F468388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 604 | 283 | 603 | 471 |
Family's Representative Sequence
| Representative Sequence | 3300025928|Ga0207700_10056817|Ga0207700_100568172 |
| Length | 468 |
| Sequence | MVARAASERAADVLVVFGITGDLARVMTFRSLYRLELHGLLDCPVVGVAVDDWTVEQLRAHARESIDASGETIDEETFARFSARLEYVSGDFADAATFERVAQTVGGARQPVFYLEVPPGLFATVVKGLAQAGLTEKARVVVEKPFGHDLASARALAAELHRYVGEPRLYRIDHFLGKMGLQEFLYLRFANKMLAPIWNRDHIQSVQITLAESFGVEDRGHFYDAVGALRDVVVNHLLQLLAVAAMEPPAAADAHALNAAKEAALRAIPTADAADYTRGQYEGYLAIAGVQPGSTTETYAALRLEIKNERWSGVPFLIRTGKLLPVTQTEVRLVFRHVPRLGFARHSGREPVANQLVVRLDPSTGIRLVVDALRADAAGPEPITLDMEFAEEGGEGATPYELLLHAAMVGDRSLFTDQGLVEESWRIVQPLITSPPPVESYAPGSWGPTGADRLAAAHGGWHDPWLGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 165 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 170 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 173 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.17 |
| Metatranscriptomes | 0.66 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 14.4 |
| Rhizosphere | 84.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10027834 | 3300001990 | Bacteria | 1780 |
| 2 | JGI24744J21845_10001909 | 3300002077 | Bacteria | 4203 |
| 3 | JGI25407J50210_10001726 | 3300003373 | Bacteria | 5012 |
| 4 | Ga0058859_11806834 | 3300004798 | Bacteria | 2723 |
| 5 | Ga0058861_12062177 | 3300004800 | Bacteria | 2119 |
| 6 | Ga0058860_10013857 | 3300004801 | Bacteria | 3578 |
| 7 | Ga0058862_12330200 | 3300004803 | Bacteria | 1593 |
| 8 | Ga0070683_100002616 | 3300005329 | Bacteria | 14404 |
| 9 | Ga0070683_100008404 | 3300005329 | Bacteria | 8764 |
| 10 | Ga0070683_100038966 | 3300005329 | Bacteria | 4359 |
| 11 | Ga0070683_100102853 | 3300005329 | Bacteria | 2691 |
| 12 | Ga0070680_100034742 | 3300005336 | Bacteria | 4066 |
| 13 | Ga0070682_100000922 | 3300005337 | Bacteria | 17137 |
| 14 | Ga0070682_100003904 | 3300005337 | Bacteria | 8276 |
| 15 | Ga0068868_100019168 | 3300005338 | Bacteria | 5125 |
| 16 | Ga0068868_100024499 | 3300005338 | Bacteria | 4580 |
| 17 | Ga0068868_100030301 | 3300005338 | Bacteria | 4148 |
| 18 | Ga0070687_100014361 | 3300005343 | Bacteria | 3557 |
| 19 | Ga0070692_10004815 | 3300005345 | Bacteria | 5674 |
| 20 | Ga0070674_100040772 | 3300005356 | Bacteria | 3143 |
| 21 | Ga0070688_100000700 | 3300005365 | Bacteria | 16543 |
| 22 | Ga0070659_100010230 | 3300005366 | Bacteria | 6897 |
| 23 | Ga0070659_100236295 | 3300005366 | Bacteria | 1511 |
| 24 | Ga0070667_100168084 | 3300005367 | Bacteria | 1935 |
| 25 | Ga0070703_10000259 | 3300005406 | Bacteria | 25582 |
| 26 | Ga0070714_100075236 | 3300005435 | Bacteria | 2930 |
| 27 | Ga0070713_100029881 | 3300005436 | Bacteria | 4321 |
| 28 | Ga0070713_100077838 | 3300005436 | Bacteria | 2821 |
| 29 | Ga0070713_100158618 | 3300005436 | Bacteria | 2018 |
| 30 | Ga0070710_10008309 | 3300005437 | Bacteria | 5052 |
| 31 | Ga0070710_10021121 | 3300005437 | Bacteria | 3388 |
| 32 | Ga0070701_10000968 | 3300005438 | Bacteria | 10385 |
| 33 | Ga0070701_10065219 | 3300005438 | Bacteria | 1932 |
| 34 | Ga0070711_100006754 | 3300005439 | Bacteria | 6944 |
| 35 | Ga0070711_100042685 | 3300005439 | Bacteria | 3067 |
| 36 | Ga0070711_100098629 | 3300005439 | Bacteria | 2121 |
| 37 | Ga0070711_100149002 | 3300005439 | Bacteria | 1762 |
| 38 | Ga0070705_100003497 | 3300005440 | Bacteria | 7688 |
| 39 | Ga0070705_100006314 | 3300005440 | Bacteria | 5806 |
| 40 | Ga0070705_100067331 | 3300005440 | Bacteria | 2151 |
| 41 | Ga0070700_100001110 | 3300005441 | Bacteria | 13330 |
| 42 | Ga0070700_100001301 | 3300005441 | Bacteria | 12417 |
| 43 | Ga0070700_100016865 | 3300005441 | Bacteria | 4166 |
| 44 | Ga0070700_100020813 | 3300005441 | Bacteria | 3807 |
| 45 | Ga0070694_100013740 | 3300005444 | Bacteria | 5061 |
| 46 | Ga0070694_100034679 | 3300005444 | Bacteria | 3329 |
| 47 | Ga0070708_100000272 | 3300005445 | Bacteria | 38532 |
| 48 | Ga0070708_100079894 | 3300005445 | Bacteria | 2959 |
| 49 | Ga0070708_100166452 | 3300005445 | Bacteria | 2056 |
| 50 | Ga0070663_100069555 | 3300005455 | Bacteria | 2558 |
| 51 | Ga0070678_100018179 | 3300005456 | Bacteria | 4552 |
| 52 | Ga0070678_100023705 | 3300005456 | Bacteria | 4095 |
| 53 | Ga0070662_100030526 | 3300005457 | Bacteria | 3773 |
| 54 | Ga0070662_100124053 | 3300005457 | Bacteria | 1983 |
| 55 | Ga0068867_100036542 | 3300005459 | Bacteria | 3566 |
| 56 | Ga0068867_100058556 | 3300005459 | Bacteria | 2855 |
| 57 | Ga0070706_100000748 | 3300005467 | Bacteria | 36445 |
| 58 | Ga0070706_100064581 | 3300005467 | Bacteria | 3383 |
| 59 | Ga0070706_100075424 | 3300005467 | Bacteria | 3121 |
| 60 | Ga0070707_100062761 | 3300005468 | Bacteria | 3565 |
| 61 | Ga0070707_100225827 | 3300005468 | Bacteria | 1823 |
| 62 | Ga0070698_100003904 | 3300005471 | Bacteria | 16391 |
| 63 | Ga0070698_100005947 | 3300005471 | Bacteria | 13308 |
| 64 | Ga0070698_100224338 | 3300005471 | Bacteria | 1812 |
| 65 | Ga0070684_100000934 | 3300005535 | Bacteria | 20769 |
| 66 | Ga0070684_100008843 | 3300005535 | Bacteria | 7897 |
| 67 | Ga0070684_100058880 | 3300005535 | Bacteria | 3358 |
| 68 | Ga0070684_100270414 | 3300005535 | Bacteria | 1556 |
| 69 | Ga0070697_100024427 | 3300005536 | Bacteria | 4810 |
| 70 | Ga0070686_100016752 | 3300005544 | Bacteria | 4268 |
| 71 | Ga0070686_100018071 | 3300005544 | Bacteria | 4132 |
| 72 | Ga0070695_100007621 | 3300005545 | Bacteria | 6413 |
| 73 | Ga0070695_100049578 | 3300005545 | Bacteria | 2688 |
| 74 | Ga0070696_100003346 | 3300005546 | Bacteria | 10698 |
| 75 | Ga0070696_100022246 | 3300005546 | Bacteria | 4306 |
| 76 | Ga0070696_100113211 | 3300005546 | Bacteria | 1956 |
| 77 | Ga0070693_100031479 | 3300005547 | Bacteria | 2907 |
| 78 | Ga0070665_100048464 | 3300005548 | Bacteria | 4266 |
| 79 | Ga0070704_100031249 | 3300005549 | Bacteria | 3580 |
| 80 | Ga0070704_100104785 | 3300005549 | Bacteria | 2140 |
| 81 | Ga0068855_100369070 | 3300005563 | Bacteria | 1578 |
| 82 | Ga0070664_100007619 | 3300005564 | Bacteria | 8742 |
| 83 | Ga0068854_100065873 | 3300005578 | Bacteria | 2635 |
| 84 | Ga0068856_100046759 | 3300005614 | Bacteria | 4262 |
| 85 | Ga0068856_100096974 | 3300005614 | Bacteria | 2937 |
| 86 | Ga0070702_100005021 | 3300005615 | Bacteria | 6111 |
| 87 | Ga0070702_100013413 | 3300005615 | Bacteria | 4137 |
| 88 | Ga0068852_100001464 | 3300005616 | Bacteria | 15962 |
| 89 | Ga0068852_100195178 | 3300005616 | Bacteria | 1913 |
| 90 | Ga0068859_100202381 | 3300005617 | Bacteria | 2070 |
| 91 | Ga0068864_100076047 | 3300005618 | Bacteria | 2932 |
| 92 | Ga0068866_10006694 | 3300005718 | Bacteria | 4805 |
| 93 | Ga0068861_100044390 | 3300005719 | Bacteria | 3342 |
| 94 | Ga0068870_10006802 | 3300005840 | Bacteria | 5068 |
| 95 | Ga0068863_100014867 | 3300005841 | Bacteria | 7478 |
| 96 | Ga0068858_100097274 | 3300005842 | Bacteria | 2744 |
| 97 | Ga0068858_100246738 | 3300005842 | Bacteria | 1695 |
| 98 | Ga0068860_100059877 | 3300005843 | Bacteria | 3619 |
| 99 | Ga0068862_100156509 | 3300005844 | Bacteria | 2032 |
| 100 | Ga0081455_10000980 | 3300005937 | Bacteria | 36344 |
| 101 | Ga0081455_10003455 | 3300005937 | Bacteria | 18167 |
| 102 | Ga0081455_10005954 | 3300005937 | Bacteria | 13226 |
| 103 | Ga0081538_10000062 | 3300005981 | Bacteria | 100500 |
| 104 | Ga0081538_10000847 | 3300005981 | Bacteria | 33018 |
| 105 | Ga0081540_1000540 | 3300005983 | Bacteria | 36618 |
| 106 | Ga0081540_1030296 | 3300005983 | Bacteria | 2999 |
| 107 | Ga0070717_10190518 | 3300006028 | Bacteria | 1792 |
| 108 | Ga0075365_10096834 | 3300006038 | Bacteria | 2017 |
| 109 | Ga0075364_10093860 | 3300006051 | Bacteria | 1993 |
| 110 | Ga0070716_100013307 | 3300006173 | Bacteria | 4191 |
| 111 | Ga0070712_100002845 | 3300006175 | Bacteria | 10710 |
| 112 | Ga0070712_100015031 | 3300006175 | Bacteria | 4977 |
| 113 | Ga0070712_100054420 | 3300006175 | Bacteria | 2798 |
| 114 | Ga0070712_100117613 | 3300006175 | Bacteria | 1995 |
| 115 | Ga0068871_100135396 | 3300006358 | Bacteria | 2092 |
| 116 | Ga0075428_100007225 | 3300006844 | Bacteria | 12300 |
| 117 | Ga0075428_100049929 | 3300006844 | Bacteria | 4589 |
| 118 | Ga0075428_100085615 | 3300006844 | Bacteria | 3437 |
| 119 | Ga0075428_100097314 | 3300006844 | Bacteria | 3209 |
| 120 | Ga0075428_100180126 | 3300006844 | Bacteria | 2288 |
| 121 | Ga0075428_100349758 | 3300006844 | Bacteria | 1586 |
| 122 | Ga0075431_100006337 | 3300006847 | Bacteria | 11754 |
| 123 | Ga0075431_100020673 | 3300006847 | Bacteria | 6727 |
| 124 | Ga0075431_100036816 | 3300006847 | Bacteria | 5040 |
| 125 | Ga0075433_10049425 | 3300006852 | Bacteria | 3659 |
| 126 | Ga0075433_10087300 | 3300006852 | Bacteria | 2755 |
| 127 | Ga0075433_10103918 | 3300006852 | Bacteria | 2517 |
| 128 | Ga0075434_100002264 | 3300006871 | Bacteria | 16846 |
| 129 | Ga0075434_100039046 | 3300006871 | Bacteria | 4704 |
| 130 | Ga0075429_100050633 | 3300006880 | Bacteria | 3614 |
| 131 | Ga0075429_100102200 | 3300006880 | Bacteria | 2502 |
| 132 | Ga0068865_100014889 | 3300006881 | Bacteria | 4950 |
| 133 | Ga0075436_100005258 | 3300006914 | Bacteria | 8909 |
| 134 | Ga0075436_100034563 | 3300006914 | Bacteria | 3486 |
| 135 | Ga0075436_100045497 | 3300006914 | Bacteria | 3027 |
| 136 | Ga0097620_100202389 | 3300006931 | Bacteria | 2070 |
| 137 | Ga0075435_100003744 | 3300007076 | Bacteria | 10363 |
| 138 | Ga0075435_100020408 | 3300007076 | Bacteria | 5077 |
| 139 | Ga0111539_10003555 | 3300009094 | Bacteria | 20558 |
| 140 | Ga0111539_10111706 | 3300009094 | Bacteria | 3206 |
| 141 | Ga0105245_10005198 | 3300009098 | Bacteria | 11427 |
| 142 | Ga0105245_10006274 | 3300009098 | Bacteria | 10460 |
| 143 | Ga0105245_10009183 | 3300009098 | Bacteria | 8619 |
| 144 | Ga0105245_10010142 | 3300009098 | Bacteria | 8203 |
| 145 | Ga0105245_10013270 | 3300009098 | Bacteria | 7179 |
| 146 | Ga0105245_10021666 | 3300009098 | Bacteria | 5641 |
| 147 | Ga0114129_10010204 | 3300009147 | Bacteria | 13392 |
| 148 | Ga0114129_10012002 | 3300009147 | Bacteria | 12321 |
| 149 | Ga0114129_10016756 | 3300009147 | Bacteria | 10434 |
| 150 | Ga0114129_10018480 | 3300009147 | Bacteria | 9927 |
| 151 | Ga0114129_10042748 | 3300009147 | Bacteria | 6378 |
| 152 | Ga0114129_10107725 | 3300009147 | Bacteria | 3848 |
| 153 | Ga0114129_10153814 | 3300009147 | Bacteria | 3147 |
| 154 | Ga0114129_10272063 | 3300009147 | Bacteria | 2266 |
| 155 | Ga0114129_10354723 | 3300009147 | Bacteria | 1942 |
| 156 | Ga0105243_10001866 | 3300009148 | Bacteria | 17995 |
| 157 | Ga0105243_10015249 | 3300009148 | Bacteria | 5814 |
| 158 | Ga0105243_10016670 | 3300009148 | Bacteria | 5554 |
| 159 | Ga0105243_10046606 | 3300009148 | Bacteria | 3411 |
| 160 | Ga0105241_10041134 | 3300009174 | Bacteria | 3491 |
| 161 | Ga0105242_10006965 | 3300009176 | Bacteria | 8727 |
| 162 | Ga0105242_10023934 | 3300009176 | Bacteria | 4819 |
| 163 | Ga0105242_10049642 | 3300009176 | Bacteria | 3415 |
| 164 | Ga0105242_10226523 | 3300009176 | Bacteria | 1673 |
| 165 | Ga0105248_10068764 | 3300009177 | Bacteria | 3976 |
| 166 | Ga0105248_10099181 | 3300009177 | Bacteria | 3282 |
| 167 | Ga0105249_10018944 | 3300009553 | Bacteria | 6135 |
| 168 | Ga0105249_10042558 | 3300009553 | Bacteria | 4132 |
| 169 | Ga0105249_10068062 | 3300009553 | Bacteria | 3283 |
| 170 | Ga0105249_10084325 | 3300009553 | Bacteria | 2959 |
| 171 | Ga0105249_10189468 | 3300009553 | Bacteria | 2007 |
| 172 | Ga0105239_10019008 | 3300010375 | Bacteria | 7592 |
| 173 | Ga0105239_10044923 | 3300010375 | Bacteria | 4842 |
| 174 | Ga0105239_10056306 | 3300010375 | Bacteria | 4314 |
| 175 | Ga0105239_10198543 | 3300010375 | Bacteria | 2247 |
| 176 | Ga0105246_10001142 | 3300011119 | Bacteria | 15397 |
| 177 | Ga0105246_10052289 | 3300011119 | Bacteria | 2808 |
| 178 | Ga0157371_10054053 | 3300013102 | Bacteria | 2852 |
| 179 | Ga0157369_10015138 | 3300013105 | Bacteria | 8705 |
| 180 | Ga0157374_10105932 | 3300013296 | Bacteria | 2701 |
| 181 | Ga0157378_10043906 | 3300013297 | Bacteria | 3968 |
| 182 | Ga0157378_10075488 | 3300013297 | Bacteria | 3035 |
| 183 | Ga0163162_10064702 | 3300013306 | Bacteria | 3702 |
| 184 | Ga0163162_10067125 | 3300013306 | Bacteria | 3637 |
| 185 | Ga0163162_10175168 | 3300013306 | Bacteria | 2270 |
| 186 | Ga0157372_10006104 | 3300013307 | Bacteria | 12802 |
| 187 | Ga0157372_10018570 | 3300013307 | Bacteria | 7480 |
| 188 | Ga0157372_10051403 | 3300013307 | Bacteria | 4586 |
| 189 | Ga0157372_10119454 | 3300013307 | Bacteria | 3026 |
| 190 | Ga0163163_10070955 | 3300014325 | Bacteria | 3470 |
| 191 | Ga0163163_10241164 | 3300014325 | Bacteria | 1857 |
| 192 | Ga0157380_10005445 | 3300014326 | Bacteria | 8897 |
| 193 | Ga0157380_10024436 | 3300014326 | Bacteria | 4574 |
| 194 | Ga0157377_10004218 | 3300014745 | Bacteria | 6581 |
| 195 | Ga0157377_10080487 | 3300014745 | Bacteria | 1903 |
| 196 | Ga0157379_10009161 | 3300014968 | Bacteria | 8623 |
| 197 | Ga0207653_10000003 | 3300025885 | Bacteria | 268014 |
| 198 | Ga0207653_10007668 | 3300025885 | Bacteria | 3367 |
| 199 | Ga0207682_10051995 | 3300025893 | Bacteria | 1697 |
| 200 | Ga0207692_10010534 | 3300025898 | Bacteria | 3901 |
| 201 | Ga0207642_10001835 | 3300025899 | Bacteria | 6565 |
| 202 | Ga0207688_10007719 | 3300025901 | Bacteria | 5860 |
| 203 | Ga0207647_10036296 | 3300025904 | Bacteria | 3133 |
| 204 | Ga0207699_10095749 | 3300025906 | Bacteria | 1873 |
| 205 | Ga0207643_10001011 | 3300025908 | Bacteria | 16746 |
| 206 | Ga0207643_10013515 | 3300025908 | Bacteria | 4423 |
| 207 | Ga0207643_10015154 | 3300025908 | Bacteria | 4194 |
| 208 | Ga0207684_10000532 | 3300025910 | Bacteria | 47160 |
| 209 | Ga0207684_10043464 | 3300025910 | Bacteria | 3810 |
| 210 | Ga0207693_10003883 | 3300025915 | Bacteria | 12729 |
| 211 | Ga0207693_10005452 | 3300025915 | Bacteria | 10609 |
| 212 | Ga0207693_10021227 | 3300025915 | Bacteria | 5161 |
| 213 | Ga0207693_10044071 | 3300025915 | Bacteria | 3506 |
| 214 | Ga0207693_10142012 | 3300025915 | Bacteria | 1888 |
| 215 | Ga0207662_10010190 | 3300025918 | Bacteria | 5182 |
| 216 | Ga0207652_10181876 | 3300025921 | Bacteria | 1889 |
| 217 | Ga0207646_10021867 | 3300025922 | Bacteria | 5902 |
| 218 | Ga0207681_10013066 | 3300025923 | Bacteria | 5134 |
| 219 | Ga0207687_10002598 | 3300025927 | Bacteria | 12258 |
| 220 | Ga0207687_10006277 | 3300025927 | Bacteria | 7865 |
| 221 | Ga0207687_10036213 | 3300025927 | Bacteria | 3361 |
| 222 | Ga0207687_10065891 | 3300025927 | Bacteria | 2573 |
| 223 | Ga0207700_10056817 | 3300025928 | Bacteria | 2948 |
| 224 | Ga0207664_10015828 | 3300025929 | Bacteria | 5489 |
| 225 | Ga0207664_10081558 | 3300025929 | Bacteria | 2632 |
| 226 | Ga0207690_10021396 | 3300025932 | Bacteria | 4010 |
| 227 | Ga0207706_10021778 | 3300025933 | Bacteria | 5753 |
| 228 | Ga0207706_10063494 | 3300025933 | Bacteria | 3251 |
| 229 | Ga0207686_10080045 | 3300025934 | Bacteria | 2129 |
| 230 | Ga0207709_10034955 | 3300025935 | Bacteria | 2967 |
| 231 | Ga0207709_10104129 | 3300025935 | Bacteria | 1883 |
| 232 | Ga0207665_10000419 | 3300025939 | Bacteria | 29265 |
| 233 | Ga0207665_10013259 | 3300025939 | Bacteria | 5419 |
| 234 | Ga0207665_10084376 | 3300025939 | Bacteria | 2192 |
| 235 | Ga0207665_10092677 | 3300025939 | Bacteria | 2096 |
| 236 | Ga0207691_10004435 | 3300025940 | Bacteria | 13605 |
| 237 | Ga0207691_10183172 | 3300025940 | Bacteria | 1829 |
| 238 | Ga0207711_10111273 | 3300025941 | Bacteria | 2436 |
| 239 | Ga0207711_10204119 | 3300025941 | Bacteria | 1804 |
| 240 | Ga0207661_10002247 | 3300025944 | Bacteria | 13322 |
| 241 | Ga0207661_10086028 | 3300025944 | Bacteria | 2608 |
| 242 | Ga0207679_10050912 | 3300025945 | Bacteria | 3029 |
| 243 | Ga0207679_10083259 | 3300025945 | Bacteria | 2452 |
| 244 | Ga0207651_10058821 | 3300025960 | Bacteria | 2658 |
| 245 | Ga0207712_10089745 | 3300025961 | Bacteria | 2260 |
| 246 | Ga0207668_10113477 | 3300025972 | Bacteria | 2038 |
| 247 | Ga0207640_10045925 | 3300025981 | Bacteria | 2808 |
| 248 | Ga0207640_10115995 | 3300025981 | Bacteria | 1908 |
| 249 | Ga0207677_10012441 | 3300026023 | Bacteria | 4892 |
| 250 | Ga0207677_10033195 | 3300026023 | Bacteria | 3327 |
| 251 | Ga0207677_10066813 | 3300026023 | Bacteria | 2516 |
| 252 | Ga0207677_10069161 | 3300026023 | Bacteria | 2482 |
| 253 | Ga0207703_10125930 | 3300026035 | Bacteria | 2206 |
| 254 | Ga0207703_10188417 | 3300026035 | Bacteria | 1825 |
| 255 | Ga0207678_10160177 | 3300026067 | Bacteria | 1922 |
| 256 | Ga0207708_10000064 | 3300026075 | Bacteria | 85366 |
| 257 | Ga0207708_10000259 | 3300026075 | Bacteria | 41740 |
| 258 | Ga0207708_10012633 | 3300026075 | Bacteria | 6298 |
| 259 | Ga0207708_10020262 | 3300026075 | Bacteria | 5016 |
| 260 | Ga0207702_10048456 | 3300026078 | Bacteria | 3583 |
| 261 | Ga0207641_10240858 | 3300026088 | Bacteria | 1685 |
| 262 | Ga0207648_10008677 | 3300026089 | Bacteria | 9807 |
| 263 | Ga0207648_10010820 | 3300026089 | Bacteria | 8622 |
| 264 | Ga0207648_10101824 | 3300026089 | Bacteria | 2517 |
| 265 | Ga0207674_10048408 | 3300026116 | Bacteria | 4351 |
| 266 | Ga0207674_10124922 | 3300026116 | Bacteria | 2539 |
| 267 | Ga0207675_100013425 | 3300026118 | Bacteria | 7643 |
| 268 | Ga0207675_100018419 | 3300026118 | Bacteria | 6510 |
| 269 | Ga0207675_100021458 | 3300026118 | Bacteria | 6015 |
| 270 | Ga0207675_100035597 | 3300026118 | Bacteria | 4644 |
| 271 | Ga0207675_100038375 | 3300026118 | Bacteria | 4470 |
| 272 | Ga0207675_100067930 | 3300026118 | Bacteria | 3332 |
| 273 | Ga0207675_100091500 | 3300026118 | Bacteria | 2860 |
| 274 | Ga0207675_100151845 | 3300026118 | Bacteria | 2205 |
| 275 | Ga0207683_10008620 | 3300026121 | Bacteria | 8720 |
| 276 | Ga0207683_10010485 | 3300026121 | Bacteria | 7907 |
| 277 | Ga0207683_10021098 | 3300026121 | Bacteria | 5575 |
| 278 | Ga0207683_10030331 | 3300026121 | Bacteria | 4685 |
| 279 | Ga0207683_10102920 | 3300026121 | Bacteria | 2550 |
| 280 | Ga0207428_10004538 | 3300027907 | Bacteria | 13165 |
| 281 | Ga0207428_10006489 | 3300027907 | Bacteria | 10798 |
| 282 | Ga0207428_10012111 | 3300027907 | Bacteria | 7589 |
| 283 | Ga0207428_10032418 | 3300027907 | Bacteria | 4298 |
| 284 | Ga0207428_10039599 | 3300027907 | Bacteria | 3828 |
| 285 | Ga0268265_10174404 | 3300028380 | Bacteria | 1841 |
| 286 | Ga0268264_10187770 | 3300028381 | Bacteria | 1882 |
| 287 | Ga0265327_10023218 | 3300031251 | Bacteria | 3678 |
| 288 | Ga0307408_100051109 | 3300031548 | Bacteria | 2976 |
| 289 | Ga0307413_10161631 | 3300031824 | Bacteria | 1574 |
| 290 | Ga0307410_10002617 | 3300031852 | Bacteria | 8759 |
| 291 | Ga0307412_10051655 | 3300031911 | Bacteria | 2718 |
| 292 | Ga0307409_100001632 | 3300031995 | Bacteria | 11223 |
| 293 | Ga0307409_100043090 | 3300031995 | Bacteria | 3385 |
| 294 | Ga0307416_100088031 | 3300032002 | Bacteria | 2654 |
| 295 | Ga0307411_10003083 | 3300032005 | Bacteria | 7622 |
| 296 | Ga0307415_100007945 | 3300032126 | Bacteria | 5842 |
| 297 | Ga0307415_100023353 | 3300032126 | Bacteria | 3837 |
| 298 | Ga0373952_0001878 | 3300035092 | Bacteria | 3817 |
| 299 | Ga0373956_0089201 | 3300035119 | Bacteria | 1421 |
| 300 | Ga0373960_0007553 | 3300035121 | Bacteria | 2581 |
| 301 | Ga0373943_0005394 | 3300035170 | Bacteria | 5753 |
| 302 | Ga0373946_0008525 | 3300035171 | Bacteria | 3763 |
| 303 | Ga0373942_0011702 | 3300035207 | Bacteria | 2084 |
| 304 | Ga0373931_0027344 | 3300035691 | Bacteria | 2911 |
| 305 | Ga0373933_0043663 | 3300035724 | Bacteria | 2653 |
| 306 | Ga0373947_0001059 | 3300035725 | Bacteria | 16809 |
| 307 | Ga0373947_0002802 | 3300035725 | Bacteria | 10419 |
| 308 | Ga0373937_0078631 | 3300036401 | Bacteria | 3048 |
| 309 | Ga0373925_0005324 | 3300037068 | Bacteria | 9604 |
| 310 | Ga0395899_0001680 | 3300037312 | Bacteria | 18454 |
| 311 | Ga0395899_0005777 | 3300037312 | Bacteria | 9604 |
| 312 | Ga0395900_0005212 | 3300037418 | Bacteria | 13633 |
| 313 | Ga0395900_0011716 | 3300037418 | Bacteria | 8965 |
| 314 | Ga0395900_0012939 | 3300037418 | Bacteria | 8524 |
| 315 | Ga0395900_0020195 | 3300037418 | Bacteria | 6797 |
| 316 | Ga0395900_0041261 | 3300037418 | Bacteria | 4757 |
| 317 | Ga0395900_0072400 | 3300037418 | Bacteria | 3543 |
| 318 | Ga0395900_0105559 | 3300037418 | Bacteria | 2894 |
| 319 | Ga0395898_0001644 | 3300037466 | Bacteria | 30233 |
| 320 | Ga0395898_0004563 | 3300037466 | Bacteria | 15114 |
| 321 | Ga0395898_0006011 | 3300037466 | Bacteria | 13034 |
| 322 | Ga0395898_0023058 | 3300037466 | Bacteria | 6294 |
| 323 | Ga0395898_0033832 | 3300037466 | Bacteria | 5097 |
| 324 | Ga0395898_0070903 | 3300037466 | Bacteria | 3368 |
| 325 | Ga0395898_0081982 | 3300037466 | Bacteria | 3110 |
| 326 | Ga0395898_0098701 | 3300037466 | Bacteria | 2804 |
| 327 | Ga0395905_0002213 | 3300037471 | Bacteria | 21946 |
| 328 | Ga0395905_0005590 | 3300037471 | Bacteria | 12806 |
| 329 | Ga0395905_0010756 | 3300037471 | Bacteria | 8871 |
| 330 | Ga0395905_0015079 | 3300037471 | Bacteria | 7359 |
| 331 | Ga0395905_0089127 | 3300037471 | Bacteria | 2891 |
| 332 | Ga0395905_0183932 | 3300037471 | Bacteria | 1962 |
| 333 | Ga0395905_0264441 | 3300037471 | Bacteria | 1605 |
| 334 | Ga0395901_0001203 | 3300038443 | Bacteria | 27494 |
| 335 | Ga0395901_0025938 | 3300038443 | Bacteria | 6018 |
| 336 | Ga0395901_0136926 | 3300038443 | Bacteria | 2573 |
| 337 | Ga0395901_0272771 | 3300038443 | Bacteria | 1759 |
| 338 | Ga0451787_260720 | 3300041441 | Bacteria | 1417 |
| 339 | Ga0451800_0526498 | 3300041459 | Bacteria | 4689 |
| 340 | Ga0451802_1676736 | 3300041460 | Bacteria | 7404 |
| 341 | Ga0451804_0502473 | 3300041463 | Bacteria | 5101 |
| 342 | Ga0451839_0806449 | 3300041496 | Bacteria | 4657 |
| 343 | Ga0451849_0147738 | 3300041505 | Bacteria | 2888 |
| 344 | Ga0439448_0004060 | 3300042005 | Bacteria | 4113 |
| 345 | Ga0439450_002177 | 3300042008 | Bacteria | 3034 |
| 346 | Ga0439450_012201 | 3300042008 | Bacteria | 1701 |
| 347 | Ga0451576_0035206 | 3300045051 | Bacteria | 5313 |
| 348 | Ga0451576_0057717 | 3300045051 | Bacteria | 4058 |
| 349 | Ga0466967_0129069 | 3300045976 | Bacteria | 2345 |
| 350 | Ga0495592_0030033 | 3300046454 | Bacteria | 4111 |
| 351 | Ga0495603_0007045 | 3300046455 | Bacteria | 6745 |
| 352 | Ga0495629_0011412 | 3300046459 | Bacteria | 6454 |
| 353 | Ga0495641_0003896 | 3300046461 | Bacteria | 10855 |
| 354 | Ga0495641_0023573 | 3300046461 | Bacteria | 3054 |
| 355 | Ga0495651_0057667 | 3300046462 | Bacteria | 2981 |
| 356 | Ga0495651_0092432 | 3300046462 | Bacteria | 2266 |
| 357 | Ga0495653_0044155 | 3300046463 | Bacteria | 3460 |
| 358 | Ga0495653_0053280 | 3300046463 | Bacteria | 3096 |
| 359 | Ga0495653_0084856 | 3300046463 | Bacteria | 2331 |
| 360 | Ga0495662_0035839 | 3300046476 | Bacteria | 2395 |
| 361 | Ga0495664_0080907 | 3300046477 | Bacteria | 1947 |
| 362 | Ga0495584_0006077 | 3300046491 | Bacteria | 6356 |
| 363 | Ga0495584_0006163 | 3300046491 | Bacteria | 6305 |
| 364 | Ga0495584_0040481 | 3300046491 | Bacteria | 2353 |
| 365 | Ga0495585_0047599 | 3300046492 | Bacteria | 2388 |
| 366 | Ga0495594_0001378 | 3300046499 | Bacteria | 12614 |
| 367 | Ga0495608_0008685 | 3300046511 | Bacteria | 7108 |
| 368 | Ga0495608_0035213 | 3300046511 | Bacteria | 3378 |
| 369 | Ga0495608_0038690 | 3300046511 | Bacteria | 3201 |
| 370 | Ga0495608_0047780 | 3300046511 | Bacteria | 2844 |
| 371 | Ga0495618_0048850 | 3300046514 | Bacteria | 2672 |
| 372 | Ga0495628_0015666 | 3300046516 | Bacteria | 6330 |
| 373 | Ga0495628_0018415 | 3300046516 | Bacteria | 5785 |
| 374 | Ga0495628_0056164 | 3300046516 | Bacteria | 3100 |
| 375 | Ga0495630_0003282 | 3300046517 | Bacteria | 11286 |
| 376 | Ga0495630_0057738 | 3300046517 | Bacteria | 2909 |
| 377 | Ga0495630_0191922 | 3300046517 | Bacteria | 1558 |
| 378 | Ga0495644_0001704 | 3300046523 | Bacteria | 8906 |
| 379 | Ga0495644_0014566 | 3300046523 | Bacteria | 3011 |
| 380 | Ga0495652_0049663 | 3300046529 | Bacteria | 3590 |
| 381 | Ga0495640_0002482 | 3300046533 | Bacteria | 14838 |
| 382 | Ga0495640_0080016 | 3300046533 | Bacteria | 2174 |
| 383 | Ga0495587_0038368 | 3300046536 | Bacteria | 2873 |
| 384 | Ga0495587_0065952 | 3300046536 | Bacteria | 2113 |
| 385 | Ga0495598_0002093 | 3300046537 | Bacteria | 4069 |
| 386 | Ga0495609_0055001 | 3300046538 | Bacteria | 1766 |
| 387 | Ga0495621_0024833 | 3300046539 | Bacteria | 2006 |
| 388 | Ga0495667_0006175 | 3300046559 | Bacteria | 8119 |
| 389 | Ga0495667_0027049 | 3300046559 | Bacteria | 3866 |
| 390 | Ga0495656_0000888 | 3300046615 | Bacteria | 9672 |
| 391 | Ga0495656_0021283 | 3300046615 | Bacteria | 2523 |
| 392 | Ga0495656_0031347 | 3300046615 | Bacteria | 2156 |
| 393 | Ga0495634_0038581 | 3300046642 | Bacteria | 3256 |
| 394 | Ga0495634_0039578 | 3300046642 | Bacteria | 3210 |
| 395 | Ga0495635_0010227 | 3300046663 | Bacteria | 6560 |
| 396 | Ga0495659_0003655 | 3300046664 | Bacteria | 4891 |
| 397 | Ga0495588_0007629 | 3300046674 | Bacteria | 4938 |
| 398 | Ga0495657_0008126 | 3300046675 | Bacteria | 8045 |
| 399 | Ga0495657_0018225 | 3300046675 | Bacteria | 5086 |
| 400 | Ga0495657_0020351 | 3300046675 | Bacteria | 4771 |
| 401 | Ga0495657_0039184 | 3300046675 | Bacteria | 3258 |
| 402 | Ga0495599_0039657 | 3300046678 | Bacteria | 2959 |
| 403 | Ga0495599_0108550 | 3300046678 | Bacteria | 1729 |
| 404 | Ga0495623_0061675 | 3300046679 | Bacteria | 2351 |
| 405 | Ga0495646_0021681 | 3300046680 | Bacteria | 4058 |
| 406 | Ga0495646_0054169 | 3300046680 | Bacteria | 2414 |
| 407 | Ga0495647_0023507 | 3300046681 | Bacteria | 2235 |
| 408 | Ga0495658_0016944 | 3300046683 | Bacteria | 3756 |
| 409 | Ga0495613_0012413 | 3300046689 | Bacteria | 6329 |
| 410 | Ga0495613_0048964 | 3300046689 | Bacteria | 3120 |
| 411 | Ga0495670_0002377 | 3300046691 | Bacteria | 9262 |
| 412 | Ga0495600_0012431 | 3300046809 | Bacteria | 5323 |
| 413 | Ga0495581_0007725 | 3300047315 | Bacteria | 6222 |
| 414 | Ga0495604_0005834 | 3300047317 | Bacteria | 9761 |
| 415 | Ga0495604_0016344 | 3300047317 | Bacteria | 5931 |
| 416 | Ga0495604_0136498 | 3300047317 | Bacteria | 1757 |
| 417 | Ga0495636_0018748 | 3300047318 | Bacteria | 2776 |
| 418 | Ga0495674_0000584 | 3300047319 | Bacteria | 34100 |
| 419 | Ga0495674_0068147 | 3300047319 | Bacteria | 3080 |
| 420 | Ga0495674_0081148 | 3300047319 | Bacteria | 2782 |
| 421 | Ga0495674_0098119 | 3300047319 | Bacteria | 2495 |
| 422 | Ga0495676_0013494 | 3300047321 | Bacteria | 7342 |
| 423 | Ga0495676_0124482 | 3300047321 | Bacteria | 1870 |
| 424 | Ga0495680_0000204 | 3300047322 | Bacteria | 64223 |
| 425 | Ga0495680_0001834 | 3300047322 | Bacteria | 22404 |
| 426 | Ga0495680_0009074 | 3300047322 | Bacteria | 8979 |
| 427 | Ga0495680_0016323 | 3300047322 | Bacteria | 6385 |
| 428 | Ga0495680_0017050 | 3300047322 | Bacteria | 6216 |
| 429 | Ga0495675_0025314 | 3300047444 | Bacteria | 3784 |
| 430 | Ga0495684_0000755 | 3300047471 | Bacteria | 26085 |
| 431 | Ga0495684_0018185 | 3300047471 | Bacteria | 5416 |
| 432 | Ga0495684_0069136 | 3300047471 | Bacteria | 2685 |
| 433 | Ga0495684_0090020 | 3300047471 | Bacteria | 2325 |
| 434 | Ga0495602_0012596 | 3300048088 | Bacteria | 8678 |
| 435 | Ga0495602_0106999 | 3300048088 | Bacteria | 2281 |
| 436 | Ga0496100_0114016 | 3300048903 | Bacteria | 1882 |
| 437 | Ga0496100_0130376 | 3300048903 | Bacteria | 1770 |
| 438 | Ga0496100_0194355 | 3300048903 | Bacteria | 1475 |
| 439 | Ga0496101_0006168 | 3300048904 | Bacteria | 7702 |
| 440 | Ga0496101_0032909 | 3300048904 | Bacteria | 3653 |
| 441 | Ga0496101_0051053 | 3300048904 | Bacteria | 2979 |
| 442 | Ga0496101_0094304 | 3300048904 | Bacteria | 2230 |
| 443 | Ga0496102_0005830 | 3300048905 | Bacteria | 10478 |
| 444 | Ga0496102_0006206 | 3300048905 | Bacteria | 10183 |
| 445 | Ga0496102_0024331 | 3300048905 | Bacteria | 5383 |
| 446 | Ga0496102_0035034 | 3300048905 | Bacteria | 4517 |
| 447 | Ga0496102_0037892 | 3300048905 | Bacteria | 4349 |
| 448 | Ga0496102_0151376 | 3300048905 | Bacteria | 2180 |
| 449 | Ga0496102_0280382 | 3300048905 | Bacteria | 1571 |
| 450 | Ga0496103_0007006 | 3300048906 | Bacteria | 6726 |
| 451 | Ga0496103_0016633 | 3300048906 | Bacteria | 4391 |
| 452 | Ga0496103_0022573 | 3300048906 | Bacteria | 3790 |
| 453 | Ga0496103_0023544 | 3300048906 | Bacteria | 3715 |
| 454 | Ga0496104_0000471 | 3300048907 | Bacteria | 34675 |
| 455 | Ga0496104_0031233 | 3300048907 | Bacteria | 4952 |
| 456 | Ga0496104_0060599 | 3300048907 | Bacteria | 3585 |
| 457 | Ga0496104_0076539 | 3300048907 | Bacteria | 3187 |
| 458 | Ga0496104_0088361 | 3300048907 | Bacteria | 2960 |
| 459 | Ga0496104_0167687 | 3300048907 | Bacteria | 2105 |
| 460 | Ga0496105_0000792 | 3300048908 | Bacteria | 21415 |
| 461 | Ga0496105_0000996 | 3300048908 | Bacteria | 19557 |
| 462 | Ga0496105_0002314 | 3300048908 | Bacteria | 13812 |
| 463 | Ga0496105_0005624 | 3300048908 | Bacteria | 9534 |
| 464 | Ga0496105_0196588 | 3300048908 | Bacteria | 1647 |
| 465 | Ga0496106_0000729 | 3300048909 | Bacteria | 23698 |
| 466 | Ga0496106_0015306 | 3300048909 | Bacteria | 5674 |
| 467 | Ga0496106_0024196 | 3300048909 | Bacteria | 4513 |
| 468 | Ga0496106_0028618 | 3300048909 | Bacteria | 4151 |
| 469 | Ga0496106_0029137 | 3300048909 | Bacteria | 4113 |
| 470 | Ga0496107_0008594 | 3300048910 | Bacteria | 7069 |
| 471 | Ga0496107_0070601 | 3300048910 | Bacteria | 2536 |
| 472 | Ga0496107_0110966 | 3300048910 | Bacteria | 2016 |
| 473 | Ga0496108_0001390 | 3300048911 | Bacteria | 19045 |
| 474 | Ga0496108_0002323 | 3300048911 | Bacteria | 15222 |
| 475 | Ga0496108_0002863 | 3300048911 | Bacteria | 13852 |
| 476 | Ga0496108_0019663 | 3300048911 | Bacteria | 5547 |
| 477 | Ga0496108_0026152 | 3300048911 | Bacteria | 4813 |
| 478 | Ga0496108_0104566 | 3300048911 | Bacteria | 2416 |
| 479 | Ga0496109_0004914 | 3300048912 | Bacteria | 11156 |
| 480 | Ga0496109_0008075 | 3300048912 | Bacteria | 8922 |
| 481 | Ga0496109_0008388 | 3300048912 | Bacteria | 8782 |
| 482 | Ga0496109_0011153 | 3300048912 | Bacteria | 7709 |
| 483 | Ga0496109_0022223 | 3300048912 | Bacteria | 5616 |
| 484 | Ga0496109_0024760 | 3300048912 | Bacteria | 5339 |
| 485 | Ga0496109_0030328 | 3300048912 | Bacteria | 4848 |
| 486 | Ga0496109_0050593 | 3300048912 | Bacteria | 3783 |
| 487 | Ga0496109_0078594 | 3300048912 | Bacteria | 3038 |
| 488 | Ga0496109_0088968 | 3300048912 | Bacteria | 2854 |
| 489 | Ga0496110_0002619 | 3300048913 | Bacteria | 13540 |
| 490 | Ga0496110_0004397 | 3300048913 | Bacteria | 10913 |
| 491 | Ga0496110_0005696 | 3300048913 | Bacteria | 9784 |
| 492 | Ga0496110_0030512 | 3300048913 | Bacteria | 4648 |
| 493 | Ga0496111_0002096 | 3300048914 | Bacteria | 11900 |
| 494 | Ga0496111_0002846 | 3300048914 | Bacteria | 10558 |
| 495 | Ga0496111_0006246 | 3300048914 | Bacteria | 7723 |
| 496 | Ga0496111_0014642 | 3300048914 | Bacteria | 5363 |
| 497 | Ga0496111_0014711 | 3300048914 | Bacteria | 5352 |
| 498 | Ga0496112_0000082 | 3300048915 | Bacteria | 62404 |
| 499 | Ga0496112_0000998 | 3300048915 | Bacteria | 20731 |
| 500 | Ga0496112_0016933 | 3300048915 | Bacteria | 6840 |
| 501 | Ga0496112_0045604 | 3300048915 | Bacteria | 4297 |
| 502 | Ga0496112_0059486 | 3300048915 | Bacteria | 3765 |
| 503 | Ga0496112_0064683 | 3300048915 | Bacteria | 3609 |
| 504 | Ga0496112_0087457 | 3300048915 | Bacteria | 3083 |
| 505 | Ga0496113_0000069 | 3300048916 | Bacteria | 45043 |
| 506 | Ga0496113_0002742 | 3300048916 | Bacteria | 10355 |
| 507 | Ga0496113_0013024 | 3300048916 | Bacteria | 5613 |
| 508 | Ga0496113_0022407 | 3300048916 | Bacteria | 4467 |
| 509 | Ga0496113_0043752 | 3300048916 | Bacteria | 3315 |
| 510 | Ga0496113_0083225 | 3300048916 | Bacteria | 2455 |
| 511 | Ga0496113_0094731 | 3300048916 | Bacteria | 2307 |
| 512 | Ga0496114_0001305 | 3300048917 | Bacteria | 18876 |
| 513 | Ga0496114_0004201 | 3300048917 | Bacteria | 11159 |
| 514 | Ga0496114_0005625 | 3300048917 | Bacteria | 9833 |
| 515 | Ga0496114_0061597 | 3300048917 | Bacteria | 3139 |
| 516 | Ga0496115_0011197 | 3300048918 | Bacteria | 6717 |
| 517 | Ga0496115_0012161 | 3300048918 | Bacteria | 6472 |
| 518 | Ga0496115_0089416 | 3300048918 | Bacteria | 2515 |
| 519 | Ga0501031_0001154 | 3300049568 | Bacteria | 16098 |
| 520 | Ga0501032_0000274 | 3300049569 | Bacteria | 43406 |
| 521 | Ga0501033_0000629 | 3300049570 | Bacteria | 32631 |
| 522 | Ga0501036_0000296 | 3300049572 | Bacteria | 34579 |
| 523 | Ga0501037_0000379 | 3300049573 | Bacteria | 36982 |
| 524 | Ga0501038_0000186 | 3300049574 | Bacteria | 53569 |
| 525 | Ga0501039_0000141 | 3300049575 | Bacteria | 49210 |
| 526 | Ga0501039_0077885 | 3300049575 | Bacteria | 2578 |
| 527 | Ga0501040_0000360 | 3300049576 | Bacteria | 26851 |
| 528 | Ga0501041_0000039 | 3300049577 | Bacteria | 44027 |
| 529 | Ga0501042_0000670 | 3300049578 | Bacteria | 18434 |
| 530 | Ga0501043_0000171 | 3300049579 | Bacteria | 58361 |
| 531 | Ga0501046_0000177 | 3300049580 | Bacteria | 65024 |
| 532 | Ga0501047_0000481 | 3300049581 | Bacteria | 43439 |
| 533 | Ga0501048_0001307 | 3300049582 | Bacteria | 18874 |
| 534 | Ga0501069_0004399 | 3300049585 | Bacteria | 7277 |
| 535 | Ga0501070_0001532 | 3300049586 | Bacteria | 20564 |
| 536 | Ga0501071_0000494 | 3300049587 | Bacteria | 19967 |
| 537 | Ga0501071_0002667 | 3300049587 | Bacteria | 10929 |
| 538 | Ga0501072_0002097 | 3300049588 | Bacteria | 14852 |
| 539 | Ga0501072_0055287 | 3300049588 | Bacteria | 3128 |
| 540 | Ga0501073_0000337 | 3300049589 | Bacteria | 31624 |
| 541 | Ga0501074_0000054 | 3300049590 | Bacteria | 55953 |
| 542 | Ga0501075_0001678 | 3300049591 | Bacteria | 14518 |
| 543 | Ga0501076_0000484 | 3300049592 | Bacteria | 25088 |
| 544 | Ga0501077_0000419 | 3300049593 | Bacteria | 25710 |
| 545 | Ga0501077_0009346 | 3300049593 | Bacteria | 6088 |
| 546 | Ga0501079_0000108 | 3300049741 | Bacteria | 42571 |
| 547 | Ga0501080_0000301 | 3300049742 | Bacteria | 37557 |
| 548 | Ga0501080_0076516 | 3300049742 | Bacteria | 3112 |
| 549 | Ga0501081_0000758 | 3300049743 | Bacteria | 18903 |
| 550 | Ga0501083_0000797 | 3300049744 | Bacteria | 20656 |
| 551 | Ga0501035_0000457 | 3300049822 | Bacteria | 45780 |
| 552 | Ga0501044_0003357 | 3300049823 | Bacteria | 18050 |
| 553 | Ga0501045_0000050 | 3300049824 | Bacteria | 51884 |
| 554 | nmdc:mga03683_17990_c1 | 3300050489 | Bacteria | 2681 |
| 555 | nmdc:mga00v17_77099_c1 | 3300050491 | Bacteria | 2075 |
| 556 | nmdc:mga05p37_24157_c1 | 3300050507 | Bacteria | 7384 |
| 557 | nmdc:mga05p37_24475_c1 | 3300050507 | Bacteria | 7339 |
| 558 | nmdc:mga05p37_259523_c1 | 3300050507 | Bacteria | 2080 |
| 559 | nmdc:mga05p37_36144_c1 | 3300050507 | Bacteria | 6061 |
| 560 | nmdc:mga05p37_37201_c1 | 3300050507 | Bacteria | 5969 |
| 561 | nmdc:mga05p37_88328_c1 | 3300050507 | Bacteria | 3821 |
| 562 | nmdc:mga05p37_98278_c1 | 3300050507 | Bacteria | 3606 |
| 563 | nmdc:mga09592_193761_c1 | 3300050508 | Bacteria | 1759 |
| 564 | nmdc:mga09592_19783_c1 | 3300050508 | Bacteria | 5530 |
| 565 | nmdc:mga09592_78386_c1 | 3300050508 | Bacteria | 2812 |
| 566 | nmdc:mga0qj67_24303_c1 | 3300050509 | Bacteria | 4670 |
| 567 | nmdc:mga0qj67_99105_c1 | 3300050509 | Bacteria | 2348 |
| 568 | nmdc:mga06r32_19290_c1 | 3300050510 | Bacteria | 6258 |
| 569 | nmdc:mga06r32_25580_c1 | 3300050510 | Bacteria | 5492 |
| 570 | nmdc:mga06r32_29088_c1 | 3300050510 | Bacteria | 5176 |
| 571 | nmdc:mga06r32_67596_c1 | 3300050510 | Bacteria | 3451 |
| 572 | nmdc:mga08y16_11751_c1 | 3300050511 | Bacteria | 9198 |
| 573 | nmdc:mga08y16_2685_c1 | 3300050511 | Bacteria | 18270 |
| 574 | nmdc:mga08y16_35406_c1 | 3300050511 | Bacteria | 5243 |
| 575 | nmdc:mga08y16_70585_c1 | 3300050511 | Bacteria | 3641 |
| 576 | nmdc:mga08y16_7262_c1 | 3300050511 | Bacteria | 11630 |
| 577 | nmdc:mga0n895_131460_c1 | 3300050512 | Bacteria | 2528 |
| 578 | nmdc:mga0n895_233767_c1 | 3300050512 | Bacteria | 1866 |
| 579 | nmdc:mga0n895_26924_c1 | 3300050512 | Bacteria | 5455 |
| 580 | nmdc:mga0rr50_139407_c1 | 3300050513 | Bacteria | 1950 |
| 581 | nmdc:mga0rr50_42319_c1 | 3300050513 | Bacteria | 3326 |
| 582 | nmdc:mga0rr50_44464_c1 | 3300050513 | Bacteria | 3258 |
| 583 | nmdc:mga0rr50_67185_c1 | 3300050513 | Bacteria | 2723 |
| 584 | nmdc:mga08x19_131330_c1 | 3300050514 | Bacteria | 1685 |
| 585 | nmdc:mga08x19_44688_c1 | 3300050514 | Bacteria | 2829 |
| 586 | nmdc:mga0a205_1136_c1 | 3300050515 | Bacteria | 22088 |
| 587 | nmdc:mga0a205_14308_c1 | 3300050515 | Bacteria | 7399 |
| 588 | nmdc:mga0a205_16745_c1 | 3300050515 | Bacteria | 6864 |
| 589 | nmdc:mga0a205_185239_c1 | 3300050515 | Bacteria | 1975 |
| 590 | nmdc:mga0a205_287301_c1 | 3300050515 | Bacteria | 1520 |
| 591 | nmdc:mga0a205_94727_c1 | 3300050515 | Bacteria | 2885 |
| 592 | nmdc:mga0a205_98409_c1 | 3300050515 | Bacteria | 2824 |
| 593 | nmdc:mga0a205_99045_c1 | 3300050515 | Bacteria | 2814 |
| 594 | Ga0495601_0080869 | 3300053077 | Bacteria | 2085 |
| 595 | Ga0495601_0094329 | 3300053077 | Bacteria | 1928 |
| 596 | Ga0495595_0007185 | 3300053084 | Bacteria | 4551 |
| 597 | Ga0495595_0034318 | 3300053084 | Bacteria | 2294 |
| 598 | Ga0495619_0002088 | 3300053085 | Bacteria | 13277 |
| 599 | Ga0495619_0008348 | 3300053085 | Bacteria | 6548 |
| 600 | Ga0501084_0002699 | 3300054114 | Bacteria | 14290 |
| 601 | Ga0501082_0001712 | 3300060353 | Bacteria | 19340 |
| 602 | Ga0530510_0000188 | 3300061734 | Bacteria | 37875 |
| 603 | Ga0530510_0017691 | 3300061734 | Bacteria | 5051 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_10161631 | Ga0307413_101616312 | 407 |
| 2 | 3300041459 | Ga0451800_0526498 | Ga0451800_0526498_3387_4643 | 417 |
| 3 | 3300035092 | Ga0373952_0001878 | Ga0373952_0001878_15_1283 | 421 |
| 4 | 3300050514 | nmdc:mga08x19_131330_c1 | nmdc:mga08x19_131330_c1_291_1652 | 436 |
| 5 | 3300035119 | Ga0373956_0089201 | Ga0373956_0089201_78_1400 | 439 |
| 6 | 3300005937 | Ga0081455_10000980 | Ga0081455_1000098015 | 441 |
| 7 | 3300041441 | Ga0451787_260720 | Ga0451787_260720_19_1407 | 442 |
| 8 | 3300009147 | Ga0114129_10107725 | Ga0114129_101077252 | 447 |
| 9 | 3300050515 | nmdc:mga0a205_185239_c1 | nmdc:mga0a205_185239_c1_553_1953 | 447 |
| 10 | 3300002077 | JGI24744J21845_10001909 | JGI24744J21845_100019092 | 448 |
| 11 | 3300004798 | Ga0058859_11806834 | Ga0058859_118068341 | 448 |
| 12 | 3300004801 | Ga0058860_10013857 | Ga0058860_100138572 | 448 |
| 13 | 3300005337 | Ga0070682_100000922 | Ga0070682_10000092215 | 448 |
| 14 | 3300005343 | Ga0070687_100014361 | Ga0070687_1000143612 | 448 |
| 15 | 3300005367 | Ga0070667_100168084 | Ga0070667_1001680841 | 448 |
| 16 | 3300005437 | Ga0070710_10008309 | Ga0070710_100083093 | 448 |
| 17 | 3300005439 | Ga0070711_100006754 | Ga0070711_1000067542 | 448 |
| 18 | 3300005455 | Ga0070663_100069555 | Ga0070663_1000695552 | 448 |
| 19 | 3300005459 | Ga0068867_100036542 | Ga0068867_1000365422 | 448 |
| 20 | 3300005548 | Ga0070665_100048464 | Ga0070665_1000484642 | 448 |
| 21 | 3300009176 | Ga0105242_10006965 | Ga0105242_100069658 | 448 |
| 22 | 3300010375 | Ga0105239_10044923 | Ga0105239_100449232 | 448 |
| 23 | 3300013297 | Ga0157378_10043906 | Ga0157378_100439062 | 448 |
| 24 | 3300014326 | Ga0157380_10024436 | Ga0157380_100244363 | 448 |
| 25 | 3300032002 | Ga0307416_100088031 | Ga0307416_1000880312 | 448 |
| 26 | 3300046615 | Ga0495656_0031347 | Ga0495656_0031347_429_1856 | 448 |
| 27 | 3300005445 | Ga0070708_100079894 | Ga0070708_1000798942 | 449 |
| 28 | 3300005467 | Ga0070706_100064581 | Ga0070706_1000645812 | 449 |
| 29 | 3300005468 | Ga0070707_100225827 | Ga0070707_1002258271 | 449 |
| 30 | 3300005471 | Ga0070698_100003904 | Ga0070698_10000390410 | 449 |
| 31 | 3300009147 | Ga0114129_10354723 | Ga0114129_103547232 | 449 |
| 32 | 3300025910 | Ga0207684_10043464 | Ga0207684_100434642 | 449 |
| 33 | 3300026089 | Ga0207648_10101824 | Ga0207648_101018242 | 449 |
| 34 | 3300048915 | Ga0496112_0087457 | Ga0496112_0087457_1317_2750 | 449 |
| 35 | 3300037418 | Ga0395900_0020195 | Ga0395900_0020195_2100_3455 | 450 |
| 36 | 3300037466 | Ga0395898_0098701 | Ga0395898_0098701_1143_2498 | 450 |
| 37 | 3300037471 | Ga0395905_0089127 | Ga0395905_0089127_1333_2688 | 450 |
| 38 | 3300041460 | Ga0451802_1676736 | Ga0451802_1676736_1836_3191 | 450 |
| 39 | 3300041463 | Ga0451804_0502473 | Ga0451804_0502473_2978_4333 | 450 |
| 40 | 3300041496 | Ga0451839_0806449 | Ga0451839_0806449_610_1965 | 450 |
| 41 | 3300050507 | nmdc:mga05p37_259523_c1 | nmdc:mga05p37_259523_c1_61_1419 | 450 |
| 42 | 3300005338 | Ga0068868_100019168 | Ga0068868_1000191683 | 451 |
| 43 | 3300005435 | Ga0070714_100075236 | Ga0070714_1000752361 | 451 |
| 44 | 3300005437 | Ga0070710_10021121 | Ga0070710_100211213 | 451 |
| 45 | 3300005459 | Ga0068867_100058556 | Ga0068867_1000585562 | 451 |
| 46 | 3300005615 | Ga0070702_100013413 | Ga0070702_1000134132 | 451 |
| 47 | 3300005616 | Ga0068852_100195178 | Ga0068852_1001951782 | 451 |
| 48 | 3300005618 | Ga0068864_100076047 | Ga0068864_1000760472 | 451 |
| 49 | 3300006175 | Ga0070712_100117613 | Ga0070712_1001176132 | 451 |
| 50 | 3300014325 | Ga0163163_10241164 | Ga0163163_102411642 | 451 |
| 51 | 3300025898 | Ga0207692_10010534 | Ga0207692_100105343 | 451 |
| 52 | 3300025929 | Ga0207664_10081558 | Ga0207664_100815582 | 451 |
| 53 | 3300025939 | Ga0207665_10013259 | Ga0207665_100132597 | 451 |
| 54 | 3300026118 | Ga0207675_100038375 | Ga0207675_1000383754 | 451 |
| 55 | 3300035725 | Ga0373947_0001059 | Ga0373947_0001059_13373_14731 | 451 |
| 56 | 3300046517 | Ga0495630_0191922 | Ga0495630_0191922_54_1412 | 451 |
| 57 | 3300046642 | Ga0495634_0039578 | Ga0495634_0039578_1785_3149 | 451 |
| 58 | 3300047321 | Ga0495676_0124482 | Ga0495676_0124482_350_1708 | 451 |
| 59 | 3300004803 | Ga0058862_12330200 | Ga0058862_123302001 | 452 |
| 60 | 3300009098 | Ga0105245_10013270 | Ga0105245_100132705 | 452 |
| 61 | 3300048905 | Ga0496102_0280382 | Ga0496102_0280382_199_1560 | 452 |
| 62 | 3300048911 | Ga0496108_0104566 | Ga0496108_0104566_969_2330 | 452 |
| 63 | 3300048912 | Ga0496109_0008388 | Ga0496109_0008388_1311_2672 | 452 |
| 64 | 3300006852 | Ga0075433_10049425 | Ga0075433_100494252 | 453 |
| 65 | 3300006871 | Ga0075434_100002264 | Ga0075434_10000226413 | 453 |
| 66 | 3300025893 | Ga0207682_10051995 | Ga0207682_100519952 | 453 |
| 67 | 3300050507 | nmdc:mga05p37_88328_c1 | nmdc:mga05p37_88328_c1_1527_2891 | 453 |
| 68 | 3300050515 | nmdc:mga0a205_16745_c1 | nmdc:mga0a205_16745_c1_4970_6334 | 453 |
| 69 | 3300006844 | Ga0075428_100049929 | Ga0075428_1000499292 | 454 |
| 70 | 3300006914 | Ga0075436_100034563 | Ga0075436_1000345632 | 454 |
| 71 | 3300009147 | Ga0114129_10272063 | Ga0114129_102720632 | 454 |
| 72 | 3300013306 | Ga0163162_10064702 | Ga0163162_100647022 | 454 |
| 73 | 3300027907 | Ga0207428_10006489 | Ga0207428_100064898 | 454 |
| 74 | 3300037418 | Ga0395900_0105559 | Ga0395900_0105559_1033_2418 | 454 |
| 75 | 3300042008 | Ga0439450_012201 | Ga0439450_012201_154_1539 | 454 |
| 76 | 3300046523 | Ga0495644_0014566 | Ga0495644_0014566_1605_2972 | 454 |
| 77 | 3300048909 | Ga0496106_0029137 | Ga0496106_0029137_1215_2612 | 454 |
| 78 | 3300050507 | nmdc:mga05p37_36144_c1 | nmdc:mga05p37_36144_c1_2146_3513 | 454 |
| 79 | 3300050508 | nmdc:mga09592_193761_c1 | nmdc:mga09592_193761_c1_157_1590 | 454 |
| 80 | 3300050509 | nmdc:mga0qj67_99105_c1 | nmdc:mga0qj67_99105_c1_260_1627 | 454 |
| 81 | 3300050510 | nmdc:mga06r32_29088_c1 | nmdc:mga06r32_29088_c1_1904_3271 | 454 |
| 82 | 3300050511 | nmdc:mga08y16_35406_c1 | nmdc:mga08y16_35406_c1_2091_3458 | 454 |
| 83 | 3300050512 | nmdc:mga0n895_26924_c1 | nmdc:mga0n895_26924_c1_2157_3524 | 454 |
| 84 | 3300050513 | nmdc:mga0rr50_44464_c1 | nmdc:mga0rr50_44464_c1_1369_2802 | 454 |
| 85 | 3300050515 | nmdc:mga0a205_14308_c1 | nmdc:mga0a205_14308_c1_2624_4057 | 454 |
| 86 | 3300050515 | nmdc:mga0a205_94727_c1 | nmdc:mga0a205_94727_c1_1200_2633 | 454 |
| 87 | 3300050515 | nmdc:mga0a205_99045_c1 | nmdc:mga0a205_99045_c1_686_2053 | 454 |
| 88 | 3300042005 | Ga0439448_0004060 | Ga0439448_0004060_2105_3541 | 455 |
| 89 | 3300042008 | Ga0439450_002177 | Ga0439450_002177_632_2068 | 455 |
| 90 | 3300048913 | Ga0496110_0030512 | Ga0496110_0030512_1875_3263 | 456 |
| 91 | 3300005535 | Ga0070684_100270414 | Ga0070684_1002704141 | 458 |
| 92 | 3300025940 | Ga0207691_10183172 | Ga0207691_101831722 | 458 |
| 93 | 3300048905 | Ga0496102_0005830 | Ga0496102_0005830_7409_8848 | 458 |
| 94 | 3300048906 | Ga0496103_0007006 | Ga0496103_0007006_1146_2585 | 458 |
| 95 | 3300048907 | Ga0496104_0076539 | Ga0496104_0076539_1359_2798 | 458 |
| 96 | 3300048909 | Ga0496106_0000729 | Ga0496106_0000729_16671_18110 | 458 |
| 97 | 3300048912 | Ga0496109_0024760 | Ga0496109_0024760_2578_4017 | 458 |
| 98 | 3300048917 | Ga0496114_0004201 | Ga0496114_0004201_3319_4758 | 458 |
| 99 | 3300005578 | Ga0068854_100065873 | Ga0068854_1000658732 | 459 |
| 100 | 3300046491 | Ga0495584_0006077 | Ga0495584_0006077_558_1940 | 459 |
| 101 | 3300046523 | Ga0495644_0001704 | Ga0495644_0001704_7068_8450 | 459 |
| 102 | 3300046537 | Ga0495598_0002093 | Ga0495598_0002093_2661_4043 | 459 |
| 103 | 3300046539 | Ga0495621_0024833 | Ga0495621_0024833_276_1658 | 459 |
| 104 | 3300046615 | Ga0495656_0000888 | Ga0495656_0000888_6179_7561 | 459 |
| 105 | 3300046664 | Ga0495659_0003655 | Ga0495659_0003655_2099_3481 | 459 |
| 106 | 3300046691 | Ga0495670_0002377 | Ga0495670_0002377_5001_6383 | 459 |
| 107 | 3300047318 | Ga0495636_0018748 | Ga0495636_0018748_514_1896 | 459 |
| 108 | 3300006844 | Ga0075428_100097314 | Ga0075428_1000973142 | 460 |
| 109 | 3300006847 | Ga0075431_100020673 | Ga0075431_1000206732 | 460 |
| 110 | 3300006880 | Ga0075429_100050633 | Ga0075429_1000506332 | 460 |
| 111 | 3300036401 | Ga0373937_0078631 | Ga0373937_0078631_1128_2513 | 460 |
| 112 | 3300037418 | Ga0395900_0041261 | Ga0395900_0041261_1055_2500 | 460 |
| 113 | 3300037471 | Ga0395905_0264441 | Ga0395905_0264441_36_1481 | 460 |
| 114 | 3300038443 | Ga0395901_0272771 | Ga0395901_0272771_330_1715 | 460 |
| 115 | 3300046463 | Ga0495653_0084856 | Ga0495653_0084856_775_2160 | 460 |
| 116 | 3300046511 | Ga0495608_0008685 | Ga0495608_0008685_774_2159 | 460 |
| 117 | 3300046511 | Ga0495608_0035213 | Ga0495608_0035213_1606_2991 | 460 |
| 118 | 3300046514 | Ga0495618_0048850 | Ga0495618_0048850_647_2032 | 460 |
| 119 | 3300046559 | Ga0495667_0027049 | Ga0495667_0027049_888_2273 | 460 |
| 120 | 3300046675 | Ga0495657_0008126 | Ga0495657_0008126_4164_5549 | 460 |
| 121 | 3300046675 | Ga0495657_0039184 | Ga0495657_0039184_1209_2594 | 460 |
| 122 | 3300046683 | Ga0495658_0016944 | Ga0495658_0016944_747_2132 | 460 |
| 123 | 3300047317 | Ga0495604_0016344 | Ga0495604_0016344_1018_2403 | 460 |
| 124 | 3300047319 | Ga0495674_0098119 | Ga0495674_0098119_208_1593 | 460 |
| 125 | 3300047322 | Ga0495680_0017050 | Ga0495680_0017050_672_2057 | 460 |
| 126 | 3300047471 | Ga0495684_0069136 | Ga0495684_0069136_100_1485 | 460 |
| 127 | 3300047471 | Ga0495684_0090020 | Ga0495684_0090020_275_1660 | 460 |
| 128 | 3300048904 | Ga0496101_0006168 | Ga0496101_0006168_4770_6173 | 460 |
| 129 | 3300050508 | nmdc:mga09592_19783_c1 | nmdc:mga09592_19783_c1_3057_4466 | 460 |
| 130 | 3300050510 | nmdc:mga06r32_25580_c1 | nmdc:mga06r32_25580_c1_3625_5034 | 460 |
| 131 | 3300053084 | Ga0495595_0034318 | Ga0495595_0034318_774_2159 | 460 |
| 132 | 3300053085 | Ga0495619_0008348 | Ga0495619_0008348_3505_4890 | 460 |
| 133 | 3300006038 | Ga0075365_10096834 | Ga0075365_100968342 | 461 |
| 134 | 3300006844 | Ga0075428_100007225 | Ga0075428_1000072255 | 461 |
| 135 | 3300009147 | Ga0114129_10012002 | Ga0114129_100120024 | 461 |
| 136 | 3300025906 | Ga0207699_10095749 | Ga0207699_100957491 | 461 |
| 137 | 3300037466 | Ga0395898_0081982 | Ga0395898_0081982_1044_2465 | 461 |
| 138 | 3300041505 | Ga0451849_0147738 | Ga0451849_0147738_1305_2720 | 461 |
| 139 | 3300046454 | Ga0495592_0030033 | Ga0495592_0030033_1604_3025 | 461 |
| 140 | 3300046459 | Ga0495629_0011412 | Ga0495629_0011412_1304_2719 | 461 |
| 141 | 3300046462 | Ga0495651_0057667 | Ga0495651_0057667_1271_2692 | 461 |
| 142 | 3300046463 | Ga0495653_0053280 | Ga0495653_0053280_1022_2443 | 461 |
| 143 | 3300046477 | Ga0495664_0080907 | Ga0495664_0080907_59_1480 | 461 |
| 144 | 3300046511 | Ga0495608_0047780 | Ga0495608_0047780_831_2246 | 461 |
| 145 | 3300046516 | Ga0495628_0018415 | Ga0495628_0018415_3106_4527 | 461 |
| 146 | 3300046517 | Ga0495630_0057738 | Ga0495630_0057738_1200_2615 | 461 |
| 147 | 3300046536 | Ga0495587_0065952 | Ga0495587_0065952_572_1981 | 461 |
| 148 | 3300046642 | Ga0495634_0038581 | Ga0495634_0038581_577_1998 | 461 |
| 149 | 3300046678 | Ga0495599_0108550 | Ga0495599_0108550_220_1635 | 461 |
| 150 | 3300046680 | Ga0495646_0054169 | Ga0495646_0054169_577_1998 | 461 |
| 151 | 3300046689 | Ga0495613_0048964 | Ga0495613_0048964_876_2297 | 461 |
| 152 | 3300047319 | Ga0495674_0081148 | Ga0495674_0081148_174_1595 | 461 |
| 153 | 3300047322 | Ga0495680_0001834 | Ga0495680_0001834_14368_15789 | 461 |
| 154 | 3300047471 | Ga0495684_0000755 | Ga0495684_0000755_9647_11062 | 461 |
| 155 | 3300048088 | Ga0495602_0106999 | Ga0495602_0106999_814_2235 | 461 |
| 156 | 3300053077 | Ga0495601_0094329 | Ga0495601_0094329_65_1480 | 461 |
| 157 | 3300053084 | Ga0495595_0007185 | Ga0495595_0007185_641_2062 | 461 |
| 158 | 3300053085 | Ga0495619_0002088 | Ga0495619_0002088_2021_3442 | 461 |
| 159 | 3300005456 | Ga0070678_100023705 | Ga0070678_1000237052 | 462 |
| 160 | 3300006844 | Ga0075428_100349758 | Ga0075428_1003497582 | 462 |
| 161 | 3300026067 | Ga0207678_10160177 | Ga0207678_101601771 | 462 |
| 162 | 3300047317 | Ga0495604_0136498 | Ga0495604_0136498_111_1523 | 462 |
| 163 | 3300047319 | Ga0495674_0068147 | Ga0495674_0068147_54_1466 | 462 |
| 164 | 3300047322 | Ga0495680_0016323 | Ga0495680_0016323_3016_4428 | 462 |
| 165 | 3300049575 | Ga0501039_0077885 | Ga0501039_0077885_471_1859 | 462 |
| 166 | 3300049587 | Ga0501071_0002667 | Ga0501071_0002667_7355_8743 | 462 |
| 167 | 3300049588 | Ga0501072_0055287 | Ga0501072_0055287_21_1409 | 462 |
| 168 | 3300049593 | Ga0501077_0009346 | Ga0501077_0009346_1033_2421 | 462 |
| 169 | 3300049742 | Ga0501080_0076516 | Ga0501080_0076516_1013_2401 | 462 |
| 170 | 3300061734 | Ga0530510_0017691 | Ga0530510_0017691_920_2308 | 462 |
| 171 | iso_pu_bacteria | 2816332119 | 2816424226 | 462 |
| 172 | 3300005436 | Ga0070713_100077838 | Ga0070713_1000778382 | 463 |
| 173 | 3300005545 | Ga0070695_100007621 | Ga0070695_1000076212 | 463 |
| 174 | 3300006173 | Ga0070716_100013307 | Ga0070716_1000133072 | 463 |
| 175 | 3300009148 | Ga0105243_10016670 | Ga0105243_100166702 | 463 |
| 176 | 3300009553 | Ga0105249_10042558 | Ga0105249_100425582 | 463 |
| 177 | 3300025928 | Ga0207700_10056817 | Ga0207700_100568172 | 463 |
| 178 | 3300026116 | Ga0207674_10124922 | Ga0207674_101249222 | 463 |
| 179 | 3300031251 | Ga0265327_10023218 | Ga0265327_100232182 | 463 |
| 180 | 3300031995 | Ga0307409_100043090 | Ga0307409_1000430902 | 463 |
| 181 | 3300032126 | Ga0307415_100023353 | Ga0307415_1000233533 | 463 |
| 182 | 3300037418 | Ga0395900_0072400 | Ga0395900_0072400_158_1579 | 463 |
| 183 | 3300037466 | Ga0395898_0023058 | Ga0395898_0023058_4853_6274 | 463 |
| 184 | 3300038443 | Ga0395901_0025938 | Ga0395901_0025938_3884_5305 | 463 |
| 185 | 3300048903 | Ga0496100_0114016 | Ga0496100_0114016_381_1790 | 463 |
| 186 | 3300048904 | Ga0496101_0094304 | Ga0496101_0094304_21_1430 | 463 |
| 187 | 3300048905 | Ga0496102_0151376 | Ga0496102_0151376_50_1459 | 463 |
| 188 | 3300048907 | Ga0496104_0060599 | Ga0496104_0060599_506_1915 | 463 |
| 189 | 3300048907 | Ga0496104_0088361 | Ga0496104_0088361_608_2026 | 463 |
| 190 | 3300048911 | Ga0496108_0002863 | Ga0496108_0002863_4077_5486 | 463 |
| 191 | 3300048912 | Ga0496109_0004914 | Ga0496109_0004914_3302_4711 | 463 |
| 192 | 3300048912 | Ga0496109_0050593 | Ga0496109_0050593_315_1733 | 463 |
| 193 | 3300048916 | Ga0496113_0013024 | Ga0496113_0013024_137_1546 | 463 |
| 194 | 3300048918 | Ga0496115_0089416 | Ga0496115_0089416_345_1754 | 463 |
| 195 | 3300006175 | Ga0070712_100002845 | Ga0070712_1000028454 | 464 |
| 196 | 3300025915 | Ga0207693_10021227 | Ga0207693_100212272 | 464 |
| 197 | 3300048915 | Ga0496112_0045604 | Ga0496112_0045604_974_2398 | 464 |
| 198 | 3300004800 | Ga0058861_12062177 | Ga0058861_120621772 | 465 |
| 199 | 3300005356 | Ga0070674_100040772 | Ga0070674_1000407722 | 465 |
| 200 | 3300005365 | Ga0070688_100000700 | Ga0070688_1000007002 | 465 |
| 201 | 3300005439 | Ga0070711_100149002 | Ga0070711_1001490022 | 465 |
| 202 | 3300005441 | Ga0070700_100001301 | Ga0070700_1000013015 | 465 |
| 203 | 3300005546 | Ga0070696_100022246 | Ga0070696_1000222462 | 465 |
| 204 | 3300005617 | Ga0068859_100202381 | Ga0068859_1002023812 | 465 |
| 205 | 3300006931 | Ga0097620_100202389 | Ga0097620_1002023892 | 465 |
| 206 | 3300009147 | Ga0114129_10042748 | Ga0114129_100427483 | 465 |
| 207 | 3300009174 | Ga0105241_10041134 | Ga0105241_100411342 | 465 |
| 208 | 3300013296 | Ga0157374_10105932 | Ga0157374_101059322 | 465 |
| 209 | 3300014745 | Ga0157377_10004218 | Ga0157377_100042182 | 465 |
| 210 | 3300025915 | Ga0207693_10044071 | Ga0207693_100440712 | 465 |
| 211 | 3300025927 | Ga0207687_10065891 | Ga0207687_100658913 | 465 |
| 212 | 3300025929 | Ga0207664_10015828 | Ga0207664_100158282 | 465 |
| 213 | 3300025939 | Ga0207665_10000419 | Ga0207665_100004195 | 465 |
| 214 | 3300026035 | Ga0207703_10125930 | Ga0207703_101259302 | 465 |
| 215 | 3300026075 | Ga0207708_10000064 | Ga0207708_1000006435 | 465 |
| 216 | 3300026121 | Ga0207683_10010485 | Ga0207683_100104854 | 465 |
| 217 | 3300027907 | Ga0207428_10004538 | Ga0207428_100045382 | 465 |
| 218 | 3300035121 | Ga0373960_0007553 | Ga0373960_0007553_556_1989 | 465 |
| 219 | 3300035207 | Ga0373942_0011702 | Ga0373942_0011702_74_1507 | 465 |
| 220 | 3300035691 | Ga0373931_0027344 | Ga0373931_0027344_316_1749 | 465 |
| 221 | 3300037466 | Ga0395898_0070903 | Ga0395898_0070903_839_2272 | 465 |
| 222 | 3300037471 | Ga0395905_0183932 | Ga0395905_0183932_63_1496 | 465 |
| 223 | 3300045051 | Ga0451576_0035206 | Ga0451576_0035206_2563_3996 | 465 |
| 224 | 3300046461 | Ga0495641_0023573 | Ga0495641_0023573_622_2049 | 465 |
| 225 | 3300046476 | Ga0495662_0035839 | Ga0495662_0035839_216_1643 | 465 |
| 226 | 3300046491 | Ga0495584_0040481 | Ga0495584_0040481_203_1633 | 465 |
| 227 | 3300046538 | Ga0495609_0055001 | Ga0495609_0055001_62_1492 | 465 |
| 228 | 3300047315 | Ga0495581_0007725 | Ga0495581_0007725_2621_4048 | 465 |
| 229 | 3300048908 | Ga0496105_0196588 | Ga0496105_0196588_94_1521 | 465 |
| 230 | 3300048913 | Ga0496110_0002619 | Ga0496110_0002619_3584_5017 | 465 |
| 231 | 3300048914 | Ga0496111_0006246 | Ga0496111_0006246_1344_2777 | 465 |
| 232 | 3300048915 | Ga0496112_0016933 | Ga0496112_0016933_1564_2997 | 465 |
| 233 | 3300048916 | Ga0496113_0083225 | Ga0496113_0083225_153_1580 | 465 |
| 234 | 3300050507 | nmdc:mga05p37_37201_c1 | nmdc:mga05p37_37201_c1_896_2296 | 465 |
| 235 | 3300050511 | nmdc:mga08y16_2685_c1 | nmdc:mga08y16_2685_c1_2041_3441 | 465 |
| 236 | 3300050515 | nmdc:mga0a205_1136_c1 | nmdc:mga0a205_1136_c1_19069_20469 | 465 |
| 237 | 3300003373 | JGI25407J50210_10001726 | JGI25407J50210_100017262 | 466 |
| 238 | 3300005329 | Ga0070683_100008404 | Ga0070683_1000084043 | 466 |
| 239 | 3300005366 | Ga0070659_100236295 | Ga0070659_1002362951 | 466 |
| 240 | 3300005438 | Ga0070701_10065219 | Ga0070701_100652192 | 466 |
| 241 | 3300005440 | Ga0070705_100067331 | Ga0070705_1000673312 | 466 |
| 242 | 3300005457 | Ga0070662_100030526 | Ga0070662_1000305263 | 466 |
| 243 | 3300005457 | Ga0070662_100124053 | Ga0070662_1001240532 | 466 |
| 244 | 3300005535 | Ga0070684_100000934 | Ga0070684_10000093416 | 466 |
| 245 | 3300005547 | Ga0070693_100031479 | Ga0070693_1000314792 | 466 |
| 246 | 3300005549 | Ga0070704_100104785 | Ga0070704_1001047852 | 466 |
| 247 | 3300005614 | Ga0068856_100096974 | Ga0068856_1000969742 | 466 |
| 248 | 3300005718 | Ga0068866_10006694 | Ga0068866_100066944 | 466 |
| 249 | 3300005842 | Ga0068858_100246738 | Ga0068858_1002467382 | 466 |
| 250 | 3300005937 | Ga0081455_10005954 | Ga0081455_100059545 | 466 |
| 251 | 3300005981 | Ga0081538_10000062 | Ga0081538_1000006258 | 466 |
| 252 | 3300006844 | Ga0075428_100180126 | Ga0075428_1001801261 | 466 |
| 253 | 3300006852 | Ga0075433_10087300 | Ga0075433_100873002 | 466 |
| 254 | 3300006852 | Ga0075433_10103918 | Ga0075433_101039184 | 466 |
| 255 | 3300007076 | Ga0075435_100020408 | Ga0075435_1000204083 | 466 |
| 256 | 3300009098 | Ga0105245_10005198 | Ga0105245_100051988 | 466 |
| 257 | 3300009098 | Ga0105245_10006274 | Ga0105245_100062749 | 466 |
| 258 | 3300009098 | Ga0105245_10009183 | Ga0105245_100091835 | 466 |
| 259 | 3300009148 | Ga0105243_10015249 | Ga0105243_100152492 | 466 |
| 260 | 3300009176 | Ga0105242_10023934 | Ga0105242_100239343 | 466 |
| 261 | 3300009176 | Ga0105242_10226523 | Ga0105242_102265231 | 466 |
| 262 | 3300009177 | Ga0105248_10068764 | Ga0105248_100687642 | 466 |
| 263 | 3300009553 | Ga0105249_10189468 | Ga0105249_101894682 | 466 |
| 264 | 3300010375 | Ga0105239_10019008 | Ga0105239_100190083 | 466 |
| 265 | 3300010375 | Ga0105239_10198543 | Ga0105239_101985432 | 466 |
| 266 | 3300011119 | Ga0105246_10001142 | Ga0105246_100011427 | 466 |
| 267 | 3300011119 | Ga0105246_10052289 | Ga0105246_100522893 | 466 |
| 268 | 3300013105 | Ga0157369_10015138 | Ga0157369_100151383 | 466 |
| 269 | 3300013307 | Ga0157372_10006104 | Ga0157372_100061047 | 466 |
| 270 | 3300013307 | Ga0157372_10119454 | Ga0157372_101194542 | 466 |
| 271 | 3300025899 | Ga0207642_10001835 | Ga0207642_100018355 | 466 |
| 272 | 3300025908 | Ga0207643_10013515 | Ga0207643_100135154 | 466 |
| 273 | 3300025921 | Ga0207652_10181876 | Ga0207652_101818762 | 466 |
| 274 | 3300025927 | Ga0207687_10002598 | Ga0207687_100025989 | 466 |
| 275 | 3300025927 | Ga0207687_10036213 | Ga0207687_100362132 | 466 |
| 276 | 3300025933 | Ga0207706_10021778 | Ga0207706_100217782 | 466 |
| 277 | 3300025933 | Ga0207706_10063494 | Ga0207706_100634943 | 466 |
| 278 | 3300025935 | Ga0207709_10104129 | Ga0207709_101041291 | 466 |
| 279 | 3300025944 | Ga0207661_10002247 | Ga0207661_100022476 | 466 |
| 280 | 3300025945 | Ga0207679_10083259 | Ga0207679_100832592 | 466 |
| 281 | 3300026023 | Ga0207677_10066813 | Ga0207677_100668132 | 466 |
| 282 | 3300026078 | Ga0207702_10048456 | Ga0207702_100484562 | 466 |
| 283 | 3300026118 | Ga0207675_100021458 | Ga0207675_1000214581 | 466 |
| 284 | 3300026118 | Ga0207675_100067930 | Ga0207675_1000679303 | 466 |
| 285 | 3300026118 | Ga0207675_100151845 | Ga0207675_1001518452 | 466 |
| 286 | 3300027907 | Ga0207428_10032418 | Ga0207428_100324185 | 466 |
| 287 | 3300028381 | Ga0268264_10187770 | Ga0268264_101877701 | 466 |
| 288 | 3300035170 | Ga0373943_0005394 | Ga0373943_0005394_4078_5511 | 466 |
| 289 | 3300035171 | Ga0373946_0008525 | Ga0373946_0008525_2004_3440 | 466 |
| 290 | 3300035725 | Ga0373947_0002802 | Ga0373947_0002802_1138_2574 | 466 |
| 291 | 3300037068 | Ga0373925_0005324 | Ga0373925_0005324_6913_8349 | 466 |
| 292 | 3300037418 | Ga0395900_0012939 | Ga0395900_0012939_6158_7594 | 466 |
| 293 | 3300037466 | Ga0395898_0001644 | Ga0395898_0001644_23999_25435 | 466 |
| 294 | 3300037466 | Ga0395898_0033832 | Ga0395898_0033832_3161_4606 | 466 |
| 295 | 3300037471 | Ga0395905_0005590 | Ga0395905_0005590_8039_9475 | 466 |
| 296 | 3300037471 | Ga0395905_0010756 | Ga0395905_0010756_652_2097 | 466 |
| 297 | 3300045051 | Ga0451576_0057717 | Ga0451576_0057717_2075_3505 | 466 |
| 298 | 3300046455 | Ga0495603_0007045 | Ga0495603_0007045_2869_4305 | 466 |
| 299 | 3300046461 | Ga0495641_0003896 | Ga0495641_0003896_2640_4076 | 466 |
| 300 | 3300046491 | Ga0495584_0006163 | Ga0495584_0006163_875_2302 | 466 |
| 301 | 3300046499 | Ga0495594_0001378 | Ga0495594_0001378_3086_4522 | 466 |
| 302 | 3300046674 | Ga0495588_0007629 | Ga0495588_0007629_102_1538 | 466 |
| 303 | 3300046681 | Ga0495647_0023507 | Ga0495647_0023507_400_1836 | 466 |
| 304 | 3300047321 | Ga0495676_0013494 | Ga0495676_0013494_2502_3938 | 466 |
| 305 | 3300048903 | Ga0496100_0194355 | Ga0496100_0194355_30_1451 | 466 |
| 306 | 3300048905 | Ga0496102_0006206 | Ga0496102_0006206_3059_4495 | 466 |
| 307 | 3300048905 | Ga0496102_0037892 | Ga0496102_0037892_1566_2966 | 466 |
| 308 | 3300048906 | Ga0496103_0016633 | Ga0496103_0016633_140_1540 | 466 |
| 309 | 3300048906 | Ga0496103_0023544 | Ga0496103_0023544_209_1645 | 466 |
| 310 | 3300048907 | Ga0496104_0031233 | Ga0496104_0031233_2977_4413 | 466 |
| 311 | 3300048910 | Ga0496107_0110966 | Ga0496107_0110966_11_1411 | 466 |
| 312 | 3300048912 | Ga0496109_0008075 | Ga0496109_0008075_2677_4077 | 466 |
| 313 | 3300048912 | Ga0496109_0030328 | Ga0496109_0030328_3318_4745 | 466 |
| 314 | 3300048914 | Ga0496111_0002096 | Ga0496111_0002096_2402_3802 | 466 |
| 315 | 3300048914 | Ga0496111_0014711 | Ga0496111_0014711_3076_4503 | 466 |
| 316 | 3300048917 | Ga0496114_0001305 | Ga0496114_0001305_3951_5387 | 466 |
| 317 | 3300049568 | Ga0501031_0001154 | Ga0501031_0001154_2505_3917 | 466 |
| 318 | 3300049569 | Ga0501032_0000274 | Ga0501032_0000274_30060_31472 | 466 |
| 319 | 3300049570 | Ga0501033_0000629 | Ga0501033_0000629_14819_16231 | 466 |
| 320 | 3300049572 | Ga0501036_0000296 | Ga0501036_0000296_11784_13196 | 466 |
| 321 | 3300049573 | Ga0501037_0000379 | Ga0501037_0000379_23101_24513 | 466 |
| 322 | 3300049574 | Ga0501038_0000186 | Ga0501038_0000186_19040_20452 | 466 |
| 323 | 3300049575 | Ga0501039_0000141 | Ga0501039_0000141_22584_23996 | 466 |
| 324 | 3300049576 | Ga0501040_0000360 | Ga0501040_0000360_9039_10451 | 466 |
| 325 | 3300049577 | Ga0501041_0000039 | Ga0501041_0000039_11789_13201 | 466 |
| 326 | 3300049578 | Ga0501042_0000670 | Ga0501042_0000670_12461_13873 | 466 |
| 327 | 3300049579 | Ga0501043_0000171 | Ga0501043_0000171_34085_35497 | 466 |
| 328 | 3300049580 | Ga0501046_0000177 | Ga0501046_0000177_11789_13201 | 466 |
| 329 | 3300049581 | Ga0501047_0000481 | Ga0501047_0000481_28135_29547 | 466 |
| 330 | 3300049582 | Ga0501048_0001307 | Ga0501048_0001307_1090_2502 | 466 |
| 331 | 3300049585 | Ga0501069_0004399 | Ga0501069_0004399_1109_2521 | 466 |
| 332 | 3300049586 | Ga0501070_0001532 | Ga0501070_0001532_13723_15135 | 466 |
| 333 | 3300049587 | Ga0501071_0000494 | Ga0501071_0000494_16401_17813 | 466 |
| 334 | 3300049588 | Ga0501072_0002097 | Ga0501072_0002097_4690_6102 | 466 |
| 335 | 3300049589 | Ga0501073_0000337 | Ga0501073_0000337_21379_22791 | 466 |
| 336 | 3300049590 | Ga0501074_0000054 | Ga0501074_0000054_34279_35691 | 466 |
| 337 | 3300049591 | Ga0501075_0001678 | Ga0501075_0001678_9774_11186 | 466 |
| 338 | 3300049592 | Ga0501076_0000484 | Ga0501076_0000484_11893_13305 | 466 |
| 339 | 3300049593 | Ga0501077_0000419 | Ga0501077_0000419_17912_19324 | 466 |
| 340 | 3300049741 | Ga0501079_0000108 | Ga0501079_0000108_29371_30783 | 466 |
| 341 | 3300049742 | Ga0501080_0000301 | Ga0501080_0000301_11875_13287 | 466 |
| 342 | 3300049743 | Ga0501081_0000758 | Ga0501081_0000758_16401_17813 | 466 |
| 343 | 3300049744 | Ga0501083_0000797 | Ga0501083_0000797_14555_15967 | 466 |
| 344 | 3300049822 | Ga0501035_0000457 | Ga0501035_0000457_32580_33992 | 466 |
| 345 | 3300049823 | Ga0501044_0003357 | Ga0501044_0003357_13508_14920 | 466 |
| 346 | 3300049824 | Ga0501045_0000050 | Ga0501045_0000050_21384_22796 | 466 |
| 347 | 3300050511 | nmdc:mga08y16_11751_c1 | nmdc:mga08y16_11751_c1_6324_7733 | 466 |
| 348 | 3300050512 | nmdc:mga0n895_131460_c1 | nmdc:mga0n895_131460_c1_456_1865 | 466 |
| 349 | 3300050513 | nmdc:mga0rr50_42319_c1 | nmdc:mga0rr50_42319_c1_1214_2650 | 466 |
| 350 | 3300050515 | nmdc:mga0a205_98409_c1 | nmdc:mga0a205_98409_c1_356_1792 | 466 |
| 351 | 3300054114 | Ga0501084_0002699 | Ga0501084_0002699_11789_13201 | 466 |
| 352 | 3300060353 | Ga0501082_0001712 | Ga0501082_0001712_14468_15880 | 466 |
| 353 | 3300061734 | Ga0530510_0000188 | Ga0530510_0000188_13798_15210 | 466 |
| 354 | 3300005406 | Ga0070703_10000259 | Ga0070703_1000025920 | 467 |
| 355 | 3300005439 | Ga0070711_100042685 | Ga0070711_1000426852 | 467 |
| 356 | 3300005440 | Ga0070705_100006314 | Ga0070705_1000063142 | 467 |
| 357 | 3300005444 | Ga0070694_100013740 | Ga0070694_1000137404 | 467 |
| 358 | 3300005445 | Ga0070708_100000272 | Ga0070708_10000027235 | 467 |
| 359 | 3300005467 | Ga0070706_100000748 | Ga0070706_10000074833 | 467 |
| 360 | 3300005467 | Ga0070706_100075424 | Ga0070706_1000754242 | 467 |
| 361 | 3300005468 | Ga0070707_100062761 | Ga0070707_1000627612 | 467 |
| 362 | 3300005471 | Ga0070698_100005947 | Ga0070698_1000059479 | 467 |
| 363 | 3300005536 | Ga0070697_100024427 | Ga0070697_1000244272 | 467 |
| 364 | 3300005719 | Ga0068861_100044390 | Ga0068861_1000443902 | 467 |
| 365 | 3300005937 | Ga0081455_10003455 | Ga0081455_1000345516 | 467 |
| 366 | 3300005983 | Ga0081540_1030296 | Ga0081540_10302962 | 467 |
| 367 | 3300006028 | Ga0070717_10190518 | Ga0070717_101905182 | 467 |
| 368 | 3300006847 | Ga0075431_100006337 | Ga0075431_10000633712 | 467 |
| 369 | 3300006914 | Ga0075436_100045497 | Ga0075436_1000454972 | 467 |
| 370 | 3300009094 | Ga0111539_10003555 | Ga0111539_1000355526 | 467 |
| 371 | 3300009094 | Ga0111539_10111706 | Ga0111539_101117063 | 467 |
| 372 | 3300009147 | Ga0114129_10010204 | Ga0114129_100102046 | 467 |
| 373 | 3300009147 | Ga0114129_10016756 | Ga0114129_100167569 | 467 |
| 374 | 3300009147 | Ga0114129_10153814 | Ga0114129_101538142 | 467 |
| 375 | 3300025885 | Ga0207653_10000003 | Ga0207653_10000003236 | 467 |
| 376 | 3300025885 | Ga0207653_10007668 | Ga0207653_100076682 | 467 |
| 377 | 3300025901 | Ga0207688_10007719 | Ga0207688_100077192 | 467 |
| 378 | 3300025910 | Ga0207684_10000532 | Ga0207684_100005324 | 467 |
| 379 | 3300025915 | Ga0207693_10003883 | Ga0207693_100038834 | 467 |
| 380 | 3300025922 | Ga0207646_10021867 | Ga0207646_100218672 | 467 |
| 381 | 3300026118 | Ga0207675_100035597 | Ga0207675_1000355972 | 467 |
| 382 | 3300026121 | Ga0207683_10008620 | Ga0207683_100086202 | 467 |
| 383 | 3300037312 | Ga0395899_0005777 | Ga0395899_0005777_7972_9405 | 467 |
| 384 | 3300037418 | Ga0395900_0011716 | Ga0395900_0011716_898_2331 | 467 |
| 385 | 3300037466 | Ga0395898_0004563 | Ga0395898_0004563_6739_8172 | 467 |
| 386 | 3300037471 | Ga0395905_0015079 | Ga0395905_0015079_200_1633 | 467 |
| 387 | 3300038443 | Ga0395901_0001203 | Ga0395901_0001203_11634_13067 | 467 |
| 388 | 3300048909 | Ga0496106_0015306 | Ga0496106_0015306_1171_2589 | 467 |
| 389 | 3300050507 | nmdc:mga05p37_24475_c1 | nmdc:mga05p37_24475_c1_159_1580 | 467 |
| 390 | 3300050511 | nmdc:mga08y16_70585_c1 | nmdc:mga08y16_70585_c1_736_2142 | 467 |
| 391 | 3300050511 | nmdc:mga08y16_7262_c1 | nmdc:mga08y16_7262_c1_2380_3813 | 467 |
| 392 | 3300050513 | nmdc:mga0rr50_139407_c1 | nmdc:mga0rr50_139407_c1_368_1801 | 467 |
| 393 | 3300050514 | nmdc:mga08x19_44688_c1 | nmdc:mga08x19_44688_c1_1023_2456 | 467 |
| 394 | 3300050515 | nmdc:mga0a205_287301_c1 | nmdc:mga0a205_287301_c1_49_1482 | 467 |
| 395 | 3300001990 | JGI24737J22298_10027834 | JGI24737J22298_100278341 | 468 |
| 396 | 3300005329 | Ga0070683_100002616 | Ga0070683_1000026169 | 468 |
| 397 | 3300005329 | Ga0070683_100038966 | Ga0070683_1000389662 | 468 |
| 398 | 3300005329 | Ga0070683_100102853 | Ga0070683_1001028532 | 468 |
| 399 | 3300005336 | Ga0070680_100034742 | Ga0070680_1000347423 | 468 |
| 400 | 3300005337 | Ga0070682_100003904 | Ga0070682_1000039044 | 468 |
| 401 | 3300005338 | Ga0068868_100024499 | Ga0068868_1000244992 | 468 |
| 402 | 3300005338 | Ga0068868_100030301 | Ga0068868_1000303012 | 468 |
| 403 | 3300005345 | Ga0070692_10004815 | Ga0070692_100048154 | 468 |
| 404 | 3300005366 | Ga0070659_100010230 | Ga0070659_1000102304 | 468 |
| 405 | 3300005436 | Ga0070713_100029881 | Ga0070713_1000298814 | 468 |
| 406 | 3300005436 | Ga0070713_100158618 | Ga0070713_1001586182 | 468 |
| 407 | 3300005438 | Ga0070701_10000968 | Ga0070701_100009682 | 468 |
| 408 | 3300005439 | Ga0070711_100098629 | Ga0070711_1000986292 | 468 |
| 409 | 3300005440 | Ga0070705_100003497 | Ga0070705_1000034976 | 468 |
| 410 | 3300005441 | Ga0070700_100001110 | Ga0070700_10000111014 | 468 |
| 411 | 3300005441 | Ga0070700_100016865 | Ga0070700_1000168653 | 468 |
| 412 | 3300005441 | Ga0070700_100020813 | Ga0070700_1000208132 | 468 |
| 413 | 3300005444 | Ga0070694_100034679 | Ga0070694_1000346792 | 468 |
| 414 | 3300005445 | Ga0070708_100166452 | Ga0070708_1001664522 | 468 |
| 415 | 3300005456 | Ga0070678_100018179 | Ga0070678_1000181792 | 468 |
| 416 | 3300005471 | Ga0070698_100224338 | Ga0070698_1002243381 | 468 |
| 417 | 3300005535 | Ga0070684_100008843 | Ga0070684_1000088434 | 468 |
| 418 | 3300005535 | Ga0070684_100058880 | Ga0070684_1000588802 | 468 |
| 419 | 3300005544 | Ga0070686_100016752 | Ga0070686_1000167524 | 468 |
| 420 | 3300005544 | Ga0070686_100018071 | Ga0070686_1000180713 | 468 |
| 421 | 3300005545 | Ga0070695_100049578 | Ga0070695_1000495781 | 468 |
| 422 | 3300005546 | Ga0070696_100003346 | Ga0070696_1000033465 | 468 |
| 423 | 3300005546 | Ga0070696_100113211 | Ga0070696_1001132112 | 468 |
| 424 | 3300005549 | Ga0070704_100031249 | Ga0070704_1000312493 | 468 |
| 425 | 3300005563 | Ga0068855_100369070 | Ga0068855_1003690701 | 468 |
| 426 | 3300005564 | Ga0070664_100007619 | Ga0070664_1000076195 | 468 |
| 427 | 3300005614 | Ga0068856_100046759 | Ga0068856_1000467591 | 468 |
| 428 | 3300005615 | Ga0070702_100005021 | Ga0070702_1000050213 | 468 |
| 429 | 3300005616 | Ga0068852_100001464 | Ga0068852_1000014643 | 468 |
| 430 | 3300005840 | Ga0068870_10006802 | Ga0068870_100068022 | 468 |
| 431 | 3300005841 | Ga0068863_100014867 | Ga0068863_1000148672 | 468 |
| 432 | 3300005842 | Ga0068858_100097274 | Ga0068858_1000972742 | 468 |
| 433 | 3300005843 | Ga0068860_100059877 | Ga0068860_1000598772 | 468 |
| 434 | 3300005844 | Ga0068862_100156509 | Ga0068862_1001565092 | 468 |
| 435 | 3300005981 | Ga0081538_10000847 | Ga0081538_100008476 | 468 |
| 436 | 3300005983 | Ga0081540_1000540 | Ga0081540_100054023 | 468 |
| 437 | 3300006051 | Ga0075364_10093860 | Ga0075364_100938602 | 468 |
| 438 | 3300006175 | Ga0070712_100015031 | Ga0070712_1000150312 | 468 |
| 439 | 3300006175 | Ga0070712_100054420 | Ga0070712_1000544202 | 468 |
| 440 | 3300006358 | Ga0068871_100135396 | Ga0068871_1001353962 | 468 |
| 441 | 3300006844 | Ga0075428_100085615 | Ga0075428_1000856152 | 468 |
| 442 | 3300006847 | Ga0075431_100036816 | Ga0075431_1000368164 | 468 |
| 443 | 3300006871 | Ga0075434_100039046 | Ga0075434_1000390463 | 468 |
| 444 | 3300006880 | Ga0075429_100102200 | Ga0075429_1001022002 | 468 |
| 445 | 3300006881 | Ga0068865_100014889 | Ga0068865_1000148893 | 468 |
| 446 | 3300006914 | Ga0075436_100005258 | Ga0075436_1000052583 | 468 |
| 447 | 3300007076 | Ga0075435_100003744 | Ga0075435_1000037443 | 468 |
| 448 | 3300009098 | Ga0105245_10010142 | Ga0105245_100101424 | 468 |
| 449 | 3300009098 | Ga0105245_10021666 | Ga0105245_100216664 | 468 |
| 450 | 3300009147 | Ga0114129_10018480 | Ga0114129_100184802 | 468 |
| 451 | 3300009148 | Ga0105243_10001866 | Ga0105243_100018662 | 468 |
| 452 | 3300009148 | Ga0105243_10046606 | Ga0105243_100466063 | 468 |
| 453 | 3300009176 | Ga0105242_10049642 | Ga0105242_100496422 | 468 |
| 454 | 3300009177 | Ga0105248_10099181 | Ga0105248_100991812 | 468 |
| 455 | 3300009553 | Ga0105249_10018944 | Ga0105249_100189445 | 468 |
| 456 | 3300009553 | Ga0105249_10068062 | Ga0105249_100680622 | 468 |
| 457 | 3300009553 | Ga0105249_10084325 | Ga0105249_100843251 | 468 |
| 458 | 3300010375 | Ga0105239_10056306 | Ga0105239_100563062 | 468 |
| 459 | 3300013102 | Ga0157371_10054053 | Ga0157371_100540532 | 468 |
| 460 | 3300013297 | Ga0157378_10075488 | Ga0157378_100754882 | 468 |
| 461 | 3300013306 | Ga0163162_10067125 | Ga0163162_100671252 | 468 |
| 462 | 3300013306 | Ga0163162_10175168 | Ga0163162_101751682 | 468 |
| 463 | 3300013307 | Ga0157372_10018570 | Ga0157372_100185707 | 468 |
| 464 | 3300013307 | Ga0157372_10051403 | Ga0157372_100514033 | 468 |
| 465 | 3300014325 | Ga0163163_10070955 | Ga0163163_100709552 | 468 |
| 466 | 3300014326 | Ga0157380_10005445 | Ga0157380_100054452 | 468 |
| 467 | 3300014745 | Ga0157377_10080487 | Ga0157377_100804872 | 468 |
| 468 | 3300014968 | Ga0157379_10009161 | Ga0157379_100091615 | 468 |
| 469 | 3300025904 | Ga0207647_10036296 | Ga0207647_100362962 | 468 |
| 470 | 3300025908 | Ga0207643_10001011 | Ga0207643_100010112 | 468 |
| 471 | 3300025908 | Ga0207643_10015154 | Ga0207643_100151542 | 468 |
| 472 | 3300025915 | Ga0207693_10005452 | Ga0207693_100054525 | 468 |
| 473 | 3300025915 | Ga0207693_10142012 | Ga0207693_101420122 | 468 |
| 474 | 3300025918 | Ga0207662_10010190 | Ga0207662_100101903 | 468 |
| 475 | 3300025923 | Ga0207681_10013066 | Ga0207681_100130663 | 468 |
| 476 | 3300025927 | Ga0207687_10006277 | Ga0207687_100062774 | 468 |
| 477 | 3300025932 | Ga0207690_10021396 | Ga0207690_100213963 | 468 |
| 478 | 3300025934 | Ga0207686_10080045 | Ga0207686_100800452 | 468 |
| 479 | 3300025935 | Ga0207709_10034955 | Ga0207709_100349552 | 468 |
| 480 | 3300025939 | Ga0207665_10084376 | Ga0207665_100843762 | 468 |
| 481 | 3300025939 | Ga0207665_10092677 | Ga0207665_100926772 | 468 |
| 482 | 3300025940 | Ga0207691_10004435 | Ga0207691_100044354 | 468 |
| 483 | 3300025941 | Ga0207711_10111273 | Ga0207711_101112732 | 468 |
| 484 | 3300025941 | Ga0207711_10204119 | Ga0207711_102041192 | 468 |
| 485 | 3300025944 | Ga0207661_10086028 | Ga0207661_100860282 | 468 |
| 486 | 3300025945 | Ga0207679_10050912 | Ga0207679_100509122 | 468 |
| 487 | 3300025960 | Ga0207651_10058821 | Ga0207651_100588212 | 468 |
| 488 | 3300025961 | Ga0207712_10089745 | Ga0207712_100897452 | 468 |
| 489 | 3300025972 | Ga0207668_10113477 | Ga0207668_101134771 | 468 |
| 490 | 3300025981 | Ga0207640_10045925 | Ga0207640_100459252 | 468 |
| 491 | 3300025981 | Ga0207640_10115995 | Ga0207640_101159952 | 468 |
| 492 | 3300026023 | Ga0207677_10012441 | Ga0207677_100124412 | 468 |
| 493 | 3300026023 | Ga0207677_10033195 | Ga0207677_100331952 | 468 |
| 494 | 3300026023 | Ga0207677_10069161 | Ga0207677_100691612 | 468 |
| 495 | 3300026035 | Ga0207703_10188417 | Ga0207703_101884172 | 468 |
| 496 | 3300026075 | Ga0207708_10000259 | Ga0207708_1000025942 | 468 |
| 497 | 3300026075 | Ga0207708_10012633 | Ga0207708_100126333 | 468 |
| 498 | 3300026075 | Ga0207708_10020262 | Ga0207708_100202622 | 468 |
| 499 | 3300026088 | Ga0207641_10240858 | Ga0207641_102408582 | 468 |
| 500 | 3300026089 | Ga0207648_10008677 | Ga0207648_100086773 | 468 |
| 501 | 3300026089 | Ga0207648_10010820 | Ga0207648_100108203 | 468 |
| 502 | 3300026116 | Ga0207674_10048408 | Ga0207674_100484082 | 468 |
| 503 | 3300026118 | Ga0207675_100013425 | Ga0207675_1000134252 | 468 |
| 504 | 3300026118 | Ga0207675_100018419 | Ga0207675_1000184192 | 468 |
| 505 | 3300026118 | Ga0207675_100091500 | Ga0207675_1000915002 | 468 |
| 506 | 3300026121 | Ga0207683_10021098 | Ga0207683_100210982 | 468 |
| 507 | 3300026121 | Ga0207683_10030331 | Ga0207683_100303312 | 468 |
| 508 | 3300026121 | Ga0207683_10102920 | Ga0207683_101029202 | 468 |
| 509 | 3300027907 | Ga0207428_10012111 | Ga0207428_100121113 | 468 |
| 510 | 3300027907 | Ga0207428_10039599 | Ga0207428_100395992 | 468 |
| 511 | 3300028380 | Ga0268265_10174404 | Ga0268265_101744042 | 468 |
| 512 | 3300031548 | Ga0307408_100051109 | Ga0307408_1000511091 | 468 |
| 513 | 3300031852 | Ga0307410_10002617 | Ga0307410_100026173 | 468 |
| 514 | 3300031911 | Ga0307412_10051655 | Ga0307412_100516552 | 468 |
| 515 | 3300031995 | Ga0307409_100001632 | Ga0307409_1000016329 | 468 |
| 516 | 3300032005 | Ga0307411_10003083 | Ga0307411_100030836 | 468 |
| 517 | 3300032126 | Ga0307415_100007945 | Ga0307415_1000079455 | 468 |
| 518 | 3300035724 | Ga0373933_0043663 | Ga0373933_0043663_370_1812 | 468 |
| 519 | 3300037312 | Ga0395899_0001680 | Ga0395899_0001680_9945_11357 | 468 |
| 520 | 3300037418 | Ga0395900_0005212 | Ga0395900_0005212_12194_13606 | 468 |
| 521 | 3300037466 | Ga0395898_0006011 | Ga0395898_0006011_3396_4808 | 468 |
| 522 | 3300037471 | Ga0395905_0002213 | Ga0395905_0002213_4849_6261 | 468 |
| 523 | 3300038443 | Ga0395901_0136926 | Ga0395901_0136926_134_1582 | 468 |
| 524 | 3300045976 | Ga0466967_0129069 | Ga0466967_0129069_167_1576 | 468 |
| 525 | 3300046462 | Ga0495651_0092432 | Ga0495651_0092432_69_1511 | 468 |
| 526 | 3300046463 | Ga0495653_0044155 | Ga0495653_0044155_1159_2601 | 468 |
| 527 | 3300046492 | Ga0495585_0047599 | Ga0495585_0047599_377_1789 | 468 |
| 528 | 3300046511 | Ga0495608_0038690 | Ga0495608_0038690_1200_2642 | 468 |
| 529 | 3300046516 | Ga0495628_0015666 | Ga0495628_0015666_2084_3526 | 468 |
| 530 | 3300046516 | Ga0495628_0056164 | Ga0495628_0056164_581_2023 | 468 |
| 531 | 3300046517 | Ga0495630_0003282 | Ga0495630_0003282_7665_9107 | 468 |
| 532 | 3300046529 | Ga0495652_0049663 | Ga0495652_0049663_663_2105 | 468 |
| 533 | 3300046533 | Ga0495640_0002482 | Ga0495640_0002482_11550_12992 | 468 |
| 534 | 3300046533 | Ga0495640_0080016 | Ga0495640_0080016_376_1818 | 468 |
| 535 | 3300046536 | Ga0495587_0038368 | Ga0495587_0038368_1415_2857 | 468 |
| 536 | 3300046559 | Ga0495667_0006175 | Ga0495667_0006175_3428_4870 | 468 |
| 537 | 3300046615 | Ga0495656_0021283 | Ga0495656_0021283_547_1959 | 468 |
| 538 | 3300046663 | Ga0495635_0010227 | Ga0495635_0010227_2218_3660 | 468 |
| 539 | 3300046675 | Ga0495657_0018225 | Ga0495657_0018225_1554_2996 | 468 |
| 540 | 3300046675 | Ga0495657_0020351 | Ga0495657_0020351_535_1977 | 468 |
| 541 | 3300046678 | Ga0495599_0039657 | Ga0495599_0039657_69_1511 | 468 |
| 542 | 3300046679 | Ga0495623_0061675 | Ga0495623_0061675_892_2334 | 468 |
| 543 | 3300046680 | Ga0495646_0021681 | Ga0495646_0021681_237_1679 | 468 |
| 544 | 3300046689 | Ga0495613_0012413 | Ga0495613_0012413_3605_5047 | 468 |
| 545 | 3300046809 | Ga0495600_0012431 | Ga0495600_0012431_1971_3413 | 468 |
| 546 | 3300047317 | Ga0495604_0005834 | Ga0495604_0005834_3939_5381 | 468 |
| 547 | 3300047319 | Ga0495674_0000584 | Ga0495674_0000584_28409_29851 | 468 |
| 548 | 3300047322 | Ga0495680_0000204 | Ga0495680_0000204_43954_45396 | 468 |
| 549 | 3300047322 | Ga0495680_0009074 | Ga0495680_0009074_2956_4398 | 468 |
| 550 | 3300047444 | Ga0495675_0025314 | Ga0495675_0025314_2326_3768 | 468 |
| 551 | 3300047471 | Ga0495684_0018185 | Ga0495684_0018185_1709_3151 | 468 |
| 552 | 3300048088 | Ga0495602_0012596 | Ga0495602_0012596_1820_3262 | 468 |
| 553 | 3300048903 | Ga0496100_0130376 | Ga0496100_0130376_47_1483 | 468 |
| 554 | 3300048904 | Ga0496101_0032909 | Ga0496101_0032909_1422_2858 | 468 |
| 555 | 3300048904 | Ga0496101_0051053 | Ga0496101_0051053_606_2042 | 468 |
| 556 | 3300048905 | Ga0496102_0024331 | Ga0496102_0024331_2332_3768 | 468 |
| 557 | 3300048905 | Ga0496102_0035034 | Ga0496102_0035034_390_1826 | 468 |
| 558 | 3300048906 | Ga0496103_0022573 | Ga0496103_0022573_2054_3490 | 468 |
| 559 | 3300048907 | Ga0496104_0000471 | Ga0496104_0000471_28442_29878 | 468 |
| 560 | 3300048907 | Ga0496104_0167687 | Ga0496104_0167687_280_1716 | 468 |
| 561 | 3300048908 | Ga0496105_0000792 | Ga0496105_0000792_15040_16470 | 468 |
| 562 | 3300048908 | Ga0496105_0000996 | Ga0496105_0000996_9537_10973 | 468 |
| 563 | 3300048908 | Ga0496105_0002314 | Ga0496105_0002314_3798_5234 | 468 |
| 564 | 3300048908 | Ga0496105_0005624 | Ga0496105_0005624_2335_3777 | 468 |
| 565 | 3300048909 | Ga0496106_0024196 | Ga0496106_0024196_1345_2781 | 468 |
| 566 | 3300048909 | Ga0496106_0028618 | Ga0496106_0028618_2180_3616 | 468 |
| 567 | 3300048910 | Ga0496107_0008594 | Ga0496107_0008594_1160_2596 | 468 |
| 568 | 3300048910 | Ga0496107_0070601 | Ga0496107_0070601_385_1821 | 468 |
| 569 | 3300048911 | Ga0496108_0001390 | Ga0496108_0001390_17598_19034 | 468 |
| 570 | 3300048911 | Ga0496108_0002323 | Ga0496108_0002323_11614_13050 | 468 |
| 571 | 3300048911 | Ga0496108_0019663 | Ga0496108_0019663_3412_4851 | 468 |
| 572 | 3300048911 | Ga0496108_0026152 | Ga0496108_0026152_1511_2947 | 468 |
| 573 | 3300048912 | Ga0496109_0011153 | Ga0496109_0011153_5017_6435 | 468 |
| 574 | 3300048912 | Ga0496109_0022223 | Ga0496109_0022223_2008_3444 | 468 |
| 575 | 3300048912 | Ga0496109_0078594 | Ga0496109_0078594_648_2060 | 468 |
| 576 | 3300048912 | Ga0496109_0088968 | Ga0496109_0088968_1036_2472 | 468 |
| 577 | 3300048913 | Ga0496110_0004397 | Ga0496110_0004397_8881_10317 | 468 |
| 578 | 3300048913 | Ga0496110_0005696 | Ga0496110_0005696_3065_4501 | 468 |
| 579 | 3300048914 | Ga0496111_0002846 | Ga0496111_0002846_4858_6300 | 468 |
| 580 | 3300048914 | Ga0496111_0014642 | Ga0496111_0014642_2110_3546 | 468 |
| 581 | 3300048915 | Ga0496112_0000082 | Ga0496112_0000082_55794_57230 | 468 |
| 582 | 3300048915 | Ga0496112_0000998 | Ga0496112_0000998_3093_4529 | 468 |
| 583 | 3300048915 | Ga0496112_0059486 | Ga0496112_0059486_623_2065 | 468 |
| 584 | 3300048915 | Ga0496112_0064683 | Ga0496112_0064683_1881_3317 | 468 |
| 585 | 3300048916 | Ga0496113_0000069 | Ga0496113_0000069_38906_40342 | 468 |
| 586 | 3300048916 | Ga0496113_0002742 | Ga0496113_0002742_6205_7641 | 468 |
| 587 | 3300048916 | Ga0496113_0022407 | Ga0496113_0022407_1845_3281 | 468 |
| 588 | 3300048916 | Ga0496113_0043752 | Ga0496113_0043752_47_1489 | 468 |
| 589 | 3300048916 | Ga0496113_0094731 | Ga0496113_0094731_489_1931 | 468 |
| 590 | 3300048917 | Ga0496114_0005625 | Ga0496114_0005625_758_2194 | 468 |
| 591 | 3300048917 | Ga0496114_0061597 | Ga0496114_0061597_1006_2442 | 468 |
| 592 | 3300048918 | Ga0496115_0011197 | Ga0496115_0011197_2949_4385 | 468 |
| 593 | 3300048918 | Ga0496115_0012161 | Ga0496115_0012161_477_1919 | 468 |
| 594 | 3300050489 | nmdc:mga03683_17990_c1 | nmdc:mga03683_17990_c1_285_1733 | 468 |
| 595 | 3300050491 | nmdc:mga00v17_77099_c1 | nmdc:mga00v17_77099_c1_535_1983 | 468 |
| 596 | 3300050507 | nmdc:mga05p37_24157_c1 | nmdc:mga05p37_24157_c1_2399_3841 | 468 |
| 597 | 3300050507 | nmdc:mga05p37_98278_c1 | nmdc:mga05p37_98278_c1_1258_2706 | 468 |
| 598 | 3300050508 | nmdc:mga09592_78386_c1 | nmdc:mga09592_78386_c1_289_1737 | 468 |
| 599 | 3300050509 | nmdc:mga0qj67_24303_c1 | nmdc:mga0qj67_24303_c1_2241_3689 | 468 |
| 600 | 3300050510 | nmdc:mga06r32_19290_c1 | nmdc:mga06r32_19290_c1_126_1538 | 468 |
| 601 | 3300050510 | nmdc:mga06r32_67596_c1 | nmdc:mga06r32_67596_c1_1373_2821 | 468 |
| 602 | 3300050512 | nmdc:mga0n895_233767_c1 | nmdc:mga0n895_233767_c1_159_1601 | 468 |
| 603 | 3300050513 | nmdc:mga0rr50_67185_c1 | nmdc:mga0rr50_67185_c1_1045_2487 | 468 |
| 604 | 3300053077 | Ga0495601_0080869 | Ga0495601_0080869_19_1461 | 468 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lgv-assembly1.cif.gz_B | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.9334 | 12 | 467 |
| 4lgv-assembly1.cif.gz_B | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.9275 | 12 | 467 |
| 4lgv-assembly1.cif.gz_A | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.9238 | 11 | 467 |
| 4lgv-assembly1.cif.gz_A | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.9219 | 11 | 467 |
| 7xhl-assembly2.cif.gz_E | complex structure of a glucose 6-phosphate dehydrogenase from zymomonas mobilis | 0.9212 | 16 | 463 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lgvD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9852 | 13 | 173 | 3.40.50.720 |
| af_P9WN71_8_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9784 | 13 | 171 | 3.40.50.720 |
| af_P9WN71_8_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9546 | 13 | 171 | 3.40.50.720 |
| af_P0AC53_13_173_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9446 | 18 | 172 | 3.40.50.720 |
| 4lgvC02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9393 | 176 | 467 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529SM67-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9867 | 11 | 142 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A529UCW2-F1-model_v4 | deleted | 0.9773 | 8 | 166 |
|
| AF-A0A527G8Q9-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9723 | 8 | 101 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A529UCW2-F1-model_v4 | deleted | 0.9713 | 8 | 166 |
|
| AF-T1B9F9-F1-model_v4 | Glucose-6-phosphate 1-dehydrogenase | 0.9691 | 183 | 342 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar