Ga0068864_100076047 3300005618 Bacteria 2932
92 Ga0068866_10006694 3300005718 Bacteria 4805
93 Ga0068861_100044390 3300005719 Bacteria 3342
94 Ga0068870_10006802 3300005840 Bacteria 5068
95 Ga0068863_100014867 3300005841 Bacteria 7478
96 Ga0068858_100097274 3300005842 Bacteria 2744
97 Ga0068858_100246738 3300005842 Bacteria 1695
98 Ga0068860_100059877 3300005843 Bacteria 3619
99 Ga0068862_100156509 3300005844 Bacteria 2032
100 Ga0081455_10000980 3300005937 Bacteria 36344
101 Ga0081455_10003455 3300005937 Bacteria 18167
102 Ga0081455_10005954 3300005937 Bacteria 13226
103 Ga0081538_10000062 3300005981 Bacteria 100500
104 Ga0081538_10000847 3300005981 Bacteria 33018
105 Ga0081540_1000540 3300005983 Bacteria 36618
106 Ga0081540_1030296 3300005983 Bacteria 2999
107 Ga0070717_10190518 3300006028 Bacteria 1792
108 Ga0075365_10096834 3300006038 Bacteria 2017
109 Ga0075364_10093860 3300006051 Bacteria 1993
110 Ga0070716_100013307 3300006173 Bacteria 4191
111 Ga0070712_100002845 3300006175 Bacteria 10710
112 Ga0070712_100015031 3300006175 Bacteria 4977
113 Ga0070712_100054420 3300006175 Bacteria 2798
114 Ga0070712_100117613 3300006175 Bacteria 1995
115 Ga0068871_100135396 3300006358 Bacteria 2092
116 Ga0075428_100007225 3300006844 Bacteria 12300
117 Ga0075428_100049929 3300006844 Bacteria 4589
118 Ga0075428_100085615 3300006844 Bacteria 3437
119 Ga0075428_100097314 3300006844 Bacteria 3209
120 Ga0075428_100180126 3300006844 Bacteria 2288
121 Ga0075428_100349758 3300006844 Bacteria 1586
122 Ga0075431_100006337 3300006847 Bacteria 11754
123 Ga0075431_100020673 3300006847 Bacteria 6727
124 Ga0075431_100036816 3300006847 Bacteria 5040
125 Ga0075433_10049425 3300006852 Bacteria 3659
126 Ga0075433_10087300 3300006852 Bacteria 2755
127 Ga0075433_10103918 3300006852 Bacteria 2517
128 Ga0075434_100002264 3300006871 Bacteria 16846
129 Ga0075434_100039046 3300006871 Bacteria 4704
130 Ga0075429_100050633 3300006880 Bacteria 3614
131 Ga0075429_100102200 3300006880 Bacteria 2502
132 Ga0068865_100014889 3300006881 Bacteria 4950
133 Ga0075436_100005258 3300006914 Bacteria 8909
134 Ga0075436_100034563 3300006914 Bacteria 3486
135 Ga0075436_100045497 3300006914 Bacteria 3027
136 Ga0097620_100202389 3300006931 Bacteria 2070
137 Ga0075435_100003744 3300007076 Bacteria 10363
138 Ga0075435_100020408 3300007076 Bacteria 5077
139 Ga0111539_10003555 3300009094 Bacteria 20558
140 Ga0111539_10111706 3300009094 Bacteria 3206
141 Ga0105245_10005198 3300009098 Bacteria 11427
142 Ga0105245_10006274 3300009098 Bacteria 10460
143 Ga0105245_10009183 3300009098 Bacteria 8619
144 Ga0105245_10010142 3300009098 Bacteria 8203
145 Ga0105245_10013270 3300009098 Bacteria 7179
146 Ga0105245_10021666 3300009098 Bacteria 5641
147 Ga0114129_10010204 3300009147 Bacteria 13392
148 Ga0114129_10012002 3300009147 Bacteria 12321
149 Ga0114129_10016756 3300009147 Bacteria 10434
150 Ga0114129_10018480 3300009147 Bacteria 9927
151 Ga0114129_10042748 3300009147 Bacteria 6378
152 Ga0114129_10107725 3300009147 Bacteria 3848
153 Ga0114129_10153814 3300009147 Bacteria 3147
154 Ga0114129_10272063 3300009147 Bacteria 2266
155 Ga0114129_10354723 3300009147 Bacteria 1942
156 Ga0105243_10001866 3300009148 Bacteria 17995
157 Ga0105243_10015249 3300009148 Bacteria 5814
158 Ga0105243_10016670 3300009148 Bacteria 5554
159 Ga0105243_10046606 3300009148 Bacteria 3411
160 Ga0105241_10041134 3300009174 Bacteria 3491
161 Ga0105242_10006965 3300009176 Bacteria 8727
162 Ga0105242_10023934 3300009176 Bacteria 4819
163 Ga0105242_10049642 3300009176 Bacteria 3415
164 Ga0105242_10226523 3300009176 Bacteria 1673
165 Ga0105248_10068764 3300009177 Bacteria 3976
166 Ga0105248_10099181 3300009177 Bacteria 3282
167 Ga0105249_10018944 3300009553 Bacteria 6135
168 Ga0105249_10042558 3300009553 Bacteria 4132
169 Ga0105249_10068062 3300009553 Bacteria 3283
170 Ga0105249_10084325 3300009553 Bacteria 2959
171 Ga0105249_10189468 3300009553 Bacteria 2007
172 Ga0105239_10019008 3300010375 Bacteria 7592
173 Ga0105239_10044923 3300010375 Bacteria 4842
174 Ga0105239_10056306 3300010375 Bacteria 4314
175 Ga0105239_10198543 3300010375 Bacteria 2247
176 Ga0105246_10001142 3300011119 Bacteria 15397
177 Ga0105246_10052289 3300011119 Bacteria 2808
178 Ga0157371_10054053 3300013102 Bacteria 2852
179 Ga0157369_10015138 3300013105 Bacteria 8705
180 Ga0157374_10105932 3300013296 Bacteria 2701
181 Ga0157378_10043906 3300013297 Bacteria 3968
182 Ga0157378_10075488 3300013297 Bacteria 3035
183 Ga0163162_10064702 3300013306 Bacteria 3702
184 Ga0163162_10067125 3300013306 Bacteria 3637
185 Ga0163162_10175168 3300013306 Bacteria 2270
186 Ga0157372_10006104 3300013307 Bacteria 12802
187 Ga0157372_10018570 3300013307 Bacteria 7480
188 Ga0157372_10051403 3300013307 Bacteria 4586
189 Ga0157372_10119454 3300013307 Bacteria 3026
190 Ga0163163_10070955 3300014325 Bacteria 3470
191 Ga0163163_10241164 3300014325 Bacteria 1857
192 Ga0157380_10005445 3300014326 Bacteria 8897
193 Ga0157380_10024436 3300014326 Bacteria 4574
194 Ga0157377_10004218 3300014745 Bacteria 6581
195 Ga0157377_10080487 3300014745 Bacteria 1903
196 Ga0157379_10009161 3300014968 Bacteria 8623
197 Ga0207653_10000003 3300025885 Bacteria 268014
198 Ga0207653_10007668 3300025885 Bacteria 3367
199 Ga0207682_10051995 3300025893 Bacteria 1697
200 Ga0207692_10010534 3300025898 Bacteria 3901
201 Ga0207642_10001835 3300025899 Bacteria 6565
202 Ga0207688_10007719 3300025901 Bacteria 5860
203 Ga0207647_10036296 3300025904 Bacteria 3133
204 Ga0207699_10095749 3300025906 Bacteria 1873
205 Ga0207643_10001011 3300025908 Bacteria 16746
206 Ga0207643_10013515 3300025908 Bacteria 4423
207 Ga0207643_10015154 3300025908 Bacteria 4194
208 Ga0207684_10000532 3300025910 Bacteria 47160
209 Ga0207684_10043464 3300025910 Bacteria 3810
210 Ga0207693_10003883 3300025915 Bacteria 12729
211 Ga0207693_10005452 3300025915 Bacteria 10609
212 Ga0207693_10021227 3300025915 Bacteria 5161
213 Ga0207693_10044071 3300025915 Bacteria 3506
214 Ga0207693_10142012 3300025915 Bacteria 1888
215 Ga0207662_10010190 3300025918 Bacteria 5182
216 Ga0207652_10181876 3300025921 Bacteria 1889
217 Ga0207646_10021867 3300025922 Bacteria 5902
218 Ga0207681_10013066 3300025923 Bacteria 5134
219 Ga0207687_10002598 3300025927 Bacteria 12258
220 Ga0207687_10006277 3300025927 Bacteria 7865
221 Ga0207687_10036213 3300025927 Bacteria 3361
222 Ga0207687_10065891 3300025927 Bacteria 2573
223 Ga0207700_10056817 3300025928 Bacteria 2948
224 Ga0207664_10015828 3300025929 Bacteria 5489
225 Ga0207664_10081558 3300025929 Bacteria 2632
226 Ga0207690_10021396 3300025932 Bacteria 4010
227 Ga0207706_10021778 3300025933 Bacteria 5753
228 Ga0207706_10063494 3300025933 Bacteria 3251
229 Ga0207686_10080045 3300025934 Bacteria 2129
230 Ga0207709_10034955 3300025935 Bacteria 2967
231 Ga0207709_10104129 3300025935 Bacteria 1883
232 Ga0207665_10000419 3300025939 Bacteria 29265
233 Ga0207665_10013259 3300025939 Bacteria 5419
234 Ga0207665_10084376 3300025939 Bacteria 2192
235 Ga0207665_10092677 3300025939 Bacteria 2096
236 Ga0207691_10004435 3300025940 Bacteria 13605
237 Ga0207691_10183172 3300025940 Bacteria 1829
238 Ga0207711_10111273 3300025941 Bacteria 2436
239 Ga0207711_10204119 3300025941 Bacteria 1804
240 Ga0207661_10002247 3300025944 Bacteria 13322
241 Ga0207661_10086028 3300025944 Bacteria 2608
242 Ga0207679_10050912 3300025945 Bacteria 3029
243 Ga0207679_10083259 3300025945 Bacteria 2452
244 Ga0207651_10058821 3300025960 Bacteria 2658
245 Ga0207712_10089745 3300025961 Bacteria 2260
246 Ga0207668_10113477 3300025972 Bacteria 2038
247 Ga0207640_10045925 3300025981 Bacteria 2808
248 Ga0207640_10115995 3300025981 Bacteria 1908
249 Ga0207677_10012441 3300026023 Bacteria 4892
250 Ga0207677_10033195 3300026023 Bacteria 3327
251 Ga0207677_10066813 3300026023 Bacteria 2516
252 Ga0207677_10069161 3300026023 Bacteria 2482
253 Ga0207703_10125930 3300026035 Bacteria 2206
254 Ga0207703_10188417 3300026035 Bacteria 1825
255 Ga0207678_10160177 3300026067 Bacteria 1922
256 Ga0207708_10000064 3300026075 Bacteria 85366
257 Ga0207708_10000259 3300026075 Bacteria 41740
258 Ga0207708_10012633 3300026075 Bacteria 6298
259 Ga0207708_10020262 3300026075 Bacteria 5016
260 Ga0207702_10048456 3300026078 Bacteria 3583
261 Ga0207641_10240858 3300026088 Bacteria 1685
262 Ga0207648_10008677 3300026089 Bacteria 9807
263 Ga0207648_10010820 3300026089 Bacteria 8622
264 Ga0207648_10101824 3300026089 Bacteria 2517
265 Ga0207674_10048408 3300026116 Bacteria 4351
266 Ga0207674_10124922 3300026116 Bacteria 2539
267 Ga0207675_100013425 3300026118 Bacteria 7643
268 Ga0207675_100018419 3300026118 Bacteria 6510
269 Ga0207675_100021458 3300026118 Bacteria 6015
270 Ga0207675_100035597 3300026118 Bacteria 4644
271 Ga0207675_100038375 3300026118 Bacteria 4470
272 Ga0207675_100067930 3300026118 Bacteria 3332
273 Ga0207675_100091500 3300026118 Bacteria 2860
274 Ga0207675_100151845 3300026118 Bacteria 2205
275 Ga0207683_10008620 3300026121 Bacteria 8720
276 Ga0207683_10010485 3300026121 Bacteria 7907
277 Ga0207683_10021098 3300026121 Bacteria 5575
278 Ga0207683_10030331 3300026121 Bacteria 4685
279 Ga0207683_10102920 3300026121 Bacteria 2550
280 Ga0207428_10004538 3300027907 Bacteria 13165
281 Ga0207428_10006489 3300027907 Bacteria 10798
282 Ga0207428_10012111 3300027907 Bacteria 7589
283 Ga0207428_10032418 3300027907 Bacteria 4298
284 Ga0207428_10039599 3300027907 Bacteria 3828
285 Ga0268265_10174404 3300028380 Bacteria 1841
286 Ga0268264_10187770 3300028381 Bacteria 1882
287 Ga0265327_10023218 3300031251 Bacteria 3678
288 Ga0307408_100051109 3300031548 Bacteria 2976
289 Ga0307413_10161631 3300031824 Bacteria 1574
290 Ga0307410_10002617 3300031852 Bacteria 8759
291 Ga0307412_10051655 3300031911 Bacteria 2718
292 Ga0307409_100001632 3300031995 Bacteria 11223
293 Ga0307409_100043090 3300031995 Bacteria 3385
294 Ga0307416_100088031 3300032002 Bacteria 2654
295 Ga0307411_10003083 3300032005 Bacteria 7622
296 Ga0307415_100007945 3300032126 Bacteria 5842
297 Ga0307415_100023353 3300032126 Bacteria 3837
298 Ga0373952_0001878 3300035092 Bacteria 3817
299 Ga0373956_0089201 3300035119 Bacteria 1421
300 Ga0373960_0007553 3300035121 Bacteria 2581
301 Ga0373943_0005394 3300035170 Bacteria 5753
302 Ga0373946_0008525 3300035171 Bacteria 3763
303 Ga0373942_0011702 3300035207 Bacteria 2084
304 Ga0373931_0027344 3300035691 Bacteria 2911
305 Ga0373933_0043663 3300035724 Bacteria 2653
306 Ga0373947_0001059 3300035725 Bacteria 16809
307 Ga0373947_0002802 3300035725 Bacteria 10419
308 Ga0373937_0078631 3300036401 Bacteria 3048
309 Ga0373925_0005324 3300037068 Bacteria 9604
310 Ga0395899_0001680 3300037312 Bacteria 18454
311 Ga0395899_0005777 3300037312 Bacteria 9604
312 Ga0395900_0005212 3300037418 Bacteria 13633
313 Ga0395900_0011716 3300037418 Bacteria 8965
314 Ga0395900_0012939 3300037418 Bacteria 8524
315 Ga0395900_0020195 3300037418 Bacteria 6797
316 Ga0395900_0041261 3300037418 Bacteria 4757
317 Ga0395900_0072400 3300037418 Bacteria 3543
318 Ga0395900_0105559 3300037418 Bacteria 2894
319 Ga0395898_0001644 3300037466 Bacteria 30233
320 Ga0395898_0004563 3300037466 Bacteria 15114
321 Ga0395898_0006011 3300037466 Bacteria 13034
322 Ga0395898_0023058 3300037466 Bacteria 6294
323 Ga0395898_0033832 3300037466 Bacteria 5097
324 Ga0395898_0070903 3300037466 Bacteria 3368
325 Ga0395898_0081982 3300037466 Bacteria 3110
326 Ga0395898_0098701 3300037466 Bacteria 2804
327 Ga0395905_0002213 3300037471 Bacteria 21946
328 Ga0395905_0005590 3300037471 Bacteria 12806
329 Ga0395905_0010756 3300037471 Bacteria 8871
330 Ga0395905_0015079 3300037471 Bacteria 7359
331 Ga0395905_0089127 3300037471 Bacteria 2891
332 Ga0395905_0183932 3300037471 Bacteria 1962
333 Ga0395905_0264441 3300037471 Bacteria 1605
334 Ga0395901_0001203 3300038443 Bacteria 27494
335 Ga0395901_0025938 3300038443 Bacteria 6018
336 Ga0395901_0136926 3300038443 Bacteria 2573
337 Ga0395901_0272771 3300038443 Bacteria 1759
338 Ga0451787_260720 3300041441 Bacteria 1417
339 Ga0451800_0526498 3300041459 Bacteria 4689
340 Ga0451802_1676736 3300041460 Bacteria 7404
341 Ga0451804_0502473 3300041463 Bacteria 5101
342 Ga0451839_0806449 3300041496 Bacteria 4657
343 Ga0451849_0147738 3300041505 Bacteria 2888
344 Ga0439448_0004060 3300042005 Bacteria 4113
345 Ga0439450_002177 3300042008 Bacteria 3034
346 Ga0439450_012201 3300042008 Bacteria 1701
347 Ga0451576_0035206 3300045051 Bacteria 5313
348 Ga0451576_0057717 3300045051 Bacteria 4058
349 Ga0466967_0129069 3300045976 Bacteria 2345
350 Ga0495592_0030033 3300046454 Bacteria 4111
351 Ga0495603_0007045 3300046455 Bacteria 6745
352 Ga0495629_0011412 3300046459 Bacteria 6454
353 Ga0495641_0003896 3300046461 Bacteria 10855
354 Ga0495641_0023573 3300046461 Bacteria 3054
355 Ga0495651_0057667 3300046462 Bacteria 2981
356 Ga0495651_0092432 3300046462 Bacteria 2266
357 Ga0495653_0044155 3300046463 Bacteria 3460
358 Ga0495653_0053280 3300046463 Bacteria 3096
359 Ga0495653_0084856 3300046463 Bacteria 2331
360 Ga0495662_0035839 3300046476 Bacteria 2395
361 Ga0495664_0080907 3300046477 Bacteria 1947
362 Ga0495584_0006077 3300046491 Bacteria 6356
363 Ga0495584_0006163 3300046491 Bacteria 6305
364 Ga0495584_0040481 3300046491 Bacteria 2353
365 Ga0495585_0047599 3300046492 Bacteria 2388
366 Ga0495594_0001378 3300046499 Bacteria 12614
367 Ga0495608_0008685 3300046511 Bacteria 7108
368 Ga0495608_0035213 3300046511 Bacteria 3378
369 Ga0495608_0038690 3300046511 Bacteria 3201
370 Ga0495608_0047780 3300046511 Bacteria 2844
371 Ga0495618_0048850 3300046514 Bacteria 2672
372 Ga0495628_0015666 3300046516 Bacteria 6330
373 Ga0495628_0018415 3300046516 Bacteria 5785
374 Ga0495628_0056164 3300046516 Bacteria 3100
375 Ga0495630_0003282 3300046517 Bacteria 11286
376 Ga0495630_0057738 3300046517 Bacteria 2909
377 Ga0495630_0191922 3300046517 Bacteria 1558
378 Ga0495644_0001704 3300046523 Bacteria 8906
379 Ga0495644_0014566 3300046523 Bacteria 3011
380 Ga0495652_0049663 3300046529 Bacteria 3590
381 Ga0495640_0002482 3300046533 Bacteria 14838
382 Ga0495640_0080016 3300046533 Bacteria 2174
383 Ga0495587_0038368 3300046536 Bacteria 2873
384 Ga0495587_0065952 3300046536 Bacteria 2113
385 Ga0495598_0002093 3300046537 Bacteria 4069
386 Ga0495609_0055001 3300046538 Bacteria 1766
387 Ga0495621_0024833 3300046539 Bacteria 2006
388 Ga0495667_0006175 3300046559 Bacteria 8119
389 Ga0495667_0027049 3300046559 Bacteria 3866
390 Ga0495656_0000888 3300046615 Bacteria 9672
391 Ga0495656_0021283 3300046615 Bacteria 2523
392 Ga0495656_0031347 3300046615 Bacteria 2156
393 Ga0495634_0038581 3300046642 Bacteria 3256
394 Ga0495634_0039578 3300046642 Bacteria 3210
395 Ga0495635_0010227 3300046663 Bacteria 6560
396 Ga0495659_0003655 3300046664 Bacteria 4891
397 Ga0495588_0007629 3300046674 Bacteria 4938
398 Ga0495657_0008126 3300046675 Bacteria 8045
399 Ga0495657_0018225 3300046675 Bacteria 5086
400 Ga0495657_0020351 3300046675 Bacteria 4771
401 Ga0495657_0039184 3300046675 Bacteria 3258
402 Ga0495599_0039657 3300046678 Bacteria 2959
403 Ga0495599_0108550 3300046678 Bacteria 1729
404 Ga0495623_0061675 3300046679 Bacteria 2351
405 Ga0495646_0021681 3300046680 Bacteria 4058
406 Ga0495646_0054169 3300046680 Bacteria 2414
407 Ga0495647_0023507 3300046681 Bacteria 2235
408 Ga0495658_0016944 3300046683 Bacteria 3756
409 Ga0495613_0012413 3300046689 Bacteria 6329
410 Ga0495613_0048964 3300046689 Bacteria 3120
411 Ga0495670_0002377 3300046691 Bacteria 9262
412 Ga0495600_0012431 3300046809 Bacteria 5323
413 Ga0495581_0007725 3300047315 Bacteria 6222
414 Ga0495604_0005834 3300047317 Bacteria 9761
415 Ga0495604_0016344 3300047317 Bacteria 5931
416 Ga0495604_0136498 3300047317 Bacteria 1757
417 Ga0495636_0018748 3300047318 Bacteria 2776
418 Ga0495674_0000584 3300047319 Bacteria 34100
419 Ga0495674_0068147 3300047319 Bacteria 3080
420 Ga0495674_0081148 3300047319 Bacteria 2782
421 Ga0495674_0098119 3300047319 Bacteria 2495
422 Ga0495676_0013494 3300047321 Bacteria 7342
423 Ga0495676_0124482 3300047321 Bacteria 1870
424 Ga0495680_0000204 3300047322 Bacteria 64223
425 Ga0495680_0001834 3300047322 Bacteria 22404
426 Ga0495680_0009074 3300047322 Bacteria 8979
427 Ga0495680_0016323 3300047322 Bacteria 6385
428 Ga0495680_0017050 3300047322 Bacteria 6216
429 Ga0495675_0025314 3300047444 Bacteria 3784
430 Ga0495684_0000755 3300047471 Bacteria 26085
431 Ga0495684_0018185 3300047471 Bacteria 5416
432 Ga0495684_0069136 3300047471 Bacteria 2685
433 Ga0495684_0090020 3300047471 Bacteria 2325
434 Ga0495602_0012596 3300048088 Bacteria 8678
435 Ga0495602_0106999 3300048088 Bacteria 2281
436 Ga0496100_0114016 3300048903 Bacteria 1882
437 Ga0496100_0130376 3300048903 Bacteria 1770
438 Ga0496100_0194355 3300048903 Bacteria 1475
439 Ga0496101_0006168 3300048904 Bacteria 7702
440 Ga0496101_0032909 3300048904 Bacteria 3653
441 Ga0496101_0051053 3300048904 Bacteria 2979
442 Ga0496101_0094304 3300048904 Bacteria 2230
443 Ga0496102_0005830 3300048905 Bacteria 10478
444 Ga0496102_0006206 3300048905 Bacteria 10183
445 Ga0496102_0024331 3300048905 Bacteria 5383
446 Ga0496102_0035034 3300048905 Bacteria 4517
447 Ga0496102_0037892 3300048905 Bacteria 4349
448 Ga0496102_0151376 3300048905 Bacteria 2180
449 Ga0496102_0280382 3300048905 Bacteria 1571
450 Ga0496103_0007006 3300048906 Bacteria 6726
451 Ga0496103_0016633 3300048906 Bacteria 4391
452 Ga0496103_0022573 3300048906 Bacteria 3790
453 Ga0496103_0023544 3300048906 Bacteria 3715
454 Ga0496104_0000471 3300048907 Bacteria 34675
455 Ga0496104_0031233 3300048907 Bacteria 4952
456 Ga0496104_0060599 3300048907 Bacteria 3585
457 Ga0496104_0076539 3300048907 Bacteria 3187
458 Ga0496104_0088361 3300048907 Bacteria 2960
459 Ga0496104_0167687 3300048907 Bacteria 2105
460 Ga0496105_0000792 3300048908 Bacteria 21415
461 Ga0496105_0000996 3300048908 Bacteria 19557
462 Ga0496105_0002314 3300048908 Bacteria 13812
463 Ga0496105_0005624 3300048908 Bacteria 9534
464 Ga0496105_0196588 3300048908 Bacteria 1647
465 Ga0496106_0000729 3300048909 Bacteria 23698
466 Ga0496106_0015306 3300048909 Bacteria 5674
467 Ga0496106_0024196 3300048909 Bacteria 4513
468 Ga0496106_0028618 3300048909 Bacteria 4151
469 Ga0496106_0029137 3300048909 Bacteria 4113
470 Ga0496107_0008594 3300048910 Bacteria 7069
471 Ga0496107_0070601 3300048910 Bacteria 2536
472 Ga0496107_0110966 3300048910 Bacteria 2016
473 Ga0496108_0001390 3300048911 Bacteria 19045
474 Ga0496108_0002323 3300048911 Bacteria 15222
475 Ga0496108_0002863 3300048911 Bacteria 13852
476 Ga0496108_0019663 3300048911 Bacteria 5547
477 Ga0496108_0026152 3300048911 Bacteria 4813
478 Ga0496108_0104566 3300048911 Bacteria 2416
479 Ga0496109_0004914 3300048912 Bacteria 11156
480 Ga0496109_0008075 3300048912 Bacteria 8922
481 Ga0496109_0008388 3300048912 Bacteria 8782
482 Ga0496109_0011153 3300048912 Bacteria 7709
483 Ga0496109_0022223 3300048912 Bacteria 5616
484 Ga0496109_0024760 3300048912 Bacteria 5339
485 Ga0496109_0030328 3300048912 Bacteria 4848
486 Ga0496109_0050593 3300048912 Bacteria 3783
487 Ga0496109_0078594 3300048912 Bacteria 3038
488 Ga0496109_0088968 3300048912 Bacteria 2854
489 Ga0496110_0002619 3300048913 Bacteria 13540
490 Ga0496110_0004397 3300048913 Bacteria 10913
491 Ga0496110_0005696 3300048913 Bacteria 9784
492 Ga0496110_0030512 3300048913 Bacteria 4648
493 Ga0496111_0002096 3300048914 Bacteria 11900
494 Ga0496111_0002846 3300048914 Bacteria 10558
495 Ga0496111_0006246 3300048914 Bacteria 7723
496 Ga0496111_0014642 3300048914 Bacteria 5363
497 Ga0496111_0014711 3300048914 Bacteria 5352
498 Ga0496112_0000082 3300048915 Bacteria 62404
499 Ga0496112_0000998 3300048915 Bacteria 20731
500 Ga0496112_0016933 3300048915 Bacteria 6840
501 Ga0496112_0045604 3300048915 Bacteria 4297
502 Ga0496112_0059486 3300048915 Bacteria 3765
503 Ga0496112_0064683 3300048915 Bacteria 3609
504 Ga0496112_0087457 3300048915 Bacteria 3083
505 Ga0496113_0000069 3300048916 Bacteria 45043
506 Ga0496113_0002742 3300048916 Bacteria 10355
507 Ga0496113_0013024 3300048916 Bacteria 5613
508 Ga0496113_0022407 3300048916 Bacteria 4467
509 Ga0496113_0043752 3300048916 Bacteria 3315
510 Ga0496113_0083225 3300048916 Bacteria 2455
511 Ga0496113_0094731 3300048916 Bacteria 2307
512 Ga0496114_0001305 3300048917 Bacteria 18876
513 Ga0496114_0004201 3300048917 Bacteria 11159
514 Ga0496114_0005625 3300048917 Bacteria 9833
515 Ga0496114_0061597 3300048917 Bacteria 3139
516 Ga0496115_0011197 3300048918 Bacteria 6717
517 Ga0496115_0012161 3300048918 Bacteria 6472
518 Ga0496115_0089416 3300048918 Bacteria 2515
519 Ga0501031_0001154 3300049568 Bacteria 16098
520 Ga0501032_0000274 3300049569 Bacteria 43406
521 Ga0501033_0000629 3300049570 Bacteria 32631
522 Ga0501036_0000296 3300049572 Bacteria 34579
523 Ga0501037_0000379 3300049573 Bacteria 36982
524 Ga0501038_0000186 3300049574 Bacteria 53569
525 Ga0501039_0000141 3300049575 Bacteria 49210
526 Ga0501039_0077885 3300049575 Bacteria 2578
527 Ga0501040_0000360 3300049576 Bacteria 26851
528 Ga0501041_0000039 3300049577 Bacteria 44027
529 Ga0501042_0000670 3300049578 Bacteria 18434
530 Ga0501043_0000171 3300049579 Bacteria 58361
531 Ga0501046_0000177 3300049580 Bacteria 65024
532 Ga0501047_0000481 3300049581 Bacteria 43439
533 Ga0501048_0001307 3300049582 Bacteria 18874
534 Ga0501069_0004399 3300049585 Bacteria 7277
535 Ga0501070_0001532 3300049586 Bacteria 20564
536 Ga0501071_0000494 3300049587 Bacteria 19967
537 Ga0501071_0002667 3300049587 Bacteria 10929
538 Ga0501072_0002097 3300049588 Bacteria 14852
539 Ga0501072_0055287 3300049588 Bacteria 3128
540 Ga0501073_0000337 3300049589 Bacteria 31624
541 Ga0501074_0000054 3300049590 Bacteria 55953
542 Ga0501075_0001678 3300049591 Bacteria 14518
543 Ga0501076_0000484 3300049592 Bacteria 25088
544 Ga0501077_0000419 3300049593 Bacteria 25710
545 Ga0501077_0009346 3300049593 Bacteria 6088
546 Ga0501079_0000108 3300049741 Bacteria 42571
547 Ga0501080_0000301 3300049742 Bacteria 37557
548 Ga0501080_0076516 3300049742 Bacteria 3112
549 Ga0501081_0000758 3300049743 Bacteria 18903
550 Ga0501083_0000797 3300049744 Bacteria 20656
551 Ga0501035_0000457 3300049822 Bacteria 45780
552 Ga0501044_0003357 3300049823 Bacteria 18050
553 Ga0501045_0000050 3300049824 Bacteria 51884
554 nmdc:mga03683_17990_c1 3300050489 Bacteria 2681
555 nmdc:mga00v17_77099_c1 3300050491 Bacteria 2075
556 nmdc:mga05p37_24157_c1 3300050507 Bacteria 7384
557 nmdc:mga05p37_24475_c1 3300050507 Bacteria 7339
558 nmdc:mga05p37_259523_c1 3300050507 Bacteria 2080
559 nmdc:mga05p37_36144_c1 3300050507 Bacteria 6061
560 nmdc:mga05p37_37201_c1 3300050507 Bacteria 5969
561 nmdc:mga05p37_88328_c1 3300050507 Bacteria 3821
562 nmdc:mga05p37_98278_c1 3300050507 Bacteria 3606
563 nmdc:mga09592_193761_c1 3300050508 Bacteria 1759
564 nmdc:mga09592_19783_c1 3300050508 Bacteria 5530
565 nmdc:mga09592_78386_c1 3300050508 Bacteria 2812
566 nmdc:mga0qj67_24303_c1 3300050509 Bacteria 4670
567 nmdc:mga0qj67_99105_c1 3300050509 Bacteria 2348
568 nmdc:mga06r32_19290_c1 3300050510 Bacteria 6258
569 nmdc:mga06r32_25580_c1 3300050510 Bacteria 5492
570 nmdc:mga06r32_29088_c1 3300050510 Bacteria 5176
571 nmdc:mga06r32_67596_c1 3300050510 Bacteria 3451
572 nmdc:mga08y16_11751_c1 3300050511 Bacteria 9198
573 nmdc:mga08y16_2685_c1 3300050511 Bacteria 18270
574 nmdc:mga08y16_35406_c1 3300050511 Bacteria 5243
575 nmdc:mga08y16_70585_c1 3300050511 Bacteria 3641
576 nmdc:mga08y16_7262_c1 3300050511 Bacteria 11630
577 nmdc:mga0n895_131460_c1 3300050512 Bacteria 2528
578 nmdc:mga0n895_233767_c1 3300050512 Bacteria 1866
579 nmdc:mga0n895_26924_c1 3300050512 Bacteria 5455
580 nmdc:mga0rr50_139407_c1 3300050513 Bacteria 1950
581 nmdc:mga0rr50_42319_c1 3300050513 Bacteria 3326
582 nmdc:mga0rr50_44464_c1 3300050513 Bacteria 3258
583 nmdc:mga0rr50_67185_c1 3300050513 Bacteria 2723
584 nmdc:mga08x19_131330_c1 3300050514 Bacteria 1685
585 nmdc:mga08x19_44688_c1 3300050514 Bacteria 2829
586 nmdc:mga0a205_1136_c1 3300050515 Bacteria 22088
587 nmdc:mga0a205_14308_c1 3300050515 Bacteria 7399
588 nmdc:mga0a205_16745_c1 3300050515 Bacteria 6864
589 nmdc:mga0a205_185239_c1 3300050515 Bacteria 1975
590 nmdc:mga0a205_287301_c1 3300050515 Bacteria 1520
591 nmdc:mga0a205_94727_c1 3300050515 Bacteria 2885
592 nmdc:mga0a205_98409_c1 3300050515 Bacteria 2824
593 nmdc:mga0a205_99045_c1 3300050515 Bacteria 2814
594 Ga0495601_0080869 3300053077 Bacteria 2085
595 Ga0495601_0094329 3300053077 Bacteria 1928
596 Ga0495595_0007185 3300053084 Bacteria 4551
597 Ga0495595_0034318 3300053084 Bacteria 2294
598 Ga0495619_0002088 3300053085 Bacteria 13277
599 Ga0495619_0008348 3300053085 Bacteria 6548
600 Ga0501084_0002699 3300054114 Bacteria 14290
601 Ga0501082_0001712 3300060353 Bacteria 19340
602 Ga0530510_0000188 3300061734 Bacteria 37875
603 Ga0530510_0017691 3300061734 Bacteria 5051

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10161631 Ga0307413_101616312 407
2 3300041459 Ga0451800_0526498 Ga0451800_0526498_3387_4643 417
3 3300035092 Ga0373952_0001878 Ga0373952_0001878_15_1283 421
4 3300050514 nmdc:mga08x19_131330_c1 nmdc:mga08x19_131330_c1_291_1652 436
5 3300035119 Ga0373956_0089201 Ga0373956_0089201_78_1400 439
6 3300005937 Ga0081455_10000980 Ga0081455_1000098015 441
7 3300041441 Ga0451787_260720 Ga0451787_260720_19_1407 442
8 3300009147 Ga0114129_10107725 Ga0114129_101077252 447
9 3300050515 nmdc:mga0a205_185239_c1 nmdc:mga0a205_185239_c1_553_1953 447
10 3300002077 JGI24744J21845_10001909 JGI24744J21845_100019092 448
11 3300004798 Ga0058859_11806834 Ga0058859_118068341 448
12 3300004801 Ga0058860_10013857 Ga0058860_100138572 448
13 3300005337 Ga0070682_100000922 Ga0070682_10000092215 448
14 3300005343 Ga0070687_100014361 Ga0070687_1000143612 448
15 3300005367 Ga0070667_100168084 Ga0070667_1001680841 448
16 3300005437 Ga0070710_10008309 Ga0070710_100083093 448
17 3300005439 Ga0070711_100006754 Ga0070711_1000067542 448
18 3300005455 Ga0070663_100069555 Ga0070663_1000695552 448
19 3300005459 Ga0068867_100036542 Ga0068867_1000365422 448
20 3300005548 Ga0070665_100048464 Ga0070665_1000484642 448
21 3300009176 Ga0105242_10006965 Ga0105242_100069658 448
22 3300010375 Ga0105239_10044923 Ga0105239_100449232 448
23 3300013297 Ga0157378_10043906 Ga0157378_100439062 448
24 3300014326 Ga0157380_10024436 Ga0157380_100244363 448
25 3300032002 Ga0307416_100088031 Ga0307416_1000880312 448
26 3300046615 Ga0495656_0031347 Ga0495656_0031347_429_1856 448
27 3300005445 Ga0070708_100079894 Ga0070708_1000798942 449
28 3300005467 Ga0070706_100064581 Ga0070706_1000645812 449
29 3300005468 Ga0070707_100225827 Ga0070707_1002258271 449
30 3300005471 Ga0070698_100003904 Ga0070698_10000390410 449
31 3300009147 Ga0114129_10354723 Ga0114129_103547232 449
32 3300025910 Ga0207684_10043464 Ga0207684_100434642 449
33 3300026089 Ga0207648_10101824 Ga0207648_101018242 449
34 3300048915 Ga0496112_0087457 Ga0496112_0087457_1317_2750 449
35 3300037418 Ga0395900_0020195 Ga0395900_0020195_2100_3455 450
36 3300037466 Ga0395898_0098701 Ga0395898_0098701_1143_2498 450
37 3300037471 Ga0395905_0089127 Ga0395905_0089127_1333_2688 450
38 3300041460 Ga0451802_1676736 Ga0451802_1676736_1836_3191 450
39 3300041463 Ga0451804_0502473 Ga0451804_0502473_2978_4333 450
40 3300041496 Ga0451839_0806449 Ga0451839_0806449_610_1965 450
41 3300050507 nmdc:mga05p37_259523_c1 nmdc:mga05p37_259523_c1_61_1419 450
42 3300005338 Ga0068868_100019168 Ga0068868_1000191683 451
43 3300005435 Ga0070714_100075236 Ga0070714_1000752361 451
44 3300005437 Ga0070710_10021121 Ga0070710_100211213 451
45 3300005459 Ga0068867_100058556 Ga0068867_1000585562 451
46 3300005615 Ga0070702_100013413 Ga0070702_1000134132 451
47 3300005616 Ga0068852_100195178 Ga0068852_1001951782 451
48 3300005618 Ga0068864_100076047 Ga0068864_1000760472 451
49 3300006175 Ga0070712_100117613 Ga0070712_1001176132 451
50 3300014325 Ga0163163_10241164 Ga0163163_102411642 451
51 3300025898 Ga0207692_10010534 Ga0207692_100105343 451
52 3300025929 Ga0207664_10081558 Ga0207664_100815582 451
53 3300025939 Ga0207665_10013259 Ga0207665_100132597 451
54 3300026118 Ga0207675_100038375 Ga0207675_1000383754 451
55 3300035725 Ga0373947_0001059 Ga0373947_0001059_13373_14731 451
56 3300046517 Ga0495630_0191922 Ga0495630_0191922_54_1412 451
57 3300046642 Ga0495634_0039578 Ga0495634_0039578_1785_3149 451
58 3300047321 Ga0495676_0124482 Ga0495676_0124482_350_1708 451
59 3300004803 Ga0058862_12330200 Ga0058862_123302001 452
60 3300009098 Ga0105245_10013270 Ga0105245_100132705 452
61 3300048905 Ga0496102_0280382 Ga0496102_0280382_199_1560 452
62 3300048911 Ga0496108_0104566 Ga0496108_0104566_969_2330 452
63 3300048912 Ga0496109_0008388 Ga0496109_0008388_1311_2672 452
64 3300006852 Ga0075433_10049425 Ga0075433_100494252 453
65 3300006871 Ga0075434_100002264 Ga0075434_10000226413 453
66 3300025893 Ga0207682_10051995 Ga0207682_100519952 453
67 3300050507 nmdc:mga05p37_88328_c1 nmdc:mga05p37_88328_c1_1527_2891 453
68 3300050515 nmdc:mga0a205_16745_c1 nmdc:mga0a205_16745_c1_4970_6334 453
69 3300006844 Ga0075428_100049929 Ga0075428_1000499292 454
70 3300006914 Ga0075436_100034563 Ga0075436_1000345632 454
71 3300009147 Ga0114129_10272063 Ga0114129_102720632 454
72 3300013306 Ga0163162_10064702 Ga0163162_100647022 454
73 3300027907 Ga0207428_10006489 Ga0207428_100064898 454
74 3300037418 Ga0395900_0105559 Ga0395900_0105559_1033_2418 454
75 3300042008 Ga0439450_012201 Ga0439450_012201_154_1539 454
76 3300046523 Ga0495644_0014566 Ga0495644_0014566_1605_2972 454
77 3300048909 Ga0496106_0029137 Ga0496106_0029137_1215_2612 454
78 3300050507 nmdc:mga05p37_36144_c1 nmdc:mga05p37_36144_c1_2146_3513 454
79 3300050508 nmdc:mga09592_193761_c1 nmdc:mga09592_193761_c1_157_1590 454
80 3300050509 nmdc:mga0qj67_99105_c1 nmdc:mga0qj67_99105_c1_260_1627 454
81 3300050510 nmdc:mga06r32_29088_c1 nmdc:mga06r32_29088_c1_1904_3271 454
82 3300050511 nmdc:mga08y16_35406_c1 nmdc:mga08y16_35406_c1_2091_3458 454
83 3300050512 nmdc:mga0n895_26924_c1 nmdc:mga0n895_26924_c1_2157_3524 454
84 3300050513 nmdc:mga0rr50_44464_c1 nmdc:mga0rr50_44464_c1_1369_2802 454
85 3300050515 nmdc:mga0a205_14308_c1 nmdc:mga0a205_14308_c1_2624_4057 454
86 3300050515 nmdc:mga0a205_94727_c1 nmdc:mga0a205_94727_c1_1200_2633 454
87 3300050515 nmdc:mga0a205_99045_c1 nmdc:mga0a205_99045_c1_686_2053 454
88 3300042005 Ga0439448_0004060 Ga0439448_0004060_2105_3541 455
89 3300042008 Ga0439450_002177 Ga0439450_002177_632_2068 455
90 3300048913 Ga0496110_0030512 Ga0496110_0030512_1875_3263 456
91 3300005535 Ga0070684_100270414 Ga0070684_1002704141 458
92 3300025940 Ga0207691_10183172 Ga0207691_101831722 458
93 3300048905 Ga0496102_0005830 Ga0496102_0005830_7409_8848 458
94 3300048906 Ga0496103_0007006 Ga0496103_0007006_1146_2585 458
95 3300048907 Ga0496104_0076539 Ga0496104_0076539_1359_2798 458
96 3300048909 Ga0496106_0000729 Ga0496106_0000729_16671_18110 458
97 3300048912 Ga0496109_0024760 Ga0496109_0024760_2578_4017 458
98 3300048917 Ga0496114_0004201 Ga0496114_0004201_3319_4758 458
99 3300005578 Ga0068854_100065873 Ga0068854_1000658732 459
100 3300046491 Ga0495584_0006077 Ga0495584_0006077_558_1940 459
101 3300046523 Ga0495644_0001704 Ga0495644_0001704_7068_8450 459
102 3300046537 Ga0495598_0002093 Ga0495598_0002093_2661_4043 459
103 3300046539 Ga0495621_0024833 Ga0495621_0024833_276_1658 459
104 3300046615 Ga0495656_0000888 Ga0495656_0000888_6179_7561 459
105 3300046664 Ga0495659_0003655 Ga0495659_0003655_2099_3481 459
106 3300046691 Ga0495670_0002377 Ga0495670_0002377_5001_6383 459
107 3300047318 Ga0495636_0018748 Ga0495636_0018748_514_1896 459
108 3300006844 Ga0075428_100097314 Ga0075428_1000973142 460
109 3300006847 Ga0075431_100020673 Ga0075431_1000206732 460
110 3300006880 Ga0075429_100050633 Ga0075429_1000506332 460
111 3300036401 Ga0373937_0078631 Ga0373937_0078631_1128_2513 460
112 3300037418 Ga0395900_0041261 Ga0395900_0041261_1055_2500 460
113 3300037471 Ga0395905_0264441 Ga0395905_0264441_36_1481 460
114 3300038443 Ga0395901_0272771 Ga0395901_0272771_330_1715 460
115 3300046463 Ga0495653_0084856 Ga0495653_0084856_775_2160 460
116 3300046511 Ga0495608_0008685 Ga0495608_0008685_774_2159 460
117 3300046511 Ga0495608_0035213 Ga0495608_0035213_1606_2991 460
118 3300046514 Ga0495618_0048850 Ga0495618_0048850_647_2032 460
119 3300046559 Ga0495667_0027049 Ga0495667_0027049_888_2273 460
120 3300046675 Ga0495657_0008126 Ga0495657_0008126_4164_5549 460
121 3300046675 Ga0495657_0039184 Ga0495657_0039184_1209_2594 460
122 3300046683 Ga0495658_0016944 Ga0495658_0016944_747_2132 460
123 3300047317 Ga0495604_0016344 Ga0495604_0016344_1018_2403 460
124 3300047319 Ga0495674_0098119 Ga0495674_0098119_208_1593 460
125 3300047322 Ga0495680_0017050 Ga0495680_0017050_672_2057 460
126 3300047471 Ga0495684_0069136 Ga0495684_0069136_100_1485 460
127 3300047471 Ga0495684_0090020 Ga0495684_0090020_275_1660 460
128 3300048904 Ga0496101_0006168 Ga0496101_0006168_4770_6173 460
129 3300050508 nmdc:mga09592_19783_c1 nmdc:mga09592_19783_c1_3057_4466 460
130 3300050510 nmdc:mga06r32_25580_c1 nmdc:mga06r32_25580_c1_3625_5034 460
131 3300053084 Ga0495595_0034318 Ga0495595_0034318_774_2159 460
132 3300053085 Ga0495619_0008348 Ga0495619_0008348_3505_4890 460
133 3300006038 Ga0075365_10096834 Ga0075365_100968342 461
134 3300006844 Ga0075428_100007225 Ga0075428_1000072255 461
135 3300009147 Ga0114129_10012002 Ga0114129_100120024 461
136 3300025906 Ga0207699_10095749 Ga0207699_100957491 461
137 3300037466 Ga0395898_0081982 Ga0395898_0081982_1044_2465 461
138 3300041505 Ga0451849_0147738 Ga0451849_0147738_1305_2720 461
139 3300046454 Ga0495592_0030033 Ga0495592_0030033_1604_3025 461
140 3300046459 Ga0495629_0011412 Ga0495629_0011412_1304_2719 461
141 3300046462 Ga0495651_0057667 Ga0495651_0057667_1271_2692 461
142 3300046463 Ga0495653_0053280 Ga0495653_0053280_1022_2443 461
143 3300046477 Ga0495664_0080907 Ga0495664_0080907_59_1480 461
144 3300046511 Ga0495608_0047780 Ga0495608_0047780_831_2246 461
145 3300046516 Ga0495628_0018415 Ga0495628_0018415_3106_4527 461
146 3300046517 Ga0495630_0057738 Ga0495630_0057738_1200_2615 461
147 3300046536 Ga0495587_0065952 Ga0495587_0065952_572_1981 461
148 3300046642 Ga0495634_0038581 Ga0495634_0038581_577_1998 461
149 3300046678 Ga0495599_0108550 Ga0495599_0108550_220_1635 461
150 3300046680 Ga0495646_0054169 Ga0495646_0054169_577_1998 461
151 3300046689 Ga0495613_0048964 Ga0495613_0048964_876_2297 461
152 3300047319 Ga0495674_0081148 Ga0495674_0081148_174_1595 461
153 3300047322 Ga0495680_0001834 Ga0495680_0001834_14368_15789 461
154 3300047471 Ga0495684_0000755 Ga0495684_0000755_9647_11062 461
155 3300048088 Ga0495602_0106999 Ga0495602_0106999_814_2235 461
156 3300053077 Ga0495601_0094329 Ga0495601_0094329_65_1480 461
157 3300053084 Ga0495595_0007185 Ga0495595_0007185_641_2062 461
158 3300053085 Ga0495619_0002088 Ga0495619_0002088_2021_3442 461
159 3300005456 Ga0070678_100023705 Ga0070678_1000237052 462
160 3300006844 Ga0075428_100349758 Ga0075428_1003497582 462
161 3300026067 Ga0207678_10160177 Ga0207678_101601771 462
162 3300047317 Ga0495604_0136498 Ga0495604_0136498_111_1523 462
163 3300047319 Ga0495674_0068147 Ga0495674_0068147_54_1466 462
164 3300047322 Ga0495680_0016323 Ga0495680_0016323_3016_4428 462
165 3300049575 Ga0501039_0077885 Ga0501039_0077885_471_1859 462
166 3300049587 Ga0501071_0002667 Ga0501071_0002667_7355_8743 462
167 3300049588 Ga0501072_0055287 Ga0501072_0055287_21_1409 462
168 3300049593 Ga0501077_0009346 Ga0501077_0009346_1033_2421 462
169 3300049742 Ga0501080_0076516 Ga0501080_0076516_1013_2401 462
170 3300061734 Ga0530510_0017691 Ga0530510_0017691_920_2308 462
171 iso_pu_bacteria 2816332119 2816424226 462
172 3300005436 Ga0070713_100077838 Ga0070713_1000778382 463
173 3300005545 Ga0070695_100007621 Ga0070695_1000076212 463
174 3300006173 Ga0070716_100013307 Ga0070716_1000133072 463
175 3300009148 Ga0105243_10016670 Ga0105243_100166702 463
176 3300009553 Ga0105249_10042558 Ga0105249_100425582 463
177 3300025928 Ga0207700_10056817 Ga0207700_100568172 463
178 3300026116 Ga0207674_10124922 Ga0207674_101249222 463
179 3300031251 Ga0265327_10023218 Ga0265327_100232182 463
180 3300031995 Ga0307409_100043090 Ga0307409_1000430902 463
181 3300032126 Ga0307415_100023353 Ga0307415_1000233533 463
182 3300037418 Ga0395900_0072400 Ga0395900_0072400_158_1579 463
183 3300037466 Ga0395898_0023058 Ga0395898_0023058_4853_6274 463
184 3300038443 Ga0395901_0025938 Ga0395901_0025938_3884_5305 463
185 3300048903 Ga0496100_0114016 Ga0496100_0114016_381_1790 463
186 3300048904 Ga0496101_0094304 Ga0496101_0094304_21_1430 463
187 3300048905 Ga0496102_0151376 Ga0496102_0151376_50_1459 463
188 3300048907 Ga0496104_0060599 Ga0496104_0060599_506_1915 463
189 3300048907 Ga0496104_0088361 Ga0496104_0088361_608_2026 463
190 3300048911 Ga0496108_0002863 Ga0496108_0002863_4077_5486 463
191 3300048912 Ga0496109_0004914 Ga0496109_0004914_3302_4711 463
192 3300048912 Ga0496109_0050593 Ga0496109_0050593_315_1733 463
193 3300048916 Ga0496113_0013024 Ga0496113_0013024_137_1546 463
194 3300048918 Ga0496115_0089416 Ga0496115_0089416_345_1754 463
195 3300006175 Ga0070712_100002845 Ga0070712_1000028454 464
196 3300025915 Ga0207693_10021227 Ga0207693_100212272 464
197 3300048915 Ga0496112_0045604 Ga0496112_0045604_974_2398 464
198 3300004800 Ga0058861_12062177 Ga0058861_120621772 465
199 3300005356 Ga0070674_100040772 Ga0070674_1000407722 465
200 3300005365 Ga0070688_100000700 Ga0070688_1000007002 465
201 3300005439 Ga0070711_100149002 Ga0070711_1001490022 465
202 3300005441 Ga0070700_100001301 Ga0070700_1000013015 465
203 3300005546 Ga0070696_100022246 Ga0070696_1000222462 465
204 3300005617 Ga0068859_100202381 Ga0068859_1002023812 465
205 3300006931 Ga0097620_100202389 Ga0097620_1002023892 465
206 3300009147 Ga0114129_10042748 Ga0114129_100427483 465
207 3300009174 Ga0105241_10041134 Ga0105241_100411342 465
208 3300013296 Ga0157374_10105932 Ga0157374_101059322 465
209 3300014745 Ga0157377_10004218 Ga0157377_100042182 465
210 3300025915 Ga0207693_10044071 Ga0207693_100440712 465
211 3300025927 Ga0207687_10065891 Ga0207687_100658913 465
212 3300025929 Ga0207664_10015828 Ga0207664_100158282 465
213 3300025939 Ga0207665_10000419 Ga0207665_100004195 465
214 3300026035 Ga0207703_10125930 Ga0207703_101259302 465
215 3300026075 Ga0207708_10000064 Ga0207708_1000006435 465
216 3300026121 Ga0207683_10010485 Ga0207683_100104854 465
217 3300027907 Ga0207428_10004538 Ga0207428_100045382 465
218 3300035121 Ga0373960_0007553 Ga0373960_0007553_556_1989 465
219 3300035207 Ga0373942_0011702 Ga0373942_0011702_74_1507 465
220 3300035691 Ga0373931_0027344 Ga0373931_0027344_316_1749 465
221 3300037466 Ga0395898_0070903 Ga0395898_0070903_839_2272 465
222 3300037471 Ga0395905_0183932 Ga0395905_0183932_63_1496 465
223 3300045051 Ga0451576_0035206 Ga0451576_0035206_2563_3996 465
224 3300046461 Ga0495641_0023573 Ga0495641_0023573_622_2049 465
225 3300046476 Ga0495662_0035839 Ga0495662_0035839_216_1643 465
226 3300046491 Ga0495584_0040481 Ga0495584_0040481_203_1633 465
227 3300046538 Ga0495609_0055001 Ga0495609_0055001_62_1492 465
228 3300047315 Ga0495581_0007725 Ga0495581_0007725_2621_4048 465
229 3300048908 Ga0496105_0196588 Ga0496105_0196588_94_1521 465
230 3300048913 Ga0496110_0002619 Ga0496110_0002619_3584_5017 465
231 3300048914 Ga0496111_0006246 Ga0496111_0006246_1344_2777 465
232 3300048915 Ga0496112_0016933 Ga0496112_0016933_1564_2997 465
233 3300048916 Ga0496113_0083225 Ga0496113_0083225_153_1580 465
234 3300050507 nmdc:mga05p37_37201_c1 nmdc:mga05p37_37201_c1_896_2296 465
235 3300050511 nmdc:mga08y16_2685_c1 nmdc:mga08y16_2685_c1_2041_3441 465
236 3300050515 nmdc:mga0a205_1136_c1 nmdc:mga0a205_1136_c1_19069_20469 465
237 3300003373 JGI25407J50210_10001726 JGI25407J50210_100017262 466
238 3300005329 Ga0070683_100008404 Ga0070683_1000084043 466
239 3300005366 Ga0070659_100236295 Ga0070659_1002362951 466
240 3300005438 Ga0070701_10065219 Ga0070701_100652192 466
241 3300005440 Ga0070705_100067331 Ga0070705_1000673312 466
242 3300005457 Ga0070662_100030526 Ga0070662_1000305263 466
243 3300005457 Ga0070662_100124053 Ga0070662_1001240532 466
244 3300005535 Ga0070684_100000934 Ga0070684_10000093416 466
245 3300005547 Ga0070693_100031479 Ga0070693_1000314792 466
246 3300005549 Ga0070704_100104785 Ga0070704_1001047852 466
247 3300005614 Ga0068856_100096974 Ga0068856_1000969742 466
248 3300005718 Ga0068866_10006694 Ga0068866_100066944 466
249 3300005842 Ga0068858_100246738 Ga0068858_1002467382 466
250 3300005937 Ga0081455_10005954 Ga0081455_100059545 466
251 3300005981 Ga0081538_10000062 Ga0081538_1000006258 466
252 3300006844 Ga0075428_100180126 Ga0075428_1001801261 466
253 3300006852 Ga0075433_10087300 Ga0075433_100873002 466
254 3300006852 Ga0075433_10103918 Ga0075433_101039184 466
255 3300007076 Ga0075435_100020408 Ga0075435_1000204083 466
256 3300009098 Ga0105245_10005198 Ga0105245_100051988 466
257 3300009098 Ga0105245_10006274 Ga0105245_100062749 466
258 3300009098 Ga0105245_10009183 Ga0105245_100091835 466
259 3300009148 Ga0105243_10015249 Ga0105243_100152492 466
260 3300009176 Ga0105242_10023934 Ga0105242_100239343 466
261 3300009176 Ga0105242_10226523 Ga0105242_102265231 466
262 3300009177 Ga0105248_10068764 Ga0105248_100687642 466
263 3300009553 Ga0105249_10189468 Ga0105249_101894682 466
264 3300010375 Ga0105239_10019008 Ga0105239_100190083 466
265 3300010375 Ga0105239_10198543 Ga0105239_101985432 466
266 3300011119 Ga0105246_10001142 Ga0105246_100011427 466
267 3300011119 Ga0105246_10052289 Ga0105246_100522893 466
268 3300013105 Ga0157369_10015138 Ga0157369_100151383 466
269 3300013307 Ga0157372_10006104 Ga0157372_100061047 466
270 3300013307 Ga0157372_10119454 Ga0157372_101194542 466
271 3300025899 Ga0207642_10001835 Ga0207642_100018355 466
272 3300025908 Ga0207643_10013515 Ga0207643_100135154 466
273 3300025921 Ga0207652_10181876 Ga0207652_101818762 466
274 3300025927 Ga0207687_10002598 Ga0207687_100025989 466
275 3300025927 Ga0207687_10036213 Ga0207687_100362132 466
276 3300025933 Ga0207706_10021778 Ga0207706_100217782 466
277 3300025933 Ga0207706_10063494 Ga0207706_100634943 466
278 3300025935 Ga0207709_10104129 Ga0207709_101041291 466
279 3300025944 Ga0207661_10002247 Ga0207661_100022476 466
280 3300025945 Ga0207679_10083259 Ga0207679_100832592 466
281 3300026023 Ga0207677_10066813 Ga0207677_100668132 466
282 3300026078 Ga0207702_10048456 Ga0207702_100484562 466
283 3300026118 Ga0207675_100021458 Ga0207675_1000214581 466
284 3300026118 Ga0207675_100067930 Ga0207675_1000679303 466
285 3300026118 Ga0207675_100151845 Ga0207675_1001518452 466
286 3300027907 Ga0207428_10032418 Ga0207428_100324185 466
287 3300028381 Ga0268264_10187770 Ga0268264_101877701 466
288 3300035170 Ga0373943_0005394 Ga0373943_0005394_4078_5511 466
289 3300035171 Ga0373946_0008525 Ga0373946_0008525_2004_3440 466
290 3300035725 Ga0373947_0002802 Ga0373947_0002802_1138_2574 466
291 3300037068 Ga0373925_0005324 Ga0373925_0005324_6913_8349 466
292 3300037418 Ga0395900_0012939 Ga0395900_0012939_6158_7594 466
293 3300037466 Ga0395898_0001644 Ga0395898_0001644_23999_25435 466
294 3300037466 Ga0395898_0033832 Ga0395898_0033832_3161_4606 466
295 3300037471 Ga0395905_0005590 Ga0395905_0005590_8039_9475 466
296 3300037471 Ga0395905_0010756 Ga0395905_0010756_652_2097 466
297 3300045051 Ga0451576_0057717 Ga0451576_0057717_2075_3505 466
298 3300046455 Ga0495603_0007045 Ga0495603_0007045_2869_4305 466
299 3300046461 Ga0495641_0003896 Ga0495641_0003896_2640_4076 466
300 3300046491 Ga0495584_0006163 Ga0495584_0006163_875_2302 466
301 3300046499 Ga0495594_0001378 Ga0495594_0001378_3086_4522 466
302 3300046674 Ga0495588_0007629 Ga0495588_0007629_102_1538 466
303 3300046681 Ga0495647_0023507 Ga0495647_0023507_400_1836 466
304 3300047321 Ga0495676_0013494 Ga0495676_0013494_2502_3938 466
305 3300048903 Ga0496100_0194355 Ga0496100_0194355_30_1451 466
306 3300048905 Ga0496102_0006206 Ga0496102_0006206_3059_4495 466
307 3300048905 Ga0496102_0037892 Ga0496102_0037892_1566_2966 466
308 3300048906 Ga0496103_0016633 Ga0496103_0016633_140_1540 466
309 3300048906 Ga0496103_0023544 Ga0496103_0023544_209_1645 466
310 3300048907 Ga0496104_0031233 Ga0496104_0031233_2977_4413 466
311 3300048910 Ga0496107_0110966 Ga0496107_0110966_11_1411 466
312 3300048912 Ga0496109_0008075 Ga0496109_0008075_2677_4077 466
313 3300048912 Ga0496109_0030328 Ga0496109_0030328_3318_4745 466
314 3300048914 Ga0496111_0002096 Ga0496111_0002096_2402_3802 466
315 3300048914 Ga0496111_0014711 Ga0496111_0014711_3076_4503 466
316 3300048917 Ga0496114_0001305 Ga0496114_0001305_3951_5387 466
317 3300049568 Ga0501031_0001154 Ga0501031_0001154_2505_3917 466
318 3300049569 Ga0501032_0000274 Ga0501032_0000274_30060_31472 466
319 3300049570 Ga0501033_0000629 Ga0501033_0000629_14819_16231 466
320 3300049572 Ga0501036_0000296 Ga0501036_0000296_11784_13196 466
321 3300049573 Ga0501037_0000379 Ga0501037_0000379_23101_24513 466
322 3300049574 Ga0501038_0000186 Ga0501038_0000186_19040_20452 466
323 3300049575 Ga0501039_0000141 Ga0501039_0000141_22584_23996 466
324 3300049576 Ga0501040_0000360 Ga0501040_0000360_9039_10451 466
325 3300049577 Ga0501041_0000039 Ga0501041_0000039_11789_13201 466
326 3300049578 Ga0501042_0000670 Ga0501042_0000670_12461_13873 466
327 3300049579 Ga0501043_0000171 Ga0501043_0000171_34085_35497 466
328 3300049580 Ga0501046_0000177 Ga0501046_0000177_11789_13201 466
329 3300049581 Ga0501047_0000481 Ga0501047_0000481_28135_29547 466
330 3300049582 Ga0501048_0001307 Ga0501048_0001307_1090_2502 466
331 3300049585 Ga0501069_0004399 Ga0501069_0004399_1109_2521 466
332 3300049586 Ga0501070_0001532 Ga0501070_0001532_13723_15135 466
333 3300049587 Ga0501071_0000494 Ga0501071_0000494_16401_17813 466
334 3300049588 Ga0501072_0002097 Ga0501072_0002097_4690_6102 466
335 3300049589 Ga0501073_0000337 Ga0501073_0000337_21379_22791 466
336 3300049590 Ga0501074_0000054 Ga0501074_0000054_34279_35691 466
337 3300049591 Ga0501075_0001678 Ga0501075_0001678_9774_11186 466
338 3300049592 Ga0501076_0000484 Ga0501076_0000484_11893_13305 466
339 3300049593 Ga0501077_0000419 Ga0501077_0000419_17912_19324 466
340 3300049741 Ga0501079_0000108 Ga0501079_0000108_29371_30783 466
341 3300049742 Ga0501080_0000301 Ga0501080_0000301_11875_13287 466
342 3300049743 Ga0501081_0000758 Ga0501081_0000758_16401_17813 466
343 3300049744 Ga0501083_0000797 Ga0501083_0000797_14555_15967 466
344 3300049822 Ga0501035_0000457 Ga0501035_0000457_32580_33992 466
345 3300049823 Ga0501044_0003357 Ga0501044_0003357_13508_14920 466
346 3300049824 Ga0501045_0000050 Ga0501045_0000050_21384_22796 466
347 3300050511 nmdc:mga08y16_11751_c1 nmdc:mga08y16_11751_c1_6324_7733 466
348 3300050512 nmdc:mga0n895_131460_c1 nmdc:mga0n895_131460_c1_456_1865 466
349 3300050513 nmdc:mga0rr50_42319_c1 nmdc:mga0rr50_42319_c1_1214_2650 466
350 3300050515 nmdc:mga0a205_98409_c1 nmdc:mga0a205_98409_c1_356_1792 466
351 3300054114 Ga0501084_0002699 Ga0501084_0002699_11789_13201 466
352 3300060353 Ga0501082_0001712 Ga0501082_0001712_14468_15880 466
353 3300061734 Ga0530510_0000188 Ga0530510_0000188_13798_15210 466
354 3300005406 Ga0070703_10000259 Ga0070703_1000025920 467
355 3300005439 Ga0070711_100042685 Ga0070711_1000426852 467
356 3300005440 Ga0070705_100006314 Ga0070705_1000063142 467
357 3300005444 Ga0070694_100013740 Ga0070694_1000137404 467
358 3300005445 Ga0070708_100000272 Ga0070708_10000027235 467
359 3300005467 Ga0070706_100000748 Ga0070706_10000074833 467
360 3300005467 Ga0070706_100075424 Ga0070706_1000754242 467
361 3300005468 Ga0070707_100062761 Ga0070707_1000627612 467
362 3300005471 Ga0070698_100005947 Ga0070698_1000059479 467
363 3300005536 Ga0070697_100024427 Ga0070697_1000244272 467
364 3300005719 Ga0068861_100044390 Ga0068861_1000443902 467
365 3300005937 Ga0081455_10003455 Ga0081455_1000345516 467
366 3300005983 Ga0081540_1030296 Ga0081540_10302962 467
367 3300006028 Ga0070717_10190518 Ga0070717_101905182 467
368 3300006847 Ga0075431_100006337 Ga0075431_10000633712 467
369 3300006914 Ga0075436_100045497 Ga0075436_1000454972 467
370 3300009094 Ga0111539_10003555 Ga0111539_1000355526 467
371 3300009094 Ga0111539_10111706 Ga0111539_101117063 467
372 3300009147 Ga0114129_10010204 Ga0114129_100102046 467
373 3300009147 Ga0114129_10016756 Ga0114129_100167569 467
374 3300009147 Ga0114129_10153814 Ga0114129_101538142 467
375 3300025885 Ga0207653_10000003 Ga0207653_10000003236 467
376 3300025885 Ga0207653_10007668 Ga0207653_100076682 467
377 3300025901 Ga0207688_10007719 Ga0207688_100077192 467
378 3300025910 Ga0207684_10000532 Ga0207684_100005324 467
379 3300025915 Ga0207693_10003883 Ga0207693_100038834 467
380 3300025922 Ga0207646_10021867 Ga0207646_100218672 467
381 3300026118 Ga0207675_100035597 Ga0207675_1000355972 467
382 3300026121 Ga0207683_10008620 Ga0207683_100086202 467
383 3300037312 Ga0395899_0005777 Ga0395899_0005777_7972_9405 467
384 3300037418 Ga0395900_0011716 Ga0395900_0011716_898_2331 467
385 3300037466 Ga0395898_0004563 Ga0395898_0004563_6739_8172 467
386 3300037471 Ga0395905_0015079 Ga0395905_0015079_200_1633 467
387 3300038443 Ga0395901_0001203 Ga0395901_0001203_11634_13067 467
388 3300048909 Ga0496106_0015306 Ga0496106_0015306_1171_2589 467
389 3300050507 nmdc:mga05p37_24475_c1 nmdc:mga05p37_24475_c1_159_1580 467
390 3300050511 nmdc:mga08y16_70585_c1 nmdc:mga08y16_70585_c1_736_2142 467
391 3300050511 nmdc:mga08y16_7262_c1 nmdc:mga08y16_7262_c1_2380_3813 467
392 3300050513 nmdc:mga0rr50_139407_c1 nmdc:mga0rr50_139407_c1_368_1801 467
393 3300050514 nmdc:mga08x19_44688_c1 nmdc:mga08x19_44688_c1_1023_2456 467
394 3300050515 nmdc:mga0a205_287301_c1 nmdc:mga0a205_287301_c1_49_1482 467
395 3300001990 JGI24737J22298_10027834 JGI24737J22298_100278341 468
396 3300005329 Ga0070683_100002616 Ga0070683_1000026169 468
397 3300005329 Ga0070683_100038966 Ga0070683_1000389662 468
398 3300005329 Ga0070683_100102853 Ga0070683_1001028532 468
399 3300005336 Ga0070680_100034742 Ga0070680_1000347423 468
400 3300005337 Ga0070682_100003904 Ga0070682_1000039044 468
401 3300005338 Ga0068868_100024499 Ga0068868_1000244992 468
402 3300005338 Ga0068868_100030301 Ga0068868_1000303012 468
403 3300005345 Ga0070692_10004815 Ga0070692_100048154 468
404 3300005366 Ga0070659_100010230 Ga0070659_1000102304 468
405 3300005436 Ga0070713_100029881 Ga0070713_1000298814 468
406 3300005436 Ga0070713_100158618 Ga0070713_1001586182 468
407 3300005438 Ga0070701_10000968 Ga0070701_100009682 468
408 3300005439 Ga0070711_100098629 Ga0070711_1000986292 468
409 3300005440 Ga0070705_100003497 Ga0070705_1000034976 468
410 3300005441 Ga0070700_100001110 Ga0070700_10000111014 468
411 3300005441 Ga0070700_100016865 Ga0070700_1000168653 468
412 3300005441 Ga0070700_100020813 Ga0070700_1000208132 468
413 3300005444 Ga0070694_100034679 Ga0070694_1000346792 468
414 3300005445 Ga0070708_100166452 Ga0070708_1001664522 468
415 3300005456 Ga0070678_100018179 Ga0070678_1000181792 468
416 3300005471 Ga0070698_100224338 Ga0070698_1002243381 468
417 3300005535 Ga0070684_100008843 Ga0070684_1000088434 468
418 3300005535 Ga0070684_100058880 Ga0070684_1000588802 468
419 3300005544 Ga0070686_100016752 Ga0070686_1000167524 468
420 3300005544 Ga0070686_100018071 Ga0070686_1000180713 468
421 3300005545 Ga0070695_100049578 Ga0070695_1000495781 468
422 3300005546 Ga0070696_100003346 Ga0070696_1000033465 468
423 3300005546 Ga0070696_100113211 Ga0070696_1001132112 468
424 3300005549 Ga0070704_100031249 Ga0070704_1000312493 468
425 3300005563 Ga0068855_100369070 Ga0068855_1003690701 468
426 3300005564 Ga0070664_100007619 Ga0070664_1000076195 468
427 3300005614 Ga0068856_100046759 Ga0068856_1000467591 468
428 3300005615 Ga0070702_100005021 Ga0070702_1000050213 468
429 3300005616 Ga0068852_100001464 Ga0068852_1000014643 468
430 3300005840 Ga0068870_10006802 Ga0068870_100068022 468
431 3300005841 Ga0068863_100014867 Ga0068863_1000148672 468
432 3300005842 Ga0068858_100097274 Ga0068858_1000972742 468
433 3300005843 Ga0068860_100059877 Ga0068860_1000598772 468
434 3300005844 Ga0068862_100156509 Ga0068862_1001565092 468
435 3300005981 Ga0081538_10000847 Ga0081538_100008476 468
436 3300005983 Ga0081540_1000540 Ga0081540_100054023 468
437 3300006051 Ga0075364_10093860 Ga0075364_100938602 468
438 3300006175 Ga0070712_100015031 Ga0070712_1000150312 468
439 3300006175 Ga0070712_100054420 Ga0070712_1000544202 468
440 3300006358 Ga0068871_100135396 Ga0068871_1001353962 468
441 3300006844 Ga0075428_100085615 Ga0075428_1000856152 468
442 3300006847 Ga0075431_100036816 Ga0075431_1000368164 468
443 3300006871 Ga0075434_100039046 Ga0075434_1000390463 468
444 3300006880 Ga0075429_100102200 Ga0075429_1001022002 468
445 3300006881 Ga0068865_100014889 Ga0068865_1000148893 468
446 3300006914 Ga0075436_100005258 Ga0075436_1000052583 468
447 3300007076 Ga0075435_100003744 Ga0075435_1000037443 468
448 3300009098 Ga0105245_10010142 Ga0105245_100101424 468
449 3300009098 Ga0105245_10021666 Ga0105245_100216664 468
450 3300009147 Ga0114129_10018480 Ga0114129_100184802 468
451 3300009148 Ga0105243_10001866 Ga0105243_100018662 468
452 3300009148 Ga0105243_10046606 Ga0105243_100466063 468
453 3300009176 Ga0105242_10049642 Ga0105242_100496422 468
454 3300009177 Ga0105248_10099181 Ga0105248_100991812 468
455 3300009553 Ga0105249_10018944 Ga0105249_100189445 468
456 3300009553 Ga0105249_10068062 Ga0105249_100680622 468
457 3300009553 Ga0105249_10084325 Ga0105249_100843251 468
458 3300010375 Ga0105239_10056306 Ga0105239_100563062 468
459 3300013102 Ga0157371_10054053 Ga0157371_100540532 468
460 3300013297 Ga0157378_10075488 Ga0157378_100754882 468
461 3300013306 Ga0163162_10067125 Ga0163162_100671252 468
462 3300013306 Ga0163162_10175168 Ga0163162_101751682 468
463 3300013307 Ga0157372_10018570 Ga0157372_100185707 468
464 3300013307 Ga0157372_10051403 Ga0157372_100514033 468
465 3300014325 Ga0163163_10070955 Ga0163163_100709552 468
466 3300014326 Ga0157380_10005445 Ga0157380_100054452 468
467 3300014745 Ga0157377_10080487 Ga0157377_100804872 468
468 3300014968 Ga0157379_10009161 Ga0157379_100091615 468
469 3300025904 Ga0207647_10036296 Ga0207647_100362962 468
470 3300025908 Ga0207643_10001011 Ga0207643_100010112 468
471 3300025908 Ga0207643_10015154 Ga0207643_100151542 468
472 3300025915 Ga0207693_10005452 Ga0207693_100054525 468
473 3300025915 Ga0207693_10142012 Ga0207693_101420122 468
474 3300025918 Ga0207662_10010190 Ga0207662_100101903 468
475 3300025923 Ga0207681_10013066 Ga0207681_100130663 468
476 3300025927 Ga0207687_10006277 Ga0207687_100062774 468
477 3300025932 Ga0207690_10021396 Ga0207690_100213963 468
478 3300025934 Ga0207686_10080045 Ga0207686_100800452 468
479 3300025935 Ga0207709_10034955 Ga0207709_100349552 468
480 3300025939 Ga0207665_10084376 Ga0207665_100843762 468
481 3300025939 Ga0207665_10092677 Ga0207665_100926772 468
482 3300025940 Ga0207691_10004435 Ga0207691_100044354 468
483 3300025941 Ga0207711_10111273 Ga0207711_101112732 468
484 3300025941 Ga0207711_10204119 Ga0207711_102041192 468
485 3300025944 Ga0207661_10086028 Ga0207661_100860282 468
486 3300025945 Ga0207679_10050912 Ga0207679_100509122 468
487 3300025960 Ga0207651_10058821 Ga0207651_100588212 468
488 3300025961 Ga0207712_10089745 Ga0207712_100897452 468
489 3300025972 Ga0207668_10113477 Ga0207668_101134771 468
490 3300025981 Ga0207640_10045925 Ga0207640_100459252 468
491 3300025981 Ga0207640_10115995 Ga0207640_101159952 468
492 3300026023 Ga0207677_10012441 Ga0207677_100124412 468
493 3300026023 Ga0207677_10033195 Ga0207677_100331952 468
494 3300026023 Ga0207677_10069161 Ga0207677_100691612 468
495 3300026035 Ga0207703_10188417 Ga0207703_101884172 468
496 3300026075 Ga0207708_10000259 Ga0207708_1000025942 468
497 3300026075 Ga0207708_10012633 Ga0207708_100126333 468
498 3300026075 Ga0207708_10020262 Ga0207708_100202622 468
499 3300026088 Ga0207641_10240858 Ga0207641_102408582 468
500 3300026089 Ga0207648_10008677 Ga0207648_100086773 468
501 3300026089 Ga0207648_10010820 Ga0207648_100108203 468
502 3300026116 Ga0207674_10048408 Ga0207674_100484082 468
503 3300026118 Ga0207675_100013425 Ga0207675_1000134252 468
504 3300026118 Ga0207675_100018419 Ga0207675_1000184192 468
505 3300026118 Ga0207675_100091500 Ga0207675_1000915002 468
506 3300026121 Ga0207683_10021098 Ga0207683_100210982 468
507 3300026121 Ga0207683_10030331 Ga0207683_100303312 468
508 3300026121 Ga0207683_10102920 Ga0207683_101029202 468
509 3300027907 Ga0207428_10012111 Ga0207428_100121113 468
510 3300027907 Ga0207428_10039599 Ga0207428_100395992 468
511 3300028380 Ga0268265_10174404 Ga0268265_101744042 468
512 3300031548 Ga0307408_100051109 Ga0307408_1000511091 468
513 3300031852 Ga0307410_10002617 Ga0307410_100026173 468
514 3300031911 Ga0307412_10051655 Ga0307412_100516552 468
515 3300031995 Ga0307409_100001632 Ga0307409_1000016329 468
516 3300032005 Ga0307411_10003083 Ga0307411_100030836 468
517 3300032126 Ga0307415_100007945 Ga0307415_1000079455 468
518 3300035724 Ga0373933_0043663 Ga0373933_0043663_370_1812 468
519 3300037312 Ga0395899_0001680 Ga0395899_0001680_9945_11357 468
520 3300037418 Ga0395900_0005212 Ga0395900_0005212_12194_13606 468
521 3300037466 Ga0395898_0006011 Ga0395898_0006011_3396_4808 468
522 3300037471 Ga0395905_0002213 Ga0395905_0002213_4849_6261 468
523 3300038443 Ga0395901_0136926 Ga0395901_0136926_134_1582 468
524 3300045976 Ga0466967_0129069 Ga0466967_0129069_167_1576 468
525 3300046462 Ga0495651_0092432 Ga0495651_0092432_69_1511 468
526 3300046463 Ga0495653_0044155 Ga0495653_0044155_1159_2601 468
527 3300046492 Ga0495585_0047599 Ga0495585_0047599_377_1789 468
528 3300046511 Ga0495608_0038690 Ga0495608_0038690_1200_2642 468
529 3300046516 Ga0495628_0015666 Ga0495628_0015666_2084_3526 468
530 3300046516 Ga0495628_0056164 Ga0495628_0056164_581_2023 468
531 3300046517 Ga0495630_0003282 Ga0495630_0003282_7665_9107 468
532 3300046529 Ga0495652_0049663 Ga0495652_0049663_663_2105 468
533 3300046533 Ga0495640_0002482 Ga0495640_0002482_11550_12992 468
534 3300046533 Ga0495640_0080016 Ga0495640_0080016_376_1818 468
535 3300046536 Ga0495587_0038368 Ga0495587_0038368_1415_2857 468
536 3300046559 Ga0495667_0006175 Ga0495667_0006175_3428_4870 468
537 3300046615 Ga0495656_0021283 Ga0495656_0021283_547_1959 468
538 3300046663 Ga0495635_0010227 Ga0495635_0010227_2218_3660 468
539 3300046675 Ga0495657_0018225 Ga0495657_0018225_1554_2996 468
540 3300046675 Ga0495657_0020351 Ga0495657_0020351_535_1977 468
541 3300046678 Ga0495599_0039657 Ga0495599_0039657_69_1511 468
542 3300046679 Ga0495623_0061675 Ga0495623_0061675_892_2334 468
543 3300046680 Ga0495646_0021681 Ga0495646_0021681_237_1679 468
544 3300046689 Ga0495613_0012413 Ga0495613_0012413_3605_5047 468
545 3300046809 Ga0495600_0012431 Ga0495600_0012431_1971_3413 468
546 3300047317 Ga0495604_0005834 Ga0495604_0005834_3939_5381 468
547 3300047319 Ga0495674_0000584 Ga0495674_0000584_28409_29851 468
548 3300047322 Ga0495680_0000204 Ga0495680_0000204_43954_45396 468
549 3300047322 Ga0495680_0009074 Ga0495680_0009074_2956_4398 468
550 3300047444 Ga0495675_0025314 Ga0495675_0025314_2326_3768 468
551 3300047471 Ga0495684_0018185 Ga0495684_0018185_1709_3151 468
552 3300048088 Ga0495602_0012596 Ga0495602_0012596_1820_3262 468
553 3300048903 Ga0496100_0130376 Ga0496100_0130376_47_1483 468
554 3300048904 Ga0496101_0032909 Ga0496101_0032909_1422_2858 468
555 3300048904 Ga0496101_0051053 Ga0496101_0051053_606_2042 468
556 3300048905 Ga0496102_0024331 Ga0496102_0024331_2332_3768 468
557 3300048905 Ga0496102_0035034 Ga0496102_0035034_390_1826 468
558 3300048906 Ga0496103_0022573 Ga0496103_0022573_2054_3490 468
559 3300048907 Ga0496104_0000471 Ga0496104_0000471_28442_29878 468
560 3300048907 Ga0496104_0167687 Ga0496104_0167687_280_1716 468
561 3300048908 Ga0496105_0000792 Ga0496105_0000792_15040_16470 468
562 3300048908 Ga0496105_0000996 Ga0496105_0000996_9537_10973 468
563 3300048908 Ga0496105_0002314 Ga0496105_0002314_3798_5234 468
564 3300048908 Ga0496105_0005624 Ga0496105_0005624_2335_3777 468
565 3300048909 Ga0496106_0024196 Ga0496106_0024196_1345_2781 468
566 3300048909 Ga0496106_0028618 Ga0496106_0028618_2180_3616 468
567 3300048910 Ga0496107_0008594 Ga0496107_0008594_1160_2596 468
568 3300048910 Ga0496107_0070601 Ga0496107_0070601_385_1821 468
569 3300048911 Ga0496108_0001390 Ga0496108_0001390_17598_19034 468
570 3300048911 Ga0496108_0002323 Ga0496108_0002323_11614_13050 468
571 3300048911 Ga0496108_0019663 Ga0496108_0019663_3412_4851 468
572 3300048911 Ga0496108_0026152 Ga0496108_0026152_1511_2947 468
573 3300048912 Ga0496109_0011153 Ga0496109_0011153_5017_6435 468
574 3300048912 Ga0496109_0022223 Ga0496109_0022223_2008_3444 468
575 3300048912 Ga0496109_0078594 Ga0496109_0078594_648_2060 468
576 3300048912 Ga0496109_0088968 Ga0496109_0088968_1036_2472 468
577 3300048913 Ga0496110_0004397 Ga0496110_0004397_8881_10317 468
578 3300048913 Ga0496110_0005696 Ga0496110_0005696_3065_4501 468
579 3300048914 Ga0496111_0002846 Ga0496111_0002846_4858_6300 468
580 3300048914 Ga0496111_0014642 Ga0496111_0014642_2110_3546 468
581 3300048915 Ga0496112_0000082 Ga0496112_0000082_55794_57230 468
582 3300048915 Ga0496112_0000998 Ga0496112_0000998_3093_4529 468
583 3300048915 Ga0496112_0059486 Ga0496112_0059486_623_2065 468
584 3300048915 Ga0496112_0064683 Ga0496112_0064683_1881_3317 468
585 3300048916 Ga0496113_0000069 Ga0496113_0000069_38906_40342 468
586 3300048916 Ga0496113_0002742 Ga0496113_0002742_6205_7641 468
587 3300048916 Ga0496113_0022407 Ga0496113_0022407_1845_3281 468
588 3300048916 Ga0496113_0043752 Ga0496113_0043752_47_1489 468
589 3300048916 Ga0496113_0094731 Ga0496113_0094731_489_1931 468
590 3300048917 Ga0496114_0005625 Ga0496114_0005625_758_2194 468
591 3300048917 Ga0496114_0061597 Ga0496114_0061597_1006_2442 468
592 3300048918 Ga0496115_0011197 Ga0496115_0011197_2949_4385 468
593 3300048918 Ga0496115_0012161 Ga0496115_0012161_477_1919 468
594 3300050489 nmdc:mga03683_17990_c1 nmdc:mga03683_17990_c1_285_1733 468
595 3300050491 nmdc:mga00v17_77099_c1 nmdc:mga00v17_77099_c1_535_1983 468
596 3300050507 nmdc:mga05p37_24157_c1 nmdc:mga05p37_24157_c1_2399_3841 468
597 3300050507 nmdc:mga05p37_98278_c1 nmdc:mga05p37_98278_c1_1258_2706 468
598 3300050508 nmdc:mga09592_78386_c1 nmdc:mga09592_78386_c1_289_1737 468
599 3300050509 nmdc:mga0qj67_24303_c1 nmdc:mga0qj67_24303_c1_2241_3689 468
600 3300050510 nmdc:mga06r32_19290_c1 nmdc:mga06r32_19290_c1_126_1538 468
601 3300050510 nmdc:mga06r32_67596_c1 nmdc:mga06r32_67596_c1_1373_2821 468
602 3300050512 nmdc:mga0n895_233767_c1 nmdc:mga0n895_233767_c1_159_1601 468
603 3300050513 nmdc:mga0rr50_67185_c1 nmdc:mga0rr50_67185_c1_1045_2487 468
604 3300053077 Ga0495601_0080869 Ga0495601_0080869_19_1461 468

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

15

183

0.94

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

185

465

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9334 12 467
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9275 12 467
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9238 11 467
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9219 11 467
7xhl-assembly2.cif.gz_E complex structure of a glucose 6-phosphate dehydrogenase from zymomonas mobilis 0.9212 16 463
ID Description Score Start End Superfamily
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9852 13 173 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9784 13 171 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 13 171 3.40.50.720
af_P0AC53_13_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9446 18 172 3.40.50.720
4lgvC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9393 176 467 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A529SM67-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9867 11 142 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A529UCW2-F1-model_v4 deleted 0.9773 8 166
AF-A0A527G8Q9-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9723 8 101 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A529UCW2-F1-model_v4 deleted 0.9713 8 166
AF-T1B9F9-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase 0.9691 183 342 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Feature Viewer

pLDDT pTM Quality
89.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map