F468354

General Info

Members Datasets Scaffolds Average Seq Length
604 280 591 120

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100685636|Ga0070708_1006856362
Length 141
Sequence MISEPEGRGAAWTEERGTSDEGTRRPEGAPQASRRHGGNGDIAGGEPARSEWPLWEVFLRGKRGLNHVHVGSLHAADATMALHHARDLYTRRNEGVSIWVVRAADITASSPDEKDPFFVPSGDKVYRHPTFYDIPDTVPHI

Samples

Sample ID Description Type Environment
1 2643221641 Nocardioides sp. Root122 Isolate Unclassified
2 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
3 2739367898 Nocardioides sp. CF479 Isolate Unclassified
4 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
5 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
6 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
7 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
8 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
9 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
10 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
193 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
252 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
275 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
280 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.19
Metatranscriptomes 1.66
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 5.63
Rhizosphere 89.07
Stem 0
Stem Tuber 0
Unclassified 3.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10269501 3300005327 Bacteria 1448
2 Ga0070658_11072499 3300005327 Bacteria 701
3 Ga0070676_10036296 3300005328 Bacteria 2839
4 Ga0070683_100220769 3300005329 Bacteria 1801
5 Ga0070683_101643794 3300005329 Bacteria 618
6 Ga0070690_100892606 3300005330 Bacteria 695
7 Ga0070690_101576087 3300005330 Bacteria 532
8 Ga0070670_100194595 3300005331 Bacteria 1761
9 Ga0070670_100248279 3300005331 Bacteria 1550
10 Ga0070670_101122017 3300005331 Bacteria 717
11 Ga0068869_100028918 3300005334 Bacteria 3877
12 Ga0068869_100549990 3300005334 Bacteria 969
13 Ga0068869_101500091 3300005334 Bacteria 598
14 Ga0070682_100105339 3300005337 Bacteria 1869
15 Ga0070682_100190225 3300005337 Bacteria 1440
16 Ga0070682_100313011 3300005337 Bacteria 1156
17 Ga0070682_100413008 3300005337 Bacteria 1024
18 Ga0068868_100106928 3300005338 Bacteria 2270
19 Ga0068868_100357344 3300005338 Bacteria 1252
20 Ga0068868_100753042 3300005338 Bacteria 875
21 Ga0070689_100701741 3300005340 Bacteria 884
22 Ga0070687_101507977 3300005343 Bacteria 506
23 Ga0070661_100399382 3300005344 Bacteria 1087
24 Ga0070661_101511007 3300005344 Bacteria 567
25 Ga0070661_101745912 3300005344 Bacteria 528
26 Ga0070692_10062655 3300005345 Bacteria 1963
27 Ga0070668_100020774 3300005347 Bacteria 4959
28 Ga0070668_100223470 3300005347 Bacteria 1554
29 Ga0070675_101669049 3300005354 Bacteria 588
30 Ga0070671_100001754 3300005355 Bacteria 16478
31 Ga0070674_100016051 3300005356 Bacteria 4689
32 Ga0070688_100259688 3300005365 Bacteria 1240
33 Ga0070688_100545731 3300005365 Bacteria 880
34 Ga0070659_100009212 3300005366 Bacteria 7245
35 Ga0070659_100894678 3300005366 Bacteria 776
36 Ga0070659_101900861 3300005366 Bacteria 534
37 Ga0070667_100704230 3300005367 Bacteria 935
38 Ga0070667_101147725 3300005367 Bacteria 727
39 Ga0070667_101372804 3300005367 Bacteria 663
40 Ga0070709_10574087 3300005434 Bacteria 865
41 Ga0070714_100511734 3300005435 Bacteria 1146
42 Ga0070714_100589793 3300005435 Bacteria 1067
43 Ga0070714_101161575 3300005435 Bacteria 753
44 Ga0070714_101362271 3300005435 Bacteria 693
45 Ga0070713_100213352 3300005436 Bacteria 1749
46 Ga0070713_100600182 3300005436 Bacteria 1046
47 Ga0070713_101937499 3300005436 Bacteria 572
48 Ga0070701_10631820 3300005438 Bacteria 713
49 Ga0070700_100114084 3300005441 Bacteria 1801
50 Ga0070700_101050019 3300005441 Bacteria 672
51 Ga0070700_101292022 3300005441 Bacteria 613
52 Ga0070708_100685636 3300005445 Bacteria 965
53 Ga0070663_100000691 3300005455 Bacteria 18161
54 Ga0070663_100008282 3300005455 Bacteria 6387
55 Ga0070663_100072005 3300005455 Bacteria 2516
56 Ga0070663_100566307 3300005455 Bacteria 951
57 Ga0070663_100853972 3300005455 Bacteria 784
58 Ga0070663_101159059 3300005455 Bacteria 678
59 Ga0070678_100139753 3300005456 Bacteria 1936
60 Ga0070678_100772213 3300005456 Bacteria 871
61 Ga0070678_101016011 3300005456 Bacteria 763
62 Ga0070662_100429064 3300005457 Bacteria 1095
63 Ga0070681_10230902 3300005458 Bacteria 1765
64 Ga0070685_10367558 3300005466 Bacteria 987
65 Ga0070685_10431040 3300005466 Bacteria 919
66 Ga0070706_100522069 3300005467 Bacteria 1105
67 Ga0070679_100281467 3300005530 Bacteria 1616
68 Ga0070679_101999825 3300005530 Bacteria 529
69 Ga0070684_100078631 3300005535 Bacteria 2914
70 Ga0070684_101584601 3300005535 Bacteria 618
71 Ga0070665_100002791 3300005548 Bacteria 18933
72 Ga0070665_100108059 3300005548 Bacteria 2784
73 Ga0070665_100175177 3300005548 Bacteria 2146
74 Ga0070665_101098648 3300005548 Bacteria 807
75 Ga0070664_100006472 3300005564 Bacteria 9442
76 Ga0070664_100155191 3300005564 Bacteria 2023
77 Ga0070664_100460327 3300005564 Bacteria 1169
78 Ga0070664_100474221 3300005564 Bacteria 1151
79 Ga0070664_100474704 3300005564 Bacteria 1150
80 Ga0070664_100775832 3300005564 Bacteria 895
81 Ga0068857_100080862 3300005577 Bacteria 2901
82 Ga0068857_100172991 3300005577 Bacteria 1963
83 Ga0068857_100237112 3300005577 Bacteria 1669
84 Ga0068857_101970127 3300005577 Bacteria 573
85 Ga0068856_100085216 3300005614 Bacteria 3139
86 Ga0068856_100120619 3300005614 Bacteria 2623
87 Ga0068856_100415097 3300005614 Bacteria 1366
88 Ga0068856_100453302 3300005614 Bacteria 1303
89 Ga0068856_101438173 3300005614 Bacteria 704
90 Ga0068856_101586838 3300005614 Bacteria 668
91 Ga0068852_100037968 3300005616 Bacteria 4044
92 Ga0068852_100198975 3300005616 Bacteria 1895
93 Ga0068852_100344764 3300005616 Bacteria 1453
94 Ga0068859_100414361 3300005617 Bacteria 1443
95 Ga0068859_102069549 3300005617 Bacteria 628
96 Ga0068864_100147606 3300005618 Bacteria 2127
97 Ga0068864_100197539 3300005618 Bacteria 1846
98 Ga0068851_10113572 3300005834 Bacteria 1448
99 Ga0068870_10091369 3300005840 Bacteria 1702
100 Ga0068863_100125060 3300005841 Bacteria 2453
101 Ga0068863_100934144 3300005841 Bacteria 869
102 Ga0068858_100332844 3300005842 Bacteria 1452
103 Ga0068858_101796537 3300005842 Bacteria 606
104 Ga0068860_100077660 3300005843 Bacteria 3158
105 Ga0068860_100327261 3300005843 Bacteria 1505
106 Ga0068860_102212982 3300005843 Bacteria 571
107 Ga0068862_100013982 3300005844 Bacteria 6655
108 Ga0070717_10240354 3300006028 Bacteria 1597
109 Ga0075364_10077973 3300006051 Bacteria 2187
110 Ga0070716_100204696 3300006173 Bacteria 1314
111 Ga0075362_10180173 3300006177 Bacteria 1024
112 Ga0075428_102583332 3300006844 Bacteria 519
113 Ga0097620_100414356 3300006931 Bacteria 1443
114 Ga0097620_102069647 3300006931 Bacteria 628
115 Ga0105251_10190647 3300009011 Bacteria 923
116 Ga0105240_11584503 3300009093 Bacteria 685
117 Ga0105245_10052805 3300009098 Bacteria 3646
118 Ga0105245_10576387 3300009098 Bacteria 1149
119 Ga0105245_10773039 3300009098 Bacteria 997
120 Ga0105245_12903688 3300009098 Bacteria 531
121 Ga0105247_10059559 3300009101 Bacteria 2364
122 Ga0105247_10468662 3300009101 Bacteria 912
123 Ga0114129_11368718 3300009147 Bacteria 874
124 Ga0105243_10734497 3300009148 Bacteria 966
125 Ga0105243_10800371 3300009148 Bacteria 929
126 Ga0105242_10003049 3300009176 Bacteria 13097
127 Ga0105248_10317590 3300009177 Bacteria 1754
128 Ga0105237_10056196 3300009545 Bacteria 3940
129 Ga0105237_10139646 3300009545 Bacteria 2417
130 Ga0105237_11597797 3300009545 Bacteria 659
131 Ga0105237_12055133 3300009545 Bacteria 580
132 Ga0105249_10083692 3300009553 Bacteria 2970
133 Ga0105249_11256087 3300009553 Bacteria 812
134 Ga0105239_10062376 3300010375 Bacteria 4091
135 Ga0105239_10218122 3300010375 Bacteria 2139
136 Ga0105239_10705003 3300010375 Bacteria 1154
137 Ga0105239_13122216 3300010375 Bacteria 540
138 Ga0105246_10369010 3300011119 Bacteria 1182
139 Ga0105246_10881363 3300011119 Bacteria 801
140 Ga0157369_10520850 3300013105 Bacteria 1230
141 Ga0157374_10121598 3300013296 Bacteria 2520
142 Ga0157374_10565014 3300013296 Bacteria 1146
143 Ga0157374_10765673 3300013296 Bacteria 980
144 Ga0157374_11496161 3300013296 Bacteria 698
145 Ga0157378_11185904 3300013297 Bacteria 803
146 Ga0157378_11188518 3300013297 Bacteria 802
147 Ga0157378_13029934 3300013297 Bacteria 521
148 Ga0163162_10089061 3300013306 Bacteria 3166
149 Ga0163162_10799951 3300013306 Bacteria 1060
150 Ga0163162_11067355 3300013306 Bacteria 914
151 Ga0157372_10164614 3300013307 Bacteria 2564
152 Ga0157372_12182887 3300013307 Bacteria 636
153 Ga0157375_10342218 3300013308 Bacteria 1661
154 Ga0157375_13200029 3300013308 Bacteria 546
155 Ga0163163_10664361 3300014325 Bacteria 1106
156 Ga0163163_12059428 3300014325 Bacteria 630
157 Ga0157380_10198317 3300014326 Bacteria 1778
158 Ga0157377_11288940 3300014745 Bacteria 570
159 Ga0157379_10964074 3300014968 Bacteria 812
160 Ga0157379_12454913 3300014968 Bacteria 521
161 Ga0197907_11378065 3300020069 Bacteria 1533
162 Ga0206351_10913268 3300020077 Bacteria 1859
163 Ga0206352_11204810 3300020078 Bacteria 998
164 Ga0206350_10093833 3300020080 Bacteria 599
165 Ga0206354_10112504 3300020081 Bacteria 859
166 Ga0206354_11164954 3300020081 Bacteria 1313
167 Ga0206353_11199355 3300020082 Bacteria 3057
168 Ga0213876_10079821 3300021384 Bacteria 1729
169 Ga0213875_10006652 3300021388 Bacteria 6039
170 Ga0213875_10024074 3300021388 Bacteria 2905
171 Ga0213875_10026935 3300021388 Bacteria 2735
172 Ga0224712_10055690 3300022467 Bacteria 1556
173 Ga0224712_10074108 3300022467 Bacteria 1390
174 Ga0207656_10155617 3300025321 Bacteria 1085
175 Ga0207692_10043552 3300025898 Bacteria 2234
176 Ga0207642_10278184 3300025899 Bacteria 961
177 Ga0207710_10632123 3300025900 Bacteria 560
178 Ga0207688_10064397 3300025901 Bacteria 2070
179 Ga0207688_10339570 3300025901 Bacteria 924
180 Ga0207688_10354605 3300025901 Bacteria 904
181 Ga0207699_10263628 3300025906 Bacteria 1192
182 Ga0207645_10046690 3300025907 Bacteria 2766
183 Ga0207645_10169397 3300025907 Bacteria 1431
184 Ga0207643_10027448 3300025908 Bacteria 3157
185 Ga0207705_10146402 3300025909 Bacteria 1767
186 Ga0207705_10642545 3300025909 Bacteria 825
187 Ga0207705_11016734 3300025909 Bacteria 640
188 Ga0207684_10627105 3300025910 Bacteria 917
189 Ga0207707_10406869 3300025912 Bacteria 1168
190 Ga0207695_10760280 3300025913 Bacteria 849
191 Ga0207671_10255181 3300025914 Bacteria 1379
192 Ga0207693_10007426 3300025915 Bacteria 9013
193 Ga0207663_10077362 3300025916 Bacteria 2165
194 Ga0207660_10411964 3300025917 Bacteria 1089
195 Ga0207657_10052911 3300025919 Bacteria 3521
196 Ga0207657_10122354 3300025919 Bacteria 2140
197 Ga0207649_10023680 3300025920 Bacteria 3559
198 Ga0207649_10247874 3300025920 Bacteria 1281
199 Ga0207652_10379756 3300025921 Bacteria 1275
200 Ga0207650_10364322 3300025925 Bacteria 1191
201 Ga0207650_10518328 3300025925 Bacteria 997
202 Ga0207659_10339880 3300025926 Bacteria 1243
203 Ga0207659_11795545 3300025926 Bacteria 521
204 Ga0207687_10244508 3300025927 Bacteria 1424
205 Ga0207687_10518425 3300025927 Bacteria 997
206 Ga0207700_10106839 3300025928 Bacteria 2245
207 Ga0207700_10117145 3300025928 Bacteria 2153
208 Ga0207664_10128207 3300025929 Bacteria 2132
209 Ga0207644_10001034 3300025931 Bacteria 17840
210 Ga0207690_10431260 3300025932 Bacteria 1056
211 Ga0207690_10595328 3300025932 Bacteria 902
212 Ga0207690_10993985 3300025932 Bacteria 698
213 Ga0207690_11077102 3300025932 Bacteria 670
214 Ga0207706_10232184 3300025933 Bacteria 1614
215 Ga0207706_10609402 3300025933 Bacteria 937
216 Ga0207709_10607702 3300025935 Bacteria 866
217 Ga0207670_11306249 3300025936 Bacteria 615
218 Ga0207670_11421573 3300025936 Bacteria 589
219 Ga0207669_11243339 3300025937 Bacteria 632
220 Ga0207665_10034114 3300025939 Bacteria 3377
221 Ga0207691_10057259 3300025940 Bacteria 3548
222 Ga0207711_10528909 3300025941 Bacteria 1100
223 Ga0207689_10092906 3300025942 Bacteria 2479
224 Ga0207689_10221508 3300025942 Bacteria 1563
225 Ga0207689_10434379 3300025942 Bacteria 1096
226 Ga0207661_10097432 3300025944 Bacteria 2463
227 Ga0207661_10482111 3300025944 Bacteria 1132
228 Ga0207661_10657465 3300025944 Bacteria 963
229 Ga0207661_11557065 3300025944 Bacteria 605
230 Ga0207679_10683221 3300025945 Bacteria 930
231 Ga0207679_11169718 3300025945 Bacteria 706
232 Ga0207667_10008089 3300025949 Bacteria 12537
233 Ga0207651_10868728 3300025960 Bacteria 802
234 Ga0207712_10212330 3300025961 Bacteria 1542
235 Ga0207712_11248439 3300025961 Bacteria 663
236 Ga0207668_10048725 3300025972 Bacteria 2909
237 Ga0207668_10407151 3300025972 Bacteria 1151
238 Ga0207668_12115415 3300025972 Bacteria 507
239 Ga0207640_10112592 3300025981 Bacteria 1932
240 Ga0207640_10567443 3300025981 Bacteria 956
241 Ga0207658_10396614 3300025986 Bacteria 1212
242 Ga0207658_10428780 3300025986 Bacteria 1167
243 Ga0207658_10849801 3300025986 Bacteria 830
244 Ga0207677_10029498 3300026023 Bacteria 3487
245 Ga0207677_10088203 3300026023 Bacteria 2248
246 Ga0207677_10173351 3300026023 Bacteria 1689
247 Ga0207703_10087351 3300026035 Bacteria 2614
248 Ga0207703_10551390 3300026035 Bacteria 1087
249 Ga0207639_10158178 3300026041 Bacteria 1906
250 Ga0207678_10000314 3300026067 Bacteria 43676
251 Ga0207678_10037560 3300026067 Bacteria 4212
252 Ga0207678_10065198 3300026067 Bacteria 3128
253 Ga0207678_10230295 3300026067 Bacteria 1586
254 Ga0207708_10269888 3300026075 Bacteria 1376
255 Ga0207708_10564314 3300026075 Bacteria 961
256 Ga0207708_10656241 3300026075 Bacteria 893
257 Ga0207708_11036099 3300026075 Bacteria 714
258 Ga0207702_10361772 3300026078 Bacteria 1391
259 Ga0207702_10617836 3300026078 Bacteria 1064
260 Ga0207702_11275340 3300026078 Bacteria 729
261 Ga0207641_10105936 3300026088 Bacteria 2484
262 Ga0207641_11330508 3300026088 Bacteria 719
263 Ga0207648_10315635 3300026089 Bacteria 1404
264 Ga0207676_10162642 3300026095 Bacteria 1935
265 Ga0207676_11635771 3300026095 Bacteria 642
266 Ga0207676_12440977 3300026095 Bacteria 520
267 Ga0207674_10048933 3300026116 Bacteria 4325
268 Ga0207674_10198458 3300026116 Bacteria 1956
269 Ga0207674_10900824 3300026116 Bacteria 853
270 Ga0207674_11599728 3300026116 Bacteria 620
271 Ga0207675_100165113 3300026118 Bacteria 2114
272 Ga0207675_100221368 3300026118 Bacteria 1824
273 Ga0207675_100830527 3300026118 Bacteria 938
274 Ga0207683_10076164 3300026121 Bacteria 2970
275 Ga0207683_10426422 3300026121 Bacteria 1222
276 Ga0207698_10110995 3300026142 Bacteria 2298
277 Ga0207698_10307224 3300026142 Bacteria 1479
278 Ga0268266_10013711 3300028379 Bacteria 6980
279 Ga0268266_10112529 3300028379 Bacteria 2413
280 Ga0268266_10176996 3300028379 Bacteria 1940
281 Ga0268266_10416481 3300028379 Bacteria 1272
282 Ga0268265_11258868 3300028380 Bacteria 739
283 Ga0268264_10008083 3300028381 Bacteria 8749
284 Ga0268264_10486881 3300028381 Bacteria 1201
285 Ga0307513_10052060 3300031456 Bacteria 4411
286 Ga0307408_101100507 3300031548 Bacteria 737
287 Ga0307405_10203021 3300031731 Bacteria 1441
288 Ga0307405_10257565 3300031731 Bacteria 1301
289 Ga0307405_10332957 3300031731 Bacteria 1164
290 Ga0307405_10562259 3300031731 Bacteria 925
291 Ga0307413_10277088 3300031824 Bacteria 1259
292 Ga0307413_10392391 3300031824 Bacteria 1085
293 Ga0307413_10802573 3300031824 Bacteria 791
294 Ga0307410_10016988 3300031852 Bacteria 4356
295 Ga0307410_10118415 3300031852 Bacteria 1927
296 Ga0307410_10162267 3300031852 Bacteria 1676
297 Ga0307410_10225713 3300031852 Bacteria 1443
298 Ga0307410_10244451 3300031852 Bacteria 1392
299 Ga0307410_10662954 3300031852 Bacteria 876
300 Ga0307410_10702803 3300031852 Bacteria 852
301 Ga0307410_11831940 3300031852 Bacteria 539
302 Ga0307406_10014342 3300031901 Bacteria 4558
303 Ga0307406_10152468 3300031901 Bacteria 1650
304 Ga0307406_12089429 3300031901 Bacteria 507
305 Ga0307406_12123630 3300031901 Bacteria 503
306 Ga0307407_10034549 3300031903 Bacteria 2769
307 Ga0307407_10211387 3300031903 Bacteria 1306
308 Ga0307407_10456062 3300031903 Bacteria 929
309 Ga0307412_10184827 3300031911 Bacteria 1571
310 Ga0307412_10541266 3300031911 Bacteria 976
311 Ga0307409_100253164 3300031995 Bacteria 1611
312 Ga0307409_100259222 3300031995 Bacteria 1594
313 Ga0307409_100276946 3300031995 Bacteria 1548
314 Ga0307409_100345194 3300031995 Bacteria 1402
315 Ga0307409_100445573 3300031995 Bacteria 1248
316 Ga0307409_100906225 3300031995 Bacteria 896
317 Ga0307409_101514750 3300031995 Bacteria 698
318 Ga0307409_101727881 3300031995 Bacteria 654
319 Ga0307416_100006810 3300032002 Bacteria 7189
320 Ga0307416_100052929 3300032002 Bacteria 3253
321 Ga0307416_100707586 3300032002 Bacteria 1097
322 Ga0307416_101319095 3300032002 Bacteria 827
323 Ga0307416_101547146 3300032002 Bacteria 769
324 Ga0307416_102204462 3300032002 Bacteria 652
325 Ga0307416_103013596 3300032002 Bacteria 563
326 Ga0307414_10230363 3300032004 Bacteria 1527
327 Ga0307414_10744700 3300032004 Bacteria 890
328 Ga0307414_10936421 3300032004 Bacteria 795
329 Ga0307414_10980978 3300032004 Bacteria 777
330 Ga0307414_11098905 3300032004 Bacteria 734
331 Ga0307414_12063431 3300032004 Bacteria 532
332 Ga0307411_10082528 3300032005 Bacteria 2217
333 Ga0307411_10130150 3300032005 Bacteria 1838
334 Ga0307411_10632964 3300032005 Bacteria 924
335 Ga0307411_10907144 3300032005 Bacteria 783
336 Ga0307415_100001340 3300032126 Bacteria 11693
337 Ga0307415_100060707 3300032126 Bacteria 2614
338 Ga0307415_100359781 3300032126 Bacteria 1228
339 Ga0307415_100591492 3300032126 Bacteria 986
340 Ga0307415_100721349 3300032126 Bacteria 902
341 Ga0307415_100783752 3300032126 Bacteria 868
342 Ga0307415_100913198 3300032126 Bacteria 810
343 Ga0373926_0000194 3300035083 Bacteria 13938
344 Ga0373934_0155486 3300035086 Bacteria 937
345 Ga0373923_0082203 3300035111 Bacteria 1398
346 Ga0373936_0002169 3300035113 Bacteria 7316
347 Ga0373945_0000105 3300035116 Bacteria 19853
348 Ga0373943_0002905 3300035170 Bacteria 7771
349 Ga0373946_0000340 3300035171 Bacteria 15068
350 Ga0373955_0014029 3300035172 Bacteria 3890
351 Ga0373924_0110158 3300035410 Bacteria 1189
352 Ga0373931_0379485 3300035691 Bacteria 891
353 Ga0373935_0000837 3300035692 Bacteria 16568
354 Ga0373927_0001172 3300035695 Bacteria 19853
355 Ga0373933_0083061 3300035724 Bacteria 1967
356 Ga0373947_0001050 3300035725 Bacteria 16852
357 Ga0373937_0244094 3300036401 Bacteria 1692
358 Ga0373937_1107752 3300036401 Bacteria 740
359 Ga0373937_1686181 3300036401 Bacteria 581
360 Ga0373925_0001881 3300037068 Bacteria 17436
361 Ga0395899_0190128 3300037312 Bacteria 1437
362 Ga0395900_0010397 3300037418 Bacteria 9515
363 Ga0395900_0263376 3300037418 Bacteria 1721
364 Ga0395900_0352956 3300037418 Bacteria 1444
365 Ga0395898_0218095 3300037466 Bacteria 1820
366 Ga0395898_0365696 3300037466 Bacteria 1375
367 Ga0395905_0443169 3300037471 Bacteria 1196
368 Ga0395905_1517683 3300037471 Bacteria 574
369 Ga0436364_1349894 3300037853 Bacteria 5412
370 Ga0436364_1565185 3300037853 Bacteria 6222
371 Ga0395901_0020349 3300038443 Bacteria 6793
372 Ga0436365_1315947 3300039437 Bacteria 1730
373 Ga0436365_1348550 3300039437 Bacteria 1825
374 Ga0436365_1766708 3300039437 Bacteria 2186
375 Ga0436363_0364438 3300039450 Bacteria 683
376 Ga0436363_0611301 3300039450 Bacteria 1024
377 Ga0436363_1696899 3300039450 Bacteria 530
378 Ga0451791_1509369 3300041451 Bacteria 1235
379 Ga0451791_1519585 3300041451 Bacteria 520
380 Ga0451795_0932728 3300041456 Bacteria 1113
381 Ga0451802_2100189 3300041460 Bacteria 644
382 Ga0451804_0899706 3300041463 Bacteria 746
383 Ga0451845_0191103 3300041501 Bacteria 654
384 Ga0439440_0072210 3300042993 Bacteria 900
385 Ga0466969_0332187 3300044656 Bacteria 688
386 Ga0466972_0009259 3300044658 Bacteria 4948
387 Ga0466972_0221839 3300044658 Bacteria 884
388 Ga0466972_0495730 3300044658 Bacteria 575
389 Ga0466965_0013665 3300044683 Bacteria 3833
390 Ga0466965_0109885 3300044683 Bacteria 1416
391 Ga0466965_0115925 3300044683 Bacteria 1380
392 Ga0466965_0132017 3300044683 Bacteria 1296
393 Ga0466965_0146068 3300044683 Bacteria 1234
394 Ga0466965_0212713 3300044683 Bacteria 1028
395 Ga0466965_0266200 3300044683 Bacteria 922
396 Ga0466965_0309531 3300044683 Bacteria 858
397 Ga0466965_0748531 3300044683 Bacteria 563
398 Ga0466966_0017769 3300044684 Bacteria 4696
399 Ga0466966_0119260 3300044684 Bacteria 1622
400 Ga0466966_0265220 3300044684 Bacteria 1034
401 Ga0466966_0277251 3300044684 Bacteria 1009
402 Ga0466966_0278157 3300044684 Bacteria 1007
403 Ga0466966_0306645 3300044684 Bacteria 954
404 Ga0466966_0318221 3300044684 Bacteria 935
405 Ga0466961_0014273 3300044693 Bacteria 5099
406 Ga0466961_0357448 3300044693 Bacteria 888
407 Ga0466961_0403772 3300044693 Bacteria 829
408 Ga0466961_0428840 3300044693 Bacteria 801
409 Ga0466961_0642096 3300044693 Bacteria 637
410 Ga0466961_0677403 3300044693 Bacteria 618
411 Ga0466963_0070176 3300044694 Bacteria 2356
412 Ga0466963_0278197 3300044694 Bacteria 1176
413 Ga0466963_0314297 3300044694 Bacteria 1102
414 Ga0466963_0346501 3300044694 Bacteria 1046
415 Ga0466963_0420631 3300044694 Bacteria 942
416 Ga0466963_0556022 3300044694 Bacteria 810
417 Ga0466963_0576829 3300044694 Bacteria 794
418 Ga0466963_0758678 3300044694 Bacteria 684
419 Ga0466963_0781445 3300044694 Bacteria 673
420 Ga0466963_1034945 3300044694 Bacteria 578
421 Ga0466964_0185912 3300044706 Bacteria 988
422 Ga0466964_0857081 3300044706 Bacteria 517
423 Ga0466964_0883207 3300044706 Bacteria 510
424 Ga0466971_0046224 3300044719 Bacteria 1957
425 Ga0466971_0111762 3300044719 Bacteria 1261
426 Ga0466971_0177692 3300044719 Bacteria 1000
427 Ga0466971_0231490 3300044719 Bacteria 877
428 Ga0466971_0418321 3300044719 Bacteria 655
429 Ga0466968_0188409 3300044735 Bacteria 962
430 Ga0466968_0664211 3300044735 Bacteria 530
431 Ga0466970_0017578 3300044765 Bacteria 3696
432 Ga0466970_0018477 3300044765 Bacteria 3609
433 Ga0466970_0066688 3300044765 Bacteria 1932
434 Ga0466970_0110371 3300044765 Bacteria 1502
435 Ga0466970_0135278 3300044765 Bacteria 1356
436 Ga0466970_0171037 3300044765 Bacteria 1204
437 Ga0466970_0281640 3300044765 Bacteria 935
438 Ga0466970_0346297 3300044765 Bacteria 843
439 Ga0466970_0561845 3300044765 Bacteria 660
440 Ga0466970_0680592 3300044765 Bacteria 599
441 Ga0466957_0062976 3300044842 Bacteria 2279
442 Ga0466957_0129200 3300044842 Bacteria 1617
443 Ga0466957_0173790 3300044842 Bacteria 1404
444 Ga0466957_0174924 3300044842 Bacteria 1400
445 Ga0466957_0176787 3300044842 Bacteria 1392
446 Ga0466957_0292105 3300044842 Bacteria 1093
447 Ga0466957_0548290 3300044842 Bacteria 806
448 Ga0466960_0001071 3300044901 Bacteria 9809
449 Ga0466960_0015607 3300044901 Bacteria 3278
450 Ga0466960_0032398 3300044901 Bacteria 2419
451 Ga0466960_0118444 3300044901 Bacteria 1384
452 Ga0466960_0258515 3300044901 Bacteria 969
453 Ga0466960_0326648 3300044901 Bacteria 870
454 Ga0466960_0352644 3300044901 Bacteria 839
455 Ga0466960_0432166 3300044901 Bacteria 763
456 Ga0466960_0440660 3300044901 Bacteria 756
457 Ga0466960_0630885 3300044901 Bacteria 638
458 Ga0466960_0658606 3300044901 Bacteria 625
459 Ga0466960_0828128 3300044901 Bacteria 561
460 Ga0466959_0151691 3300045049 Bacteria 1633
461 Ga0466959_0286376 3300045049 Bacteria 1130
462 Ga0466959_0295720 3300045049 Bacteria 1109
463 Ga0466959_0397504 3300045049 Bacteria 937
464 Ga0466959_0398750 3300045049 Bacteria 935
465 Ga0466959_0410028 3300045049 Bacteria 920
466 Ga0466959_0415623 3300045049 Bacteria 913
467 Ga0466959_0505406 3300045049 Bacteria 817
468 Ga0466958_0109356 3300045836 Bacteria 1725
469 Ga0466958_0193846 3300045836 Bacteria 1292
470 Ga0466958_0306344 3300045836 Bacteria 1020
471 Ga0466958_0315236 3300045836 Bacteria 1005
472 Ga0466958_0403811 3300045836 Bacteria 882
473 Ga0466958_0516290 3300045836 Bacteria 775
474 Ga0466958_0545877 3300045836 Bacteria 753
475 Ga0466958_0592938 3300045836 Bacteria 721
476 Ga0466958_0701008 3300045836 Bacteria 659
477 Ga0466958_0737581 3300045836 Bacteria 642
478 Ga0466967_0043011 3300045976 Bacteria 3909
479 Ga0466967_0069258 3300045976 Bacteria 3153
480 Ga0466967_0107869 3300045976 Bacteria 2554
481 Ga0466967_0113444 3300045976 Bacteria 2493
482 Ga0466967_0129378 3300045976 Bacteria 2342
483 Ga0466967_0191642 3300045976 Bacteria 1932
484 Ga0466967_0207899 3300045976 Bacteria 1856
485 Ga0466967_0220429 3300045976 Bacteria 1802
486 Ga0466967_0247435 3300045976 Bacteria 1702
487 Ga0466967_0285056 3300045976 Bacteria 1586
488 Ga0466967_0398054 3300045976 Bacteria 1339
489 Ga0466967_0626237 3300045976 Bacteria 1063
490 Ga0466967_0901519 3300045976 Bacteria 879
491 Ga0466967_0939305 3300045976 Bacteria 860
492 Ga0466967_0983356 3300045976 Bacteria 840
493 Ga0466967_1953551 3300045976 Bacteria 583
494 Ga0466967_2078526 3300045976 Bacteria 564
495 Ga0466967_2112610 3300045976 Bacteria 559
496 Ga0466967_2271923 3300045976 Bacteria 538
497 Ga0466967_2283818 3300045976 Bacteria 537
498 Ga0495653_0005402 3300046463 Bacteria 10402
499 Ga0495582_0029785 3300046473 Bacteria 2997
500 Ga0495662_0007276 3300046476 Bacteria 5478
501 Ga0495664_0000357 3300046477 Bacteria 22053
502 Ga0495608_0030423 3300046511 Bacteria 3655
503 Ga0495616_0150365 3300046513 Bacteria 1054
504 Ga0495618_0394399 3300046514 Bacteria 847
505 Ga0495630_0003829 3300046517 Bacteria 10502
506 Ga0495631_0177532 3300046518 Bacteria 913
507 Ga0495652_0089898 3300046529 Bacteria 2513
508 Ga0495640_0065901 3300046533 Bacteria 2444
509 Ga0495667_0013507 3300046559 Bacteria 5525
510 Ga0495656_0266203 3300046615 Bacteria 870
511 Ga0495668_0556789 3300046616 Bacteria 633
512 Ga0495668_0865714 3300046616 Bacteria 501
513 Ga0495635_0003522 3300046663 Bacteria 10831
514 Ga0495661_0628456 3300046665 Bacteria 503
515 Ga0495657_0192638 3300046675 Bacteria 1245
516 Ga0495599_0041964 3300046678 Bacteria 2871
517 Ga0495647_0110872 3300046681 Bacteria 1145
518 Ga0495624_0016684 3300046690 Bacteria 4943
519 Ga0495600_0180717 3300046809 Bacteria 1359
520 Ga0495674_0001081 3300047319 Bacteria 26211
521 Ga0495672_0073765 3300047320 Bacteria 1924
522 Ga0495676_0002364 3300047321 Bacteria 16733
523 Ga0495680_0007093 3300047322 Bacteria 10320
524 Ga0495677_0371654 3300047445 Bacteria 565
525 Ga0495684_0002609 3300047471 Bacteria 14315
526 Ga0495684_0699939 3300047471 Bacteria 672
527 Ga0495602_0559756 3300048088 Bacteria 791
528 Ga0496100_0302834 3300048903 Bacteria 1197
529 Ga0496100_1373412 3300048903 Bacteria 558
530 Ga0496101_0615169 3300048904 Bacteria 859
531 Ga0496101_1031256 3300048904 Bacteria 647
532 Ga0496102_0638202 3300048905 Bacteria 988
533 Ga0496102_0761644 3300048905 Bacteria 891
534 Ga0496104_0125821 3300048907 Bacteria 2461
535 Ga0496104_0431487 3300048907 Bacteria 1230
536 Ga0496104_1293549 3300048907 Bacteria 632
537 Ga0496105_0370639 3300048908 Bacteria 1141
538 Ga0496108_0060415 3300048911 Bacteria 3189
539 Ga0496108_0287513 3300048911 Bacteria 1431
540 Ga0496108_0572006 3300048911 Bacteria 985
541 Ga0496109_0017069 3300048912 Bacteria 6352
542 Ga0496109_1551917 3300048912 Bacteria 597
543 Ga0496110_0106609 3300048913 Bacteria 2515
544 Ga0496110_0981303 3300048913 Bacteria 752
545 Ga0496110_1158524 3300048913 Bacteria 682
546 Ga0496110_1219105 3300048913 Bacteria 661
547 Ga0496111_0329832 3300048914 Bacteria 1130
548 Ga0496111_0375678 3300048914 Bacteria 1051
549 Ga0496112_0037625 3300048915 Bacteria 4723
550 Ga0496112_0223913 3300048915 Bacteria 1837
551 Ga0496112_0677272 3300048915 Bacteria 960
552 Ga0496113_0347273 3300048916 Bacteria 1190
553 Ga0496114_0127625 3300048917 Bacteria 2194
554 Ga0496115_0420315 3300048918 Bacteria 1083
555 Ga0496115_0538722 3300048918 Bacteria 934
556 Ga0496115_1193444 3300048918 Bacteria 572
557 Ga0501291_127489 3300049514 Bacteria 558
558 Ga0501317_076601 3300049533 Bacteria 572
559 Ga0501039_0437451 3300049575 Bacteria 1027
560 Ga0501039_0491000 3300049575 Bacteria 964
561 Ga0501041_0301309 3300049577 Bacteria 1010
562 Ga0501042_0183154 3300049578 Bacteria 1511
563 Ga0501043_0473099 3300049579 Bacteria 939
564 Ga0501047_0000046 3300049581 Bacteria 170205
565 Ga0501048_0164410 3300049582 Bacteria 1571
566 Ga0501071_0143532 3300049587 Bacteria 1779
567 Ga0501071_0243345 3300049587 Bacteria 1357
568 Ga0501072_0115397 3300049588 Bacteria 2138
569 Ga0501206_038869 3300049653 Bacteria 729
570 Ga0501035_0830907 3300049822 Bacteria 736
571 Ga0501044_0265717 3300049823 Bacteria 1653
572 nmdc:mga03683_24353_c1 3300050489 Bacteria 2367
573 nmdc:mga00v17_54503_c1 3300050491 Bacteria 2439
574 nmdc:mga00v17_87173_c1 3300050491 Bacteria 1957
575 nmdc:mga0yw44_719384_c1 3300050492 Bacteria 678
576 nmdc:mga06z11_40931_c1 3300050494 Bacteria 2316
577 nmdc:mga04h51_40752_c1 3300050495 Bacteria 1515
578 nmdc:mga07m45_156915_c1 3300050496 Bacteria 1320
579 nmdc:mga05p37_665334_c1 3300050507 Bacteria 1163
580 nmdc:mga08y16_160167_c1 3300050511 Bacteria 2338
581 nmdc:mga08y16_1859246_c1 3300050511 Bacteria 554
582 nmdc:mga08y16_238428_c1 3300050511 Bacteria 1880
583 Ga0495655_0129520 3300053083 Bacteria 776
584 Ga0495595_0666693 3300053084 Bacteria 533
585 Ga0500573_0002950 3300053140 Bacteria 8678
586 Ga0500587_017719 3300053739 Bacteria 914
587 Ga0501084_0672181 3300054114 Bacteria 874
588 Ga0466962_0147868 3300061719 Bacteria 1139
589 Ga0466962_0395057 3300061719 Bacteria 692
590 Ga0466962_0621396 3300061719 Bacteria 551
591 Ga0530510_0751157 3300061734 Bacteria 744

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_11072499 Ga0070658_110724992 104
2 3300044694 Ga0466963_0278197 Ga0466963_0278197_624_968 104
3 3300044719 Ga0466971_0418321 Ga0466971_0418321_171_515 104
4 3300045836 Ga0466958_0315236 Ga0466958_0315236_592_942 104
5 3300045836 Ga0466958_0737581 Ga0466958_0737581_57_401 104
6 3300045976 Ga0466967_0113444 Ga0466967_0113444_1144_1488 104
7 3300025932 Ga0207690_10595328 Ga0207690_105953282 105
8 3300044683 Ga0466965_0132017 Ga0466965_0132017_45_398 106
9 3300044694 Ga0466963_0758678 Ga0466963_0758678_279_632 106
10 3300044719 Ga0466971_0111762 Ga0466971_0111762_336_689 106
11 3300044842 Ga0466957_0062976 Ga0466957_0062976_1162_1515 106
12 3300045836 Ga0466958_0193846 Ga0466958_0193846_813_1166 106
13 3300005366 Ga0070659_100009212 Ga0070659_1000092126 107
14 3300005455 Ga0070663_100072005 Ga0070663_1000720054 107
15 3300005455 Ga0070663_100566307 Ga0070663_1005663072 107
16 3300005564 Ga0070664_100006472 Ga0070664_1000064725 107
17 3300044683 Ga0466965_0115925 Ga0466965_0115925_299_655 107
18 3300044684 Ga0466966_0277251 Ga0466966_0277251_113_463 107
19 3300044706 Ga0466964_0883207 Ga0466964_0883207_138_494 107
20 3300045836 Ga0466958_0545877 Ga0466958_0545877_191_541 107
21 3300025920 Ga0207649_10247874 Ga0207649_102478742 108
22 3300037471 Ga0395905_1517683 Ga0395905_1517683_67_426 108
23 3300025932 Ga0207690_11077102 Ga0207690_110771021 109
24 3300048904 Ga0496101_0615169 Ga0496101_0615169_235_582 109
25 3300048913 Ga0496110_1158524 Ga0496110_1158524_17_364 109
26 3300009098 Ga0105245_10052805 Ga0105245_100528054 110
27 3300009176 Ga0105242_10003049 Ga0105242_100030493 110
28 3300009545 Ga0105237_10056196 Ga0105237_100561963 110
29 3300010375 Ga0105239_10062376 Ga0105239_100623764 110
30 3300013296 Ga0157374_10121598 Ga0157374_101215982 110
31 3300014745 Ga0157377_11288940 Ga0157377_112889402 110
32 3300026118 Ga0207675_100165113 Ga0207675_1001651132 110
33 3300050494 nmdc:mga06z11_40931_c1 nmdc:mga06z11_40931_c1_1842_2195 110
34 3300050495 nmdc:mga04h51_40752_c1 nmdc:mga04h51_40752_c1_220_573 110
35 3300045976 Ga0466967_2078526 Ga0466967_2078526_90_482 111
36 3300049581 Ga0501047_0000046 Ga0501047_0000046_52436_52819 111
37 3300049823 Ga0501044_0265717 Ga0501044_0265717_869_1252 111
38 3300044658 Ga0466972_0009259 Ga0466972_0009259_4488_4901 113
39 3300044683 Ga0466965_0013665 Ga0466965_0013665_1691_2104 113
40 3300044735 Ga0466968_0188409 Ga0466968_0188409_405_818 113
41 3300044765 Ga0466970_0018477 Ga0466970_0018477_1086_1499 113
42 3300044842 Ga0466957_0176787 Ga0466957_0176787_385_798 113
43 3300044901 Ga0466960_0001071 Ga0466960_0001071_1063_1476 113
44 3300045836 Ga0466958_0109356 Ga0466958_0109356_278_691 113
45 3300044683 Ga0466965_0748531 Ga0466965_0748531_15_365 114
46 3300044684 Ga0466966_0278157 Ga0466966_0278157_171_524 114
47 3300045976 Ga0466967_0069258 Ga0466967_0069258_2470_2823 114
48 iso_pu_bacteria 2795385470 2795783145 114
49 iso_pu_bacteria 8003314358 8003323405 114
50 3300005328 Ga0070676_10036296 Ga0070676_100362964 115
51 3300005329 Ga0070683_100220769 Ga0070683_1002207692 115
52 3300005330 Ga0070690_100892606 Ga0070690_1008926061 115
53 3300005330 Ga0070690_101576087 Ga0070690_1015760871 115
54 3300005331 Ga0070670_100194595 Ga0070670_1001945952 115
55 3300005331 Ga0070670_100248279 Ga0070670_1002482791 115
56 3300005331 Ga0070670_101122017 Ga0070670_1011220171 115
57 3300005334 Ga0068869_100028918 Ga0068869_1000289182 115
58 3300005334 Ga0068869_100549990 Ga0068869_1005499902 115
59 3300005334 Ga0068869_101500091 Ga0068869_1015000912 115
60 3300005337 Ga0070682_100105339 Ga0070682_1001053393 115
61 3300005337 Ga0070682_100190225 Ga0070682_1001902252 115
62 3300005337 Ga0070682_100313011 Ga0070682_1003130112 115
63 3300005338 Ga0068868_100106928 Ga0068868_1001069283 115
64 3300005338 Ga0068868_100357344 Ga0068868_1003573442 115
65 3300005338 Ga0068868_100753042 Ga0068868_1007530422 115
66 3300005340 Ga0070689_100701741 Ga0070689_1007017412 115
67 3300005344 Ga0070661_100399382 Ga0070661_1003993822 115
68 3300005345 Ga0070692_10062655 Ga0070692_100626553 115
69 3300005347 Ga0070668_100020774 Ga0070668_1000207746 115
70 3300005356 Ga0070674_100016051 Ga0070674_1000160512 115
71 3300005365 Ga0070688_100259688 Ga0070688_1002596882 115
72 3300005365 Ga0070688_100545731 Ga0070688_1005457312 115
73 3300005366 Ga0070659_100894678 Ga0070659_1008946782 115
74 3300005367 Ga0070667_101147725 Ga0070667_1011477251 115
75 3300005367 Ga0070667_101372804 Ga0070667_1013728042 115
76 3300005435 Ga0070714_100511734 Ga0070714_1005117342 115
77 3300005435 Ga0070714_101161575 Ga0070714_1011615752 115
78 3300005436 Ga0070713_100213352 Ga0070713_1002133522 115
79 3300005436 Ga0070713_100600182 Ga0070713_1006001822 115
80 3300005436 Ga0070713_101937499 Ga0070713_1019374992 115
81 3300005438 Ga0070701_10631820 Ga0070701_106318202 115
82 3300005441 Ga0070700_100114084 Ga0070700_1001140842 115
83 3300005441 Ga0070700_101050019 Ga0070700_1010500191 115
84 3300005441 Ga0070700_101292022 Ga0070700_1012920221 115
85 3300005455 Ga0070663_100000691 Ga0070663_1000006919 115
86 3300005455 Ga0070663_100008282 Ga0070663_1000082823 115
87 3300005455 Ga0070663_100853972 Ga0070663_1008539722 115
88 3300005456 Ga0070678_100139753 Ga0070678_1001397532 115
89 3300005456 Ga0070678_100772213 Ga0070678_1007722132 115
90 3300005456 Ga0070678_101016011 Ga0070678_1010160112 115
91 3300005457 Ga0070662_100429064 Ga0070662_1004290642 115
92 3300005466 Ga0070685_10367558 Ga0070685_103675582 115
93 3300005466 Ga0070685_10431040 Ga0070685_104310402 115
94 3300005535 Ga0070684_100078631 Ga0070684_1000786312 115
95 3300005535 Ga0070684_101584601 Ga0070684_1015846012 115
96 3300005548 Ga0070665_100108059 Ga0070665_1001080593 115
97 3300005548 Ga0070665_100175177 Ga0070665_1001751772 115
98 3300005548 Ga0070665_101098648 Ga0070665_1010986482 115
99 3300005564 Ga0070664_100474221 Ga0070664_1004742212 115
100 3300005564 Ga0070664_100474704 Ga0070664_1004747042 115
101 3300005564 Ga0070664_100775832 Ga0070664_1007758322 115
102 3300005577 Ga0068857_100080862 Ga0068857_1000808622 115
103 3300005577 Ga0068857_100172991 Ga0068857_1001729912 115
104 3300005577 Ga0068857_100237112 Ga0068857_1002371122 115
105 3300005577 Ga0068857_101970127 Ga0068857_1019701271 115
106 3300005614 Ga0068856_100415097 Ga0068856_1004150972 115
107 3300005614 Ga0068856_100453302 Ga0068856_1004533022 115
108 3300005614 Ga0068856_101438173 Ga0068856_1014381731 115
109 3300005616 Ga0068852_100037968 Ga0068852_1000379685 115
110 3300005616 Ga0068852_100198975 Ga0068852_1001989752 115
111 3300005616 Ga0068852_100344764 Ga0068852_1003447641 115
112 3300005617 Ga0068859_100414361 Ga0068859_1004143612 115
113 3300005617 Ga0068859_102069549 Ga0068859_1020695492 115
114 3300005618 Ga0068864_100147606 Ga0068864_1001476062 115
115 3300005618 Ga0068864_100197539 Ga0068864_1001975393 115
116 3300005834 Ga0068851_10113572 Ga0068851_101135722 115
117 3300005840 Ga0068870_10091369 Ga0068870_100913692 115
118 3300005842 Ga0068858_100332844 Ga0068858_1003328442 115
119 3300005842 Ga0068858_101796537 Ga0068858_1017965371 115
120 3300005843 Ga0068860_100327261 Ga0068860_1003272612 115
121 3300005843 Ga0068860_102212982 Ga0068860_1022129822 115
122 3300005844 Ga0068862_100013982 Ga0068862_1000139822 115
123 3300006028 Ga0070717_10240354 Ga0070717_102403542 115
124 3300006844 Ga0075428_102583332 Ga0075428_1025833322 115
125 3300006931 Ga0097620_100414356 Ga0097620_1004143562 115
126 3300006931 Ga0097620_102069647 Ga0097620_1020696472 115
127 3300009011 Ga0105251_10190647 Ga0105251_101906472 115
128 3300009098 Ga0105245_10576387 Ga0105245_105763872 115
129 3300009098 Ga0105245_10773039 Ga0105245_107730392 115
130 3300009098 Ga0105245_12903688 Ga0105245_129036881 115
131 3300009101 Ga0105247_10059559 Ga0105247_100595592 115
132 3300009101 Ga0105247_10468662 Ga0105247_104686622 115
133 3300009148 Ga0105243_10734497 Ga0105243_107344972 115
134 3300009148 Ga0105243_10800371 Ga0105243_108003712 115
135 3300009177 Ga0105248_10317590 Ga0105248_103175902 115
136 3300009545 Ga0105237_11597797 Ga0105237_115977972 115
137 3300009545 Ga0105237_12055133 Ga0105237_120551332 115
138 3300009553 Ga0105249_10083692 Ga0105249_100836924 115
139 3300009553 Ga0105249_11256087 Ga0105249_112560872 115
140 3300010375 Ga0105239_10218122 Ga0105239_102181222 115
141 3300010375 Ga0105239_10705003 Ga0105239_107050032 115
142 3300010375 Ga0105239_13122216 Ga0105239_131222161 115
143 3300011119 Ga0105246_10369010 Ga0105246_103690102 115
144 3300011119 Ga0105246_10881363 Ga0105246_108813632 115
145 3300013105 Ga0157369_10520850 Ga0157369_105208502 115
146 3300013296 Ga0157374_10565014 Ga0157374_105650142 115
147 3300013296 Ga0157374_10765673 Ga0157374_107656732 115
148 3300013296 Ga0157374_11496161 Ga0157374_114961611 115
149 3300013297 Ga0157378_11185904 Ga0157378_111859042 115
150 3300013297 Ga0157378_11188518 Ga0157378_111885182 115
151 3300013297 Ga0157378_13029934 Ga0157378_130299341 115
152 3300013306 Ga0163162_10089061 Ga0163162_100890612 115
153 3300013306 Ga0163162_10799951 Ga0163162_107999512 115
154 3300013307 Ga0157372_10164614 Ga0157372_101646144 115
155 3300013307 Ga0157372_12182887 Ga0157372_121828872 115
156 3300013308 Ga0157375_10342218 Ga0157375_103422183 115
157 3300013308 Ga0157375_13200029 Ga0157375_132000291 115
158 3300014325 Ga0163163_10664361 Ga0163163_106643612 115
159 3300014325 Ga0163163_12059428 Ga0163163_120594281 115
160 3300014326 Ga0157380_10198317 Ga0157380_101983173 115
161 3300014968 Ga0157379_10964074 Ga0157379_109640742 115
162 3300014968 Ga0157379_12454913 Ga0157379_124549132 115
163 3300020080 Ga0206350_10093833 Ga0206350_100938332 115
164 3300020081 Ga0206354_10112504 Ga0206354_101125042 115
165 3300021384 Ga0213876_10079821 Ga0213876_100798212 115
166 3300025321 Ga0207656_10155617 Ga0207656_101556172 115
167 3300025899 Ga0207642_10278184 Ga0207642_102781842 115
168 3300025900 Ga0207710_10632123 Ga0207710_106321231 115
169 3300025901 Ga0207688_10064397 Ga0207688_100643972 115
170 3300025901 Ga0207688_10339570 Ga0207688_103395701 115
171 3300025901 Ga0207688_10354605 Ga0207688_103546052 115
172 3300025907 Ga0207645_10046690 Ga0207645_100466903 115
173 3300025907 Ga0207645_10169397 Ga0207645_101693972 115
174 3300025908 Ga0207643_10027448 Ga0207643_100274482 115
175 3300025909 Ga0207705_10642545 Ga0207705_106425452 115
176 3300025909 Ga0207705_11016734 Ga0207705_110167342 115
177 3300025913 Ga0207695_10760280 Ga0207695_107602802 115
178 3300025914 Ga0207671_10255181 Ga0207671_102551812 115
179 3300025919 Ga0207657_10052911 Ga0207657_100529113 115
180 3300025920 Ga0207649_10023680 Ga0207649_100236802 115
181 3300025925 Ga0207650_10364322 Ga0207650_103643221 115
182 3300025925 Ga0207650_10518328 Ga0207650_105183282 115
183 3300025926 Ga0207659_10339880 Ga0207659_103398801 115
184 3300025926 Ga0207659_11795545 Ga0207659_117955452 115
185 3300025927 Ga0207687_10244508 Ga0207687_102445082 115
186 3300025927 Ga0207687_10518425 Ga0207687_105184252 115
187 3300025928 Ga0207700_10106839 Ga0207700_101068392 115
188 3300025932 Ga0207690_10431260 Ga0207690_104312602 115
189 3300025932 Ga0207690_10993985 Ga0207690_109939852 115
190 3300025933 Ga0207706_10232184 Ga0207706_102321842 115
191 3300025933 Ga0207706_10609402 Ga0207706_106094021 115
192 3300025935 Ga0207709_10607702 Ga0207709_106077022 115
193 3300025936 Ga0207670_11306249 Ga0207670_113062491 115
194 3300025936 Ga0207670_11421573 Ga0207670_114215731 115
195 3300025940 Ga0207691_10057259 Ga0207691_100572595 115
196 3300025941 Ga0207711_10528909 Ga0207711_105289092 115
197 3300025942 Ga0207689_10092906 Ga0207689_100929064 115
198 3300025942 Ga0207689_10221508 Ga0207689_102215082 115
199 3300025942 Ga0207689_10434379 Ga0207689_104343792 115
200 3300025944 Ga0207661_10657465 Ga0207661_106574652 115
201 3300025944 Ga0207661_11557065 Ga0207661_115570651 115
202 3300025945 Ga0207679_10683221 Ga0207679_106832212 115
203 3300025945 Ga0207679_11169718 Ga0207679_111697181 115
204 3300025960 Ga0207651_10868728 Ga0207651_108687282 115
205 3300025961 Ga0207712_10212330 Ga0207712_102123302 115
206 3300025961 Ga0207712_11248439 Ga0207712_112484392 115
207 3300025972 Ga0207668_10048725 Ga0207668_100487252 115
208 3300025981 Ga0207640_10112592 Ga0207640_101125922 115
209 3300025981 Ga0207640_10567443 Ga0207640_105674431 115
210 3300025986 Ga0207658_10396614 Ga0207658_103966141 115
211 3300025986 Ga0207658_10849801 Ga0207658_108498012 115
212 3300026023 Ga0207677_10029498 Ga0207677_100294983 115
213 3300026023 Ga0207677_10088203 Ga0207677_100882032 115
214 3300026023 Ga0207677_10173351 Ga0207677_101733512 115
215 3300026035 Ga0207703_10087351 Ga0207703_100873514 115
216 3300026035 Ga0207703_10551390 Ga0207703_105513902 115
217 3300026041 Ga0207639_10158178 Ga0207639_101581782 115
218 3300026067 Ga0207678_10000314 Ga0207678_100003149 115
219 3300026067 Ga0207678_10037560 Ga0207678_100375602 115
220 3300026067 Ga0207678_10065198 Ga0207678_100651982 115
221 3300026067 Ga0207678_10230295 Ga0207678_102302952 115
222 3300026075 Ga0207708_10269888 Ga0207708_102698882 115
223 3300026075 Ga0207708_10564314 Ga0207708_105643142 115
224 3300026078 Ga0207702_10361772 Ga0207702_103617722 115
225 3300026088 Ga0207641_11330508 Ga0207641_113305081 115
226 3300026089 Ga0207648_10315635 Ga0207648_103156352 115
227 3300026095 Ga0207676_10162642 Ga0207676_101626422 115
228 3300026095 Ga0207676_12440977 Ga0207676_124409771 115
229 3300026116 Ga0207674_10048933 Ga0207674_100489336 115
230 3300026116 Ga0207674_10198458 Ga0207674_101984582 115
231 3300026116 Ga0207674_10900824 Ga0207674_109008242 115
232 3300026116 Ga0207674_11599728 Ga0207674_115997281 115
233 3300026118 Ga0207675_100221368 Ga0207675_1002213682 115
234 3300026121 Ga0207683_10076164 Ga0207683_100761641 115
235 3300026121 Ga0207683_10426422 Ga0207683_104264222 115
236 3300026142 Ga0207698_10110995 Ga0207698_101109954 115
237 3300026142 Ga0207698_10307224 Ga0207698_103072242 115
238 3300028379 Ga0268266_10112529 Ga0268266_101125292 115
239 3300028379 Ga0268266_10176996 Ga0268266_101769962 115
240 3300028379 Ga0268266_10416481 Ga0268266_104164811 115
241 3300028380 Ga0268265_11258868 Ga0268265_112588682 115
242 3300028381 Ga0268264_10486881 Ga0268264_104868812 115
243 3300031901 Ga0307406_12089429 Ga0307406_120894292 115
244 3300035691 Ga0373931_0379485 Ga0373931_0379485_287_643 115
245 3300039437 Ga0436365_1315947 Ga0436365_1315947_896_1252 115
246 3300041460 Ga0451802_2100189 Ga0451802_2100189_279_632 115
247 3300044658 Ga0466972_0221839 Ga0466972_0221839_304_660 115
248 3300044683 Ga0466965_0266200 Ga0466965_0266200_548_910 115
249 3300044693 Ga0466961_0014273 Ga0466961_0014273_152_514 115
250 3300044694 Ga0466963_0781445 Ga0466963_0781445_141_500 115
251 3300044765 Ga0466970_0017578 Ga0466970_0017578_2669_3031 115
252 3300044765 Ga0466970_0680592 Ga0466970_0680592_229_585 115
253 3300044842 Ga0466957_0129200 Ga0466957_0129200_433_795 115
254 3300044901 Ga0466960_0015607 Ga0466960_0015607_321_707 115
255 3300044901 Ga0466960_0118444 Ga0466960_0118444_359_721 115
256 3300044901 Ga0466960_0432166 Ga0466960_0432166_103_459 115
257 3300045049 Ga0466959_0410028 Ga0466959_0410028_80_442 115
258 3300045976 Ga0466967_0191642 Ga0466967_0191642_667_1029 115
259 3300045976 Ga0466967_0626237 Ga0466967_0626237_239_595 115
260 3300045976 Ga0466967_0939305 Ga0466967_0939305_98_457 115
261 3300045976 Ga0466967_1953551 Ga0466967_1953551_67_423 115
262 3300045976 Ga0466967_2271923 Ga0466967_2271923_22_384 115
263 3300048903 Ga0496100_1373412 Ga0496100_1373412_95_451 115
264 3300048905 Ga0496102_0638202 Ga0496102_0638202_549_905 115
265 3300048905 Ga0496102_0761644 Ga0496102_0761644_135_494 115
266 3300048907 Ga0496104_0125821 Ga0496104_0125821_248_607 115
267 3300048907 Ga0496104_0431487 Ga0496104_0431487_534_890 115
268 3300048908 Ga0496105_0370639 Ga0496105_0370639_765_1121 115
269 3300048911 Ga0496108_0060415 Ga0496108_0060415_102_461 115
270 3300048911 Ga0496108_0287513 Ga0496108_0287513_250_606 115
271 3300048912 Ga0496109_0017069 Ga0496109_0017069_562_921 115
272 3300048913 Ga0496110_0106609 Ga0496110_0106609_979_1335 115
273 3300048913 Ga0496110_0981303 Ga0496110_0981303_104_460 115
274 3300048914 Ga0496111_0329832 Ga0496111_0329832_416_772 115
275 3300048914 Ga0496111_0375678 Ga0496111_0375678_634_990 115
276 3300048915 Ga0496112_0037625 Ga0496112_0037625_1357_1716 115
277 3300048915 Ga0496112_0223913 Ga0496112_0223913_620_976 115
278 3300048916 Ga0496113_0347273 Ga0496113_0347273_300_656 115
279 3300048917 Ga0496114_0127625 Ga0496114_0127625_700_1056 115
280 3300048918 Ga0496115_0538722 Ga0496115_0538722_395_754 115
281 3300048918 Ga0496115_1193444 Ga0496115_1193444_195_551 115
282 3300050511 nmdc:mga08y16_160167_c1 nmdc:mga08y16_160167_c1_496_852 115
283 3300050511 nmdc:mga08y16_1859246_c1 nmdc:mga08y16_1859246_c1_69_425 115
284 3300050511 nmdc:mga08y16_238428_c1 nmdc:mga08y16_238428_c1_819_1175 115
285 3300005343 Ga0070687_101507977 Ga0070687_1015079771 116
286 3300005467 Ga0070706_100522069 Ga0070706_1005220692 116
287 3300025910 Ga0207684_10627105 Ga0207684_106271052 116
288 3300031852 Ga0307410_10662954 Ga0307410_106629542 116
289 3300031903 Ga0307407_10456062 Ga0307407_104560622 116
290 3300031995 Ga0307409_101514750 Ga0307409_1015147501 116
291 3300035086 Ga0373934_0155486 Ga0373934_0155486_499_861 116
292 3300036401 Ga0373937_0244094 Ga0373937_0244094_516_878 116
293 3300036401 Ga0373937_1686181 Ga0373937_1686181_93_452 116
294 3300039450 Ga0436363_1696899 Ga0436363_1696899_94_453 116
295 3300041463 Ga0451804_0899706 Ga0451804_0899706_138_500 116
296 3300042993 Ga0439440_0072210 Ga0439440_0072210_179_550 116
297 3300047471 Ga0495684_0699939 Ga0495684_0699939_128_487 116
298 3300049587 Ga0501071_0143532 Ga0501071_0143532_168_584 116
299 3300049588 Ga0501072_0115397 Ga0501072_0115397_999_1415 116
300 3300053084 Ga0495595_0666693 Ga0495595_0666693_81_440 116
301 iso_pu_bacteria 2643221641 2644230811 116
302 iso_pu_bacteria 2738543034 2739362811 116
303 iso_pu_bacteria 2739367898 2740167559 116
304 iso_pu_bacteria 2739367898 2740169548 116
305 iso_pu_bacteria 2904765812 2904768217 116
306 iso_pu_bacteria 2908811453 2908815517 116
307 iso_pu_bacteria 2919420072 2919423362 116
308 iso_pu_bacteria 2919432681 2919435970 116
309 3300005347 Ga0070668_100223470 Ga0070668_1002234702 117
310 3300005355 Ga0070671_100001754 Ga0070671_1000017545 117
311 3300005367 Ga0070667_100704230 Ga0070667_1007042302 117
312 3300005434 Ga0070709_10574087 Ga0070709_105740872 117
313 3300005445 Ga0070708_100685636 Ga0070708_1006856362 117
314 3300005548 Ga0070665_100002791 Ga0070665_1000027912 117
315 3300005564 Ga0070664_100155191 Ga0070664_1001551914 117
316 3300005614 Ga0068856_100120619 Ga0068856_1001206193 117
317 3300005841 Ga0068863_100125060 Ga0068863_1001250602 117
318 3300005841 Ga0068863_100934144 Ga0068863_1009341442 117
319 3300005843 Ga0068860_100077660 Ga0068860_1000776602 117
320 3300006051 Ga0075364_10077973 Ga0075364_100779732 117
321 3300006173 Ga0070716_100204696 Ga0070716_1002046962 117
322 3300006177 Ga0075362_10180173 Ga0075362_101801732 117
323 3300009147 Ga0114129_11368718 Ga0114129_113687182 117
324 3300021388 Ga0213875_10006652 Ga0213875_100066527 117
325 3300021388 Ga0213875_10024074 Ga0213875_100240743 117
326 3300021388 Ga0213875_10026935 Ga0213875_100269352 117
327 3300022467 Ga0224712_10055690 Ga0224712_100556902 117
328 3300025898 Ga0207692_10043552 Ga0207692_100435522 117
329 3300025906 Ga0207699_10263628 Ga0207699_102636282 117
330 3300025915 Ga0207693_10007426 Ga0207693_100074265 117
331 3300025916 Ga0207663_10077362 Ga0207663_100773621 117
332 3300025928 Ga0207700_10117145 Ga0207700_101171452 117
333 3300025929 Ga0207664_10128207 Ga0207664_101282073 117
334 3300025931 Ga0207644_10001034 Ga0207644_100010345 117
335 3300025937 Ga0207669_11243339 Ga0207669_112433392 117
336 3300025939 Ga0207665_10034114 Ga0207665_100341146 117
337 3300025944 Ga0207661_10097432 Ga0207661_100974324 117
338 3300025972 Ga0207668_10407151 Ga0207668_104071512 117
339 3300025972 Ga0207668_12115415 Ga0207668_121154151 117
340 3300025986 Ga0207658_10428780 Ga0207658_104287802 117
341 3300026075 Ga0207708_10656241 Ga0207708_106562411 117
342 3300026078 Ga0207702_10617836 Ga0207702_106178362 117
343 3300026088 Ga0207641_10105936 Ga0207641_101059363 117
344 3300026118 Ga0207675_100830527 Ga0207675_1008305272 117
345 3300028379 Ga0268266_10013711 Ga0268266_100137112 117
346 3300028381 Ga0268264_10008083 Ga0268264_100080835 117
347 3300031456 Ga0307513_10052060 Ga0307513_100520602 117
348 3300031731 Ga0307405_10562259 Ga0307405_105622592 117
349 3300032002 Ga0307416_100707586 Ga0307416_1007075862 117
350 3300032002 Ga0307416_102204462 Ga0307416_1022044621 117
351 3300032004 Ga0307414_11098905 Ga0307414_110989051 117
352 3300032005 Ga0307411_10632964 Ga0307411_106329642 117
353 3300032126 Ga0307415_100060707 Ga0307415_1000607074 117
354 3300035083 Ga0373926_0000194 Ga0373926_0000194_3119_3481 117
355 3300035111 Ga0373923_0082203 Ga0373923_0082203_122_484 117
356 3300035113 Ga0373936_0002169 Ga0373936_0002169_4304_4666 117
357 3300035116 Ga0373945_0000105 Ga0373945_0000105_15540_15902 117
358 3300035170 Ga0373943_0002905 Ga0373943_0002905_1160_1522 117
359 3300035171 Ga0373946_0000340 Ga0373946_0000340_13328_13690 117
360 3300035172 Ga0373955_0014029 Ga0373955_0014029_1736_2098 117
361 3300035410 Ga0373924_0110158 Ga0373924_0110158_396_758 117
362 3300035692 Ga0373935_0000837 Ga0373935_0000837_7786_8148 117
363 3300035695 Ga0373927_0001172 Ga0373927_0001172_10391_10753 117
364 3300035724 Ga0373933_0083061 Ga0373933_0083061_352_714 117
365 3300035725 Ga0373947_0001050 Ga0373947_0001050_6528_6890 117
366 3300036401 Ga0373937_1107752 Ga0373937_1107752_298_660 117
367 3300037068 Ga0373925_0001881 Ga0373925_0001881_6183_6545 117
368 3300037853 Ga0436364_1349894 Ga0436364_1349894_3193_3555 117
369 3300037853 Ga0436364_1565185 Ga0436364_1565185_4901_5266 117
370 3300039437 Ga0436365_1348550 Ga0436365_1348550_789_1154 117
371 3300039437 Ga0436365_1766708 Ga0436365_1766708_28_390 117
372 3300039450 Ga0436363_0611301 Ga0436363_0611301_620_985 117
373 3300041451 Ga0451791_1509369 Ga0451791_1509369_574_936 117
374 3300041451 Ga0451791_1519585 Ga0451791_1519585_48_410 117
375 3300041456 Ga0451795_0932728 Ga0451795_0932728_161_523 117
376 3300041501 Ga0451845_0191103 Ga0451845_0191103_177_539 117
377 3300044658 Ga0466972_0495730 Ga0466972_0495730_186_557 117
378 3300044684 Ga0466966_0017769 Ga0466966_0017769_132_491 117
379 3300044684 Ga0466966_0265220 Ga0466966_0265220_457_819 117
380 3300044693 Ga0466961_0403772 Ga0466961_0403772_347_709 117
381 3300044694 Ga0466963_0346501 Ga0466963_0346501_346_729 117
382 3300044694 Ga0466963_0556022 Ga0466963_0556022_212_577 117
383 3300044694 Ga0466963_1034945 Ga0466963_1034945_128_490 117
384 3300044706 Ga0466964_0185912 Ga0466964_0185912_584_949 117
385 3300044719 Ga0466971_0177692 Ga0466971_0177692_607_990 117
386 3300044735 Ga0466968_0664211 Ga0466968_0664211_32_397 117
387 3300044765 Ga0466970_0561845 Ga0466970_0561845_157_516 117
388 3300044842 Ga0466957_0548290 Ga0466957_0548290_307_672 117
389 3300044901 Ga0466960_0032398 Ga0466960_0032398_1061_1435 117
390 3300045049 Ga0466959_0398750 Ga0466959_0398750_257_616 117
391 3300045049 Ga0466959_0415623 Ga0466959_0415623_427_792 117
392 3300045049 Ga0466959_0505406 Ga0466959_0505406_395_760 117
393 3300045976 Ga0466967_0043011 Ga0466967_0043011_539_901 117
394 3300045976 Ga0466967_0220429 Ga0466967_0220429_677_1042 117
395 3300045976 Ga0466967_0247435 Ga0466967_0247435_819_1202 117
396 3300045976 Ga0466967_2112610 Ga0466967_2112610_171_536 117
397 3300045976 Ga0466967_2283818 Ga0466967_2283818_106_471 117
398 3300046463 Ga0495653_0005402 Ga0495653_0005402_3791_4153 117
399 3300046473 Ga0495582_0029785 Ga0495582_0029785_478_840 117
400 3300046476 Ga0495662_0007276 Ga0495662_0007276_603_965 117
401 3300046477 Ga0495664_0000357 Ga0495664_0000357_9951_10313 117
402 3300046511 Ga0495608_0030423 Ga0495608_0030423_1353_1715 117
403 3300046514 Ga0495618_0394399 Ga0495618_0394399_88_450 117
404 3300046517 Ga0495630_0003829 Ga0495630_0003829_3369_3731 117
405 3300046518 Ga0495631_0177532 Ga0495631_0177532_19_384 117
406 3300046529 Ga0495652_0089898 Ga0495652_0089898_326_688 117
407 3300046533 Ga0495640_0065901 Ga0495640_0065901_517_879 117
408 3300046559 Ga0495667_0013507 Ga0495667_0013507_5079_5441 117
409 3300046663 Ga0495635_0003522 Ga0495635_0003522_7101_7463 117
410 3300046665 Ga0495661_0628456 Ga0495661_0628456_107_472 117
411 3300046675 Ga0495657_0192638 Ga0495657_0192638_240_602 117
412 3300046678 Ga0495599_0041964 Ga0495599_0041964_2283_2645 117
413 3300046681 Ga0495647_0110872 Ga0495647_0110872_602_964 117
414 3300046690 Ga0495624_0016684 Ga0495624_0016684_1237_1599 117
415 3300046809 Ga0495600_0180717 Ga0495600_0180717_672_1034 117
416 3300047319 Ga0495674_0001081 Ga0495674_0001081_15464_15826 117
417 3300047320 Ga0495672_0073765 Ga0495672_0073765_932_1300 117
418 3300047321 Ga0495676_0002364 Ga0495676_0002364_14217_14579 117
419 3300047322 Ga0495680_0007093 Ga0495680_0007093_3537_3899 117
420 3300047471 Ga0495684_0002609 Ga0495684_0002609_1057_1419 117
421 3300048088 Ga0495602_0559756 Ga0495602_0559756_399_761 117
422 3300048907 Ga0496104_1293549 Ga0496104_1293549_259_621 117
423 3300048913 Ga0496110_1219105 Ga0496110_1219105_100_462 117
424 3300048918 Ga0496115_0420315 Ga0496115_0420315_199_567 117
425 3300049575 Ga0501039_0437451 Ga0501039_0437451_360_722 117
426 3300049577 Ga0501041_0301309 Ga0501041_0301309_411_806 117
427 3300049578 Ga0501042_0183154 Ga0501042_0183154_561_923 117
428 3300049579 Ga0501043_0473099 Ga0501043_0473099_297_659 117
429 3300049582 Ga0501048_0164410 Ga0501048_0164410_777_1139 117
430 3300049587 Ga0501071_0243345 Ga0501071_0243345_470_832 117
431 3300049822 Ga0501035_0830907 Ga0501035_0830907_289_651 117
432 3300050489 nmdc:mga03683_24353_c1 nmdc:mga03683_24353_c1_1931_2293 117
433 3300050491 nmdc:mga00v17_54503_c1 nmdc:mga00v17_54503_c1_369_749 117
434 3300050491 nmdc:mga00v17_87173_c1 nmdc:mga00v17_87173_c1_588_950 117
435 3300050492 nmdc:mga0yw44_719384_c1 nmdc:mga0yw44_719384_c1_128_508 117
436 3300050496 nmdc:mga07m45_156915_c1 nmdc:mga07m45_156915_c1_43_405 117
437 3300050507 nmdc:mga05p37_665334_c1 nmdc:mga05p37_665334_c1_579_953 117
438 3300053083 Ga0495655_0129520 Ga0495655_0129520_76_453 117
439 3300053140 Ga0500573_0002950 Ga0500573_0002950_7025_7396 117
440 3300061719 Ga0466962_0395057 Ga0466962_0395057_103_465 117
441 iso_pu_bacteria 2816332139 2816510946 117
442 iso_pu_bacteria 2904770941 2904775459 117
443 iso_pu_bacteria 8054472261 8054477036 117
444 3300005327 Ga0070658_10269501 Ga0070658_102695012 118
445 3300005329 Ga0070683_101643794 Ga0070683_1016437942 118
446 3300005337 Ga0070682_100413008 Ga0070682_1004130081 118
447 3300005344 Ga0070661_101511007 Ga0070661_1015110071 118
448 3300005344 Ga0070661_101745912 Ga0070661_1017459122 118
449 3300005354 Ga0070675_101669049 Ga0070675_1016690492 118
450 3300005366 Ga0070659_101900861 Ga0070659_1019008612 118
451 3300005435 Ga0070714_100589793 Ga0070714_1005897932 118
452 3300005435 Ga0070714_101362271 Ga0070714_1013622712 118
453 3300005455 Ga0070663_101159059 Ga0070663_1011590591 118
454 3300005458 Ga0070681_10230902 Ga0070681_102309021 118
455 3300005530 Ga0070679_100281467 Ga0070679_1002814672 118
456 3300005530 Ga0070679_101999825 Ga0070679_1019998251 118
457 3300005564 Ga0070664_100460327 Ga0070664_1004603272 118
458 3300005614 Ga0068856_100085216 Ga0068856_1000852162 118
459 3300005614 Ga0068856_101586838 Ga0068856_1015868382 118
460 3300009093 Ga0105240_11584503 Ga0105240_115845032 118
461 3300009545 Ga0105237_10139646 Ga0105237_101396463 118
462 3300013306 Ga0163162_11067355 Ga0163162_110673552 118
463 3300020069 Ga0197907_11378065 Ga0197907_113780652 118
464 3300020077 Ga0206351_10913268 Ga0206351_109132682 118
465 3300020078 Ga0206352_11204810 Ga0206352_112048101 118
466 3300020081 Ga0206354_11164954 Ga0206354_111649542 118
467 3300020082 Ga0206353_11199355 Ga0206353_111993552 118
468 3300022467 Ga0224712_10074108 Ga0224712_100741082 118
469 3300025909 Ga0207705_10146402 Ga0207705_101464022 118
470 3300025912 Ga0207707_10406869 Ga0207707_104068692 118
471 3300025917 Ga0207660_10411964 Ga0207660_104119642 118
472 3300025919 Ga0207657_10122354 Ga0207657_101223542 118
473 3300025921 Ga0207652_10379756 Ga0207652_103797562 118
474 3300025944 Ga0207661_10482111 Ga0207661_104821112 118
475 3300025949 Ga0207667_10008089 Ga0207667_1000808910 118
476 3300026075 Ga0207708_11036099 Ga0207708_110360992 118
477 3300026078 Ga0207702_11275340 Ga0207702_112753402 118
478 3300026095 Ga0207676_11635771 Ga0207676_116357712 118
479 3300031548 Ga0307408_101100507 Ga0307408_1011005072 118
480 3300031731 Ga0307405_10203021 Ga0307405_102030211 118
481 3300031731 Ga0307405_10257565 Ga0307405_102575652 118
482 3300031731 Ga0307405_10332957 Ga0307405_103329572 118
483 3300031824 Ga0307413_10277088 Ga0307413_102770882 118
484 3300031824 Ga0307413_10392391 Ga0307413_103923912 118
485 3300031824 Ga0307413_10802573 Ga0307413_108025732 118
486 3300031852 Ga0307410_10016988 Ga0307410_100169883 118
487 3300031852 Ga0307410_10118415 Ga0307410_101184152 118
488 3300031852 Ga0307410_10162267 Ga0307410_101622672 118
489 3300031852 Ga0307410_10225713 Ga0307410_102257132 118
490 3300031852 Ga0307410_10244451 Ga0307410_102444512 118
491 3300031852 Ga0307410_10702803 Ga0307410_107028032 118
492 3300031852 Ga0307410_11831940 Ga0307410_118319402 118
493 3300031901 Ga0307406_10014342 Ga0307406_100143422 118
494 3300031901 Ga0307406_10152468 Ga0307406_101524682 118
495 3300031901 Ga0307406_12123630 Ga0307406_121236301 118
496 3300031903 Ga0307407_10034549 Ga0307407_100345493 118
497 3300031903 Ga0307407_10211387 Ga0307407_102113872 118
498 3300031911 Ga0307412_10184827 Ga0307412_101848272 118
499 3300031911 Ga0307412_10541266 Ga0307412_105412662 118
500 3300031995 Ga0307409_100253164 Ga0307409_1002531642 118
501 3300031995 Ga0307409_100259222 Ga0307409_1002592222 118
502 3300031995 Ga0307409_100276946 Ga0307409_1002769462 118
503 3300031995 Ga0307409_100345194 Ga0307409_1003451942 118
504 3300031995 Ga0307409_100445573 Ga0307409_1004455732 118
505 3300031995 Ga0307409_100906225 Ga0307409_1009062252 118
506 3300031995 Ga0307409_101727881 Ga0307409_1017278811 118
507 3300032002 Ga0307416_100006810 Ga0307416_1000068109 118
508 3300032002 Ga0307416_100052929 Ga0307416_1000529294 118
509 3300032002 Ga0307416_101319095 Ga0307416_1013190952 118
510 3300032002 Ga0307416_101547146 Ga0307416_1015471462 118
511 3300032002 Ga0307416_103013596 Ga0307416_1030135962 118
512 3300032004 Ga0307414_10230363 Ga0307414_102303632 118
513 3300032004 Ga0307414_10744700 Ga0307414_107447002 118
514 3300032004 Ga0307414_10936421 Ga0307414_109364212 118
515 3300032004 Ga0307414_10980978 Ga0307414_109809782 118
516 3300032004 Ga0307414_12063431 Ga0307414_120634311 118
517 3300032005 Ga0307411_10082528 Ga0307411_100825282 118
518 3300032005 Ga0307411_10130150 Ga0307411_101301502 118
519 3300032005 Ga0307411_10907144 Ga0307411_109071442 118
520 3300032126 Ga0307415_100001340 Ga0307415_1000013408 118
521 3300032126 Ga0307415_100359781 Ga0307415_1003597812 118
522 3300032126 Ga0307415_100591492 Ga0307415_1005914922 118
523 3300032126 Ga0307415_100721349 Ga0307415_1007213492 118
524 3300032126 Ga0307415_100783752 Ga0307415_1007837522 118
525 3300032126 Ga0307415_100913198 Ga0307415_1009131982 118
526 3300037312 Ga0395899_0190128 Ga0395899_0190128_219_584 118
527 3300037418 Ga0395900_0010397 Ga0395900_0010397_4775_5140 118
528 3300037418 Ga0395900_0263376 Ga0395900_0263376_902_1270 118
529 3300037418 Ga0395900_0352956 Ga0395900_0352956_472_828 118
530 3300037466 Ga0395898_0218095 Ga0395898_0218095_924_1289 118
531 3300037466 Ga0395898_0365696 Ga0395898_0365696_584_940 118
532 3300037471 Ga0395905_0443169 Ga0395905_0443169_430_786 118
533 3300038443 Ga0395901_0020349 Ga0395901_0020349_496_852 118
534 3300039450 Ga0436363_0364438 Ga0436363_0364438_33_395 118
535 3300044656 Ga0466969_0332187 Ga0466969_0332187_260_628 118
536 3300044683 Ga0466965_0109885 Ga0466965_0109885_467_835 118
537 3300044683 Ga0466965_0146068 Ga0466965_0146068_317_682 118
538 3300044683 Ga0466965_0212713 Ga0466965_0212713_381_749 118
539 3300044683 Ga0466965_0309531 Ga0466965_0309531_234_629 118
540 3300044684 Ga0466966_0119260 Ga0466966_0119260_732_1088 118
541 3300044684 Ga0466966_0306645 Ga0466966_0306645_518_883 118
542 3300044684 Ga0466966_0318221 Ga0466966_0318221_318_686 118
543 3300044693 Ga0466961_0357448 Ga0466961_0357448_217_612 118
544 3300044693 Ga0466961_0428840 Ga0466961_0428840_66_443 118
545 3300044693 Ga0466961_0642096 Ga0466961_0642096_241_609 118
546 3300044693 Ga0466961_0677403 Ga0466961_0677403_58_426 118
547 3300044694 Ga0466963_0070176 Ga0466963_0070176_1561_1926 118
548 3300044694 Ga0466963_0314297 Ga0466963_0314297_142_510 118
549 3300044694 Ga0466963_0420631 Ga0466963_0420631_94_450 118
550 3300044694 Ga0466963_0576829 Ga0466963_0576829_25_393 118
551 3300044706 Ga0466964_0857081 Ga0466964_0857081_60_428 118
552 3300044719 Ga0466971_0046224 Ga0466971_0046224_487_855 118
553 3300044719 Ga0466971_0231490 Ga0466971_0231490_138_506 118
554 3300044765 Ga0466970_0066688 Ga0466970_0066688_291_659 118
555 3300044765 Ga0466970_0110371 Ga0466970_0110371_345_722 118
556 3300044765 Ga0466970_0135278 Ga0466970_0135278_484_849 118
557 3300044765 Ga0466970_0171037 Ga0466970_0171037_13_381 118
558 3300044765 Ga0466970_0281640 Ga0466970_0281640_488_844 118
559 3300044765 Ga0466970_0346297 Ga0466970_0346297_70_438 118
560 3300044842 Ga0466957_0173790 Ga0466957_0173790_607_972 118
561 3300044842 Ga0466957_0174924 Ga0466957_0174924_875_1252 118
562 3300044842 Ga0466957_0292105 Ga0466957_0292105_468_836 118
563 3300044901 Ga0466960_0258515 Ga0466960_0258515_292_687 118
564 3300044901 Ga0466960_0326648 Ga0466960_0326648_92_457 118
565 3300044901 Ga0466960_0352644 Ga0466960_0352644_453_821 118
566 3300044901 Ga0466960_0440660 Ga0466960_0440660_244_612 118
567 3300044901 Ga0466960_0630885 Ga0466960_0630885_227_592 118
568 3300044901 Ga0466960_0658606 Ga0466960_0658606_57_425 118
569 3300044901 Ga0466960_0828128 Ga0466960_0828128_34_399 118
570 3300045049 Ga0466959_0151691 Ga0466959_0151691_412_777 118
571 3300045049 Ga0466959_0286376 Ga0466959_0286376_247_603 118
572 3300045049 Ga0466959_0295720 Ga0466959_0295720_474_842 118
573 3300045049 Ga0466959_0397504 Ga0466959_0397504_77_445 118
574 3300045836 Ga0466958_0306344 Ga0466958_0306344_619_984 118
575 3300045836 Ga0466958_0403811 Ga0466958_0403811_323_691 118
576 3300045836 Ga0466958_0516290 Ga0466958_0516290_346_714 118
577 3300045836 Ga0466958_0592938 Ga0466958_0592938_169_564 118
578 3300045836 Ga0466958_0701008 Ga0466958_0701008_158_526 118
579 3300045976 Ga0466967_0107869 Ga0466967_0107869_170_538 118
580 3300045976 Ga0466967_0129378 Ga0466967_0129378_1793_2161 118
581 3300045976 Ga0466967_0207899 Ga0466967_0207899_131_499 118
582 3300045976 Ga0466967_0285056 Ga0466967_0285056_428_796 118
583 3300045976 Ga0466967_0398054 Ga0466967_0398054_514_870 118
584 3300045976 Ga0466967_0901519 Ga0466967_0901519_13_381 118
585 3300045976 Ga0466967_0983356 Ga0466967_0983356_109_477 118
586 3300046513 Ga0495616_0150365 Ga0495616_0150365_27_392 118
587 3300046615 Ga0495656_0266203 Ga0495656_0266203_450_815 118
588 3300046616 Ga0495668_0556789 Ga0495668_0556789_100_465 118
589 3300046616 Ga0495668_0865714 Ga0495668_0865714_122_487 118
590 3300047445 Ga0495677_0371654 Ga0495677_0371654_153_518 118
591 3300048903 Ga0496100_0302834 Ga0496100_0302834_237_605 118
592 3300048904 Ga0496101_1031256 Ga0496101_1031256_127_489 118
593 3300048911 Ga0496108_0572006 Ga0496108_0572006_559_921 118
594 3300048912 Ga0496109_1551917 Ga0496109_1551917_126_515 118
595 3300048915 Ga0496112_0677272 Ga0496112_0677272_437_805 118
596 3300049514 Ga0501291_127489 Ga0501291_127489_88_456 118
597 3300049533 Ga0501317_076601 Ga0501317_076601_156_512 118
598 3300049575 Ga0501039_0491000 Ga0501039_0491000_362_727 118
599 3300049653 Ga0501206_038869 Ga0501206_038869_172_537 118
600 3300053739 Ga0500587_017719 Ga0500587_017719_61_426 118
601 3300054114 Ga0501084_0672181 Ga0501084_0672181_443_808 118
602 3300061719 Ga0466962_0147868 Ga0466962_0147868_93_461 118
603 3300061719 Ga0466962_0621396 Ga0466962_0621396_118_486 118
604 3300061734 Ga0530510_0751157 Ga0530510_0751157_244_609 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06243

PaaB

Phenylacetic acid degradation B

51

139

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iit-assembly1.cif.gz_B-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.877 29 88
3egr-assembly1.cif.gz_B-2 crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution 0.8709 29 88
3egr-assembly1.cif.gz_B-2 crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution 0.8331 29 88
4iit-assembly1.cif.gz_B-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8266 29 88
2nzi-assembly2.cif.gz_B crystal structure of domains a168-a170 from titin 0.7539 29 53
ID Description Score Start End Superfamily
af_P76078_2_65_3.10.20.520 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8775 29 88 3.10.20.520
3egrB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8684 29 88 3.10.20.520
3egrB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8301 29 88 3.10.20.520
af_P76078_2_65_3.10.20.520 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B 0.8146 29 88 3.10.20.520
2nziB03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7539 29 53 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3B0R5H2-F1-model_v4 1,2-phenylacetyl-CoA epoxidase, subunit B (EC 1.14.13.149) 0.9004 29 83 GO:0097266
AF-A0A2T0LAA4-F1-model_v4 Ring-1,2-phenylacetyl-CoA epoxidase subunit PaaB 0.8976 29 87
AF-A0A1K1Y778-F1-model_v4 deleted 0.8961 30 87
AF-A0A7W1XAX1-F1-model_v4 Phenylacetic acid degradation protein 0.8906 29 87
AF-A0A4R1BCV9-F1-model_v4 Uncharacterized protein 0.8904 30 87

Feature Viewer

pLDDT pTM Quality
70.5 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map