F468354
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 604 | 280 | 591 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100685636|Ga0070708_1006856362 |
| Length | 141 |
| Sequence | MISEPEGRGAAWTEERGTSDEGTRRPEGAPQASRRHGGNGDIAGGEPARSEWPLWEVFLRGKRGLNHVHVGSLHAADATMALHHARDLYTRRNEGVSIWVVRAADITASSPDEKDPFFVPSGDKVYRHPTFYDIPDTVPHI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 2 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 3 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 4 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 5 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 6 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 7 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 8 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 9 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 10 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 194 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 201 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 252 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 266 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 275 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 276 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 279 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 280 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.19 |
| Metatranscriptomes | 1.66 |
| Isolates | 2.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.82 |
| Nodule | 0 |
| Rhizoplane | 5.63 |
| Rhizosphere | 89.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10269501 | 3300005327 | Bacteria | 1448 |
| 2 | Ga0070658_11072499 | 3300005327 | Bacteria | 701 |
| 3 | Ga0070676_10036296 | 3300005328 | Bacteria | 2839 |
| 4 | Ga0070683_100220769 | 3300005329 | Bacteria | 1801 |
| 5 | Ga0070683_101643794 | 3300005329 | Bacteria | 618 |
| 6 | Ga0070690_100892606 | 3300005330 | Bacteria | 695 |
| 7 | Ga0070690_101576087 | 3300005330 | Bacteria | 532 |
| 8 | Ga0070670_100194595 | 3300005331 | Bacteria | 1761 |
| 9 | Ga0070670_100248279 | 3300005331 | Bacteria | 1550 |
| 10 | Ga0070670_101122017 | 3300005331 | Bacteria | 717 |
| 11 | Ga0068869_100028918 | 3300005334 | Bacteria | 3877 |
| 12 | Ga0068869_100549990 | 3300005334 | Bacteria | 969 |
| 13 | Ga0068869_101500091 | 3300005334 | Bacteria | 598 |
| 14 | Ga0070682_100105339 | 3300005337 | Bacteria | 1869 |
| 15 | Ga0070682_100190225 | 3300005337 | Bacteria | 1440 |
| 16 | Ga0070682_100313011 | 3300005337 | Bacteria | 1156 |
| 17 | Ga0070682_100413008 | 3300005337 | Bacteria | 1024 |
| 18 | Ga0068868_100106928 | 3300005338 | Bacteria | 2270 |
| 19 | Ga0068868_100357344 | 3300005338 | Bacteria | 1252 |
| 20 | Ga0068868_100753042 | 3300005338 | Bacteria | 875 |
| 21 | Ga0070689_100701741 | 3300005340 | Bacteria | 884 |
| 22 | Ga0070687_101507977 | 3300005343 | Bacteria | 506 |
| 23 | Ga0070661_100399382 | 3300005344 | Bacteria | 1087 |
| 24 | Ga0070661_101511007 | 3300005344 | Bacteria | 567 |
| 25 | Ga0070661_101745912 | 3300005344 | Bacteria | 528 |
| 26 | Ga0070692_10062655 | 3300005345 | Bacteria | 1963 |
| 27 | Ga0070668_100020774 | 3300005347 | Bacteria | 4959 |
| 28 | Ga0070668_100223470 | 3300005347 | Bacteria | 1554 |
| 29 | Ga0070675_101669049 | 3300005354 | Bacteria | 588 |
| 30 | Ga0070671_100001754 | 3300005355 | Bacteria | 16478 |
| 31 | Ga0070674_100016051 | 3300005356 | Bacteria | 4689 |
| 32 | Ga0070688_100259688 | 3300005365 | Bacteria | 1240 |
| 33 | Ga0070688_100545731 | 3300005365 | Bacteria | 880 |
| 34 | Ga0070659_100009212 | 3300005366 | Bacteria | 7245 |
| 35 | Ga0070659_100894678 | 3300005366 | Bacteria | 776 |
| 36 | Ga0070659_101900861 | 3300005366 | Bacteria | 534 |
| 37 | Ga0070667_100704230 | 3300005367 | Bacteria | 935 |
| 38 | Ga0070667_101147725 | 3300005367 | Bacteria | 727 |
| 39 | Ga0070667_101372804 | 3300005367 | Bacteria | 663 |
| 40 | Ga0070709_10574087 | 3300005434 | Bacteria | 865 |
| 41 | Ga0070714_100511734 | 3300005435 | Bacteria | 1146 |
| 42 | Ga0070714_100589793 | 3300005435 | Bacteria | 1067 |
| 43 | Ga0070714_101161575 | 3300005435 | Bacteria | 753 |
| 44 | Ga0070714_101362271 | 3300005435 | Bacteria | 693 |
| 45 | Ga0070713_100213352 | 3300005436 | Bacteria | 1749 |
| 46 | Ga0070713_100600182 | 3300005436 | Bacteria | 1046 |
| 47 | Ga0070713_101937499 | 3300005436 | Bacteria | 572 |
| 48 | Ga0070701_10631820 | 3300005438 | Bacteria | 713 |
| 49 | Ga0070700_100114084 | 3300005441 | Bacteria | 1801 |
| 50 | Ga0070700_101050019 | 3300005441 | Bacteria | 672 |
| 51 | Ga0070700_101292022 | 3300005441 | Bacteria | 613 |
| 52 | Ga0070708_100685636 | 3300005445 | Bacteria | 965 |
| 53 | Ga0070663_100000691 | 3300005455 | Bacteria | 18161 |
| 54 | Ga0070663_100008282 | 3300005455 | Bacteria | 6387 |
| 55 | Ga0070663_100072005 | 3300005455 | Bacteria | 2516 |
| 56 | Ga0070663_100566307 | 3300005455 | Bacteria | 951 |
| 57 | Ga0070663_100853972 | 3300005455 | Bacteria | 784 |
| 58 | Ga0070663_101159059 | 3300005455 | Bacteria | 678 |
| 59 | Ga0070678_100139753 | 3300005456 | Bacteria | 1936 |
| 60 | Ga0070678_100772213 | 3300005456 | Bacteria | 871 |
| 61 | Ga0070678_101016011 | 3300005456 | Bacteria | 763 |
| 62 | Ga0070662_100429064 | 3300005457 | Bacteria | 1095 |
| 63 | Ga0070681_10230902 | 3300005458 | Bacteria | 1765 |
| 64 | Ga0070685_10367558 | 3300005466 | Bacteria | 987 |
| 65 | Ga0070685_10431040 | 3300005466 | Bacteria | 919 |
| 66 | Ga0070706_100522069 | 3300005467 | Bacteria | 1105 |
| 67 | Ga0070679_100281467 | 3300005530 | Bacteria | 1616 |
| 68 | Ga0070679_101999825 | 3300005530 | Bacteria | 529 |
| 69 | Ga0070684_100078631 | 3300005535 | Bacteria | 2914 |
| 70 | Ga0070684_101584601 | 3300005535 | Bacteria | 618 |
| 71 | Ga0070665_100002791 | 3300005548 | Bacteria | 18933 |
| 72 | Ga0070665_100108059 | 3300005548 | Bacteria | 2784 |
| 73 | Ga0070665_100175177 | 3300005548 | Bacteria | 2146 |
| 74 | Ga0070665_101098648 | 3300005548 | Bacteria | 807 |
| 75 | Ga0070664_100006472 | 3300005564 | Bacteria | 9442 |
| 76 | Ga0070664_100155191 | 3300005564 | Bacteria | 2023 |
| 77 | Ga0070664_100460327 | 3300005564 | Bacteria | 1169 |
| 78 | Ga0070664_100474221 | 3300005564 | Bacteria | 1151 |
| 79 | Ga0070664_100474704 | 3300005564 | Bacteria | 1150 |
| 80 | Ga0070664_100775832 | 3300005564 | Bacteria | 895 |
| 81 | Ga0068857_100080862 | 3300005577 | Bacteria | 2901 |
| 82 | Ga0068857_100172991 | 3300005577 | Bacteria | 1963 |
| 83 | Ga0068857_100237112 | 3300005577 | Bacteria | 1669 |
| 84 | Ga0068857_101970127 | 3300005577 | Bacteria | 573 |
| 85 | Ga0068856_100085216 | 3300005614 | Bacteria | 3139 |
| 86 | Ga0068856_100120619 | 3300005614 | Bacteria | 2623 |
| 87 | Ga0068856_100415097 | 3300005614 | Bacteria | 1366 |
| 88 | Ga0068856_100453302 | 3300005614 | Bacteria | 1303 |
| 89 | Ga0068856_101438173 | 3300005614 | Bacteria | 704 |
| 90 | Ga0068856_101586838 | 3300005614 | Bacteria | 668 |
| 91 | Ga0068852_100037968 | 3300005616 | Bacteria | 4044 |
| 92 | Ga0068852_100198975 | 3300005616 | Bacteria | 1895 |
| 93 | Ga0068852_100344764 | 3300005616 | Bacteria | 1453 |
| 94 | Ga0068859_100414361 | 3300005617 | Bacteria | 1443 |
| 95 | Ga0068859_102069549 | 3300005617 | Bacteria | 628 |
| 96 | Ga0068864_100147606 | 3300005618 | Bacteria | 2127 |
| 97 | Ga0068864_100197539 | 3300005618 | Bacteria | 1846 |
| 98 | Ga0068851_10113572 | 3300005834 | Bacteria | 1448 |
| 99 | Ga0068870_10091369 | 3300005840 | Bacteria | 1702 |
| 100 | Ga0068863_100125060 | 3300005841 | Bacteria | 2453 |
| 101 | Ga0068863_100934144 | 3300005841 | Bacteria | 869 |
| 102 | Ga0068858_100332844 | 3300005842 | Bacteria | 1452 |
| 103 | Ga0068858_101796537 | 3300005842 | Bacteria | 606 |
| 104 | Ga0068860_100077660 | 3300005843 | Bacteria | 3158 |
| 105 | Ga0068860_100327261 | 3300005843 | Bacteria | 1505 |
| 106 | Ga0068860_102212982 | 3300005843 | Bacteria | 571 |
| 107 | Ga0068862_100013982 | 3300005844 | Bacteria | 6655 |
| 108 | Ga0070717_10240354 | 3300006028 | Bacteria | 1597 |
| 109 | Ga0075364_10077973 | 3300006051 | Bacteria | 2187 |
| 110 | Ga0070716_100204696 | 3300006173 | Bacteria | 1314 |
| 111 | Ga0075362_10180173 | 3300006177 | Bacteria | 1024 |
| 112 | Ga0075428_102583332 | 3300006844 | Bacteria | 519 |
| 113 | Ga0097620_100414356 | 3300006931 | Bacteria | 1443 |
| 114 | Ga0097620_102069647 | 3300006931 | Bacteria | 628 |
| 115 | Ga0105251_10190647 | 3300009011 | Bacteria | 923 |
| 116 | Ga0105240_11584503 | 3300009093 | Bacteria | 685 |
| 117 | Ga0105245_10052805 | 3300009098 | Bacteria | 3646 |
| 118 | Ga0105245_10576387 | 3300009098 | Bacteria | 1149 |
| 119 | Ga0105245_10773039 | 3300009098 | Bacteria | 997 |
| 120 | Ga0105245_12903688 | 3300009098 | Bacteria | 531 |
| 121 | Ga0105247_10059559 | 3300009101 | Bacteria | 2364 |
| 122 | Ga0105247_10468662 | 3300009101 | Bacteria | 912 |
| 123 | Ga0114129_11368718 | 3300009147 | Bacteria | 874 |
| 124 | Ga0105243_10734497 | 3300009148 | Bacteria | 966 |
| 125 | Ga0105243_10800371 | 3300009148 | Bacteria | 929 |
| 126 | Ga0105242_10003049 | 3300009176 | Bacteria | 13097 |
| 127 | Ga0105248_10317590 | 3300009177 | Bacteria | 1754 |
| 128 | Ga0105237_10056196 | 3300009545 | Bacteria | 3940 |
| 129 | Ga0105237_10139646 | 3300009545 | Bacteria | 2417 |
| 130 | Ga0105237_11597797 | 3300009545 | Bacteria | 659 |
| 131 | Ga0105237_12055133 | 3300009545 | Bacteria | 580 |
| 132 | Ga0105249_10083692 | 3300009553 | Bacteria | 2970 |
| 133 | Ga0105249_11256087 | 3300009553 | Bacteria | 812 |
| 134 | Ga0105239_10062376 | 3300010375 | Bacteria | 4091 |
| 135 | Ga0105239_10218122 | 3300010375 | Bacteria | 2139 |
| 136 | Ga0105239_10705003 | 3300010375 | Bacteria | 1154 |
| 137 | Ga0105239_13122216 | 3300010375 | Bacteria | 540 |
| 138 | Ga0105246_10369010 | 3300011119 | Bacteria | 1182 |
| 139 | Ga0105246_10881363 | 3300011119 | Bacteria | 801 |
| 140 | Ga0157369_10520850 | 3300013105 | Bacteria | 1230 |
| 141 | Ga0157374_10121598 | 3300013296 | Bacteria | 2520 |
| 142 | Ga0157374_10565014 | 3300013296 | Bacteria | 1146 |
| 143 | Ga0157374_10765673 | 3300013296 | Bacteria | 980 |
| 144 | Ga0157374_11496161 | 3300013296 | Bacteria | 698 |
| 145 | Ga0157378_11185904 | 3300013297 | Bacteria | 803 |
| 146 | Ga0157378_11188518 | 3300013297 | Bacteria | 802 |
| 147 | Ga0157378_13029934 | 3300013297 | Bacteria | 521 |
| 148 | Ga0163162_10089061 | 3300013306 | Bacteria | 3166 |
| 149 | Ga0163162_10799951 | 3300013306 | Bacteria | 1060 |
| 150 | Ga0163162_11067355 | 3300013306 | Bacteria | 914 |
| 151 | Ga0157372_10164614 | 3300013307 | Bacteria | 2564 |
| 152 | Ga0157372_12182887 | 3300013307 | Bacteria | 636 |
| 153 | Ga0157375_10342218 | 3300013308 | Bacteria | 1661 |
| 154 | Ga0157375_13200029 | 3300013308 | Bacteria | 546 |
| 155 | Ga0163163_10664361 | 3300014325 | Bacteria | 1106 |
| 156 | Ga0163163_12059428 | 3300014325 | Bacteria | 630 |
| 157 | Ga0157380_10198317 | 3300014326 | Bacteria | 1778 |
| 158 | Ga0157377_11288940 | 3300014745 | Bacteria | 570 |
| 159 | Ga0157379_10964074 | 3300014968 | Bacteria | 812 |
| 160 | Ga0157379_12454913 | 3300014968 | Bacteria | 521 |
| 161 | Ga0197907_11378065 | 3300020069 | Bacteria | 1533 |
| 162 | Ga0206351_10913268 | 3300020077 | Bacteria | 1859 |
| 163 | Ga0206352_11204810 | 3300020078 | Bacteria | 998 |
| 164 | Ga0206350_10093833 | 3300020080 | Bacteria | 599 |
| 165 | Ga0206354_10112504 | 3300020081 | Bacteria | 859 |
| 166 | Ga0206354_11164954 | 3300020081 | Bacteria | 1313 |
| 167 | Ga0206353_11199355 | 3300020082 | Bacteria | 3057 |
| 168 | Ga0213876_10079821 | 3300021384 | Bacteria | 1729 |
| 169 | Ga0213875_10006652 | 3300021388 | Bacteria | 6039 |
| 170 | Ga0213875_10024074 | 3300021388 | Bacteria | 2905 |
| 171 | Ga0213875_10026935 | 3300021388 | Bacteria | 2735 |
| 172 | Ga0224712_10055690 | 3300022467 | Bacteria | 1556 |
| 173 | Ga0224712_10074108 | 3300022467 | Bacteria | 1390 |
| 174 | Ga0207656_10155617 | 3300025321 | Bacteria | 1085 |
| 175 | Ga0207692_10043552 | 3300025898 | Bacteria | 2234 |
| 176 | Ga0207642_10278184 | 3300025899 | Bacteria | 961 |
| 177 | Ga0207710_10632123 | 3300025900 | Bacteria | 560 |
| 178 | Ga0207688_10064397 | 3300025901 | Bacteria | 2070 |
| 179 | Ga0207688_10339570 | 3300025901 | Bacteria | 924 |
| 180 | Ga0207688_10354605 | 3300025901 | Bacteria | 904 |
| 181 | Ga0207699_10263628 | 3300025906 | Bacteria | 1192 |
| 182 | Ga0207645_10046690 | 3300025907 | Bacteria | 2766 |
| 183 | Ga0207645_10169397 | 3300025907 | Bacteria | 1431 |
| 184 | Ga0207643_10027448 | 3300025908 | Bacteria | 3157 |
| 185 | Ga0207705_10146402 | 3300025909 | Bacteria | 1767 |
| 186 | Ga0207705_10642545 | 3300025909 | Bacteria | 825 |
| 187 | Ga0207705_11016734 | 3300025909 | Bacteria | 640 |
| 188 | Ga0207684_10627105 | 3300025910 | Bacteria | 917 |
| 189 | Ga0207707_10406869 | 3300025912 | Bacteria | 1168 |
| 190 | Ga0207695_10760280 | 3300025913 | Bacteria | 849 |
| 191 | Ga0207671_10255181 | 3300025914 | Bacteria | 1379 |
| 192 | Ga0207693_10007426 | 3300025915 | Bacteria | 9013 |
| 193 | Ga0207663_10077362 | 3300025916 | Bacteria | 2165 |
| 194 | Ga0207660_10411964 | 3300025917 | Bacteria | 1089 |
| 195 | Ga0207657_10052911 | 3300025919 | Bacteria | 3521 |
| 196 | Ga0207657_10122354 | 3300025919 | Bacteria | 2140 |
| 197 | Ga0207649_10023680 | 3300025920 | Bacteria | 3559 |
| 198 | Ga0207649_10247874 | 3300025920 | Bacteria | 1281 |
| 199 | Ga0207652_10379756 | 3300025921 | Bacteria | 1275 |
| 200 | Ga0207650_10364322 | 3300025925 | Bacteria | 1191 |
| 201 | Ga0207650_10518328 | 3300025925 | Bacteria | 997 |
| 202 | Ga0207659_10339880 | 3300025926 | Bacteria | 1243 |
| 203 | Ga0207659_11795545 | 3300025926 | Bacteria | 521 |
| 204 | Ga0207687_10244508 | 3300025927 | Bacteria | 1424 |
| 205 | Ga0207687_10518425 | 3300025927 | Bacteria | 997 |
| 206 | Ga0207700_10106839 | 3300025928 | Bacteria | 2245 |
| 207 | Ga0207700_10117145 | 3300025928 | Bacteria | 2153 |
| 208 | Ga0207664_10128207 | 3300025929 | Bacteria | 2132 |
| 209 | Ga0207644_10001034 | 3300025931 | Bacteria | 17840 |
| 210 | Ga0207690_10431260 | 3300025932 | Bacteria | 1056 |
| 211 | Ga0207690_10595328 | 3300025932 | Bacteria | 902 |
| 212 | Ga0207690_10993985 | 3300025932 | Bacteria | 698 |
| 213 | Ga0207690_11077102 | 3300025932 | Bacteria | 670 |
| 214 | Ga0207706_10232184 | 3300025933 | Bacteria | 1614 |
| 215 | Ga0207706_10609402 | 3300025933 | Bacteria | 937 |
| 216 | Ga0207709_10607702 | 3300025935 | Bacteria | 866 |
| 217 | Ga0207670_11306249 | 3300025936 | Bacteria | 615 |
| 218 | Ga0207670_11421573 | 3300025936 | Bacteria | 589 |
| 219 | Ga0207669_11243339 | 3300025937 | Bacteria | 632 |
| 220 | Ga0207665_10034114 | 3300025939 | Bacteria | 3377 |
| 221 | Ga0207691_10057259 | 3300025940 | Bacteria | 3548 |
| 222 | Ga0207711_10528909 | 3300025941 | Bacteria | 1100 |
| 223 | Ga0207689_10092906 | 3300025942 | Bacteria | 2479 |
| 224 | Ga0207689_10221508 | 3300025942 | Bacteria | 1563 |
| 225 | Ga0207689_10434379 | 3300025942 | Bacteria | 1096 |
| 226 | Ga0207661_10097432 | 3300025944 | Bacteria | 2463 |
| 227 | Ga0207661_10482111 | 3300025944 | Bacteria | 1132 |
| 228 | Ga0207661_10657465 | 3300025944 | Bacteria | 963 |
| 229 | Ga0207661_11557065 | 3300025944 | Bacteria | 605 |
| 230 | Ga0207679_10683221 | 3300025945 | Bacteria | 930 |
| 231 | Ga0207679_11169718 | 3300025945 | Bacteria | 706 |
| 232 | Ga0207667_10008089 | 3300025949 | Bacteria | 12537 |
| 233 | Ga0207651_10868728 | 3300025960 | Bacteria | 802 |
| 234 | Ga0207712_10212330 | 3300025961 | Bacteria | 1542 |
| 235 | Ga0207712_11248439 | 3300025961 | Bacteria | 663 |
| 236 | Ga0207668_10048725 | 3300025972 | Bacteria | 2909 |
| 237 | Ga0207668_10407151 | 3300025972 | Bacteria | 1151 |
| 238 | Ga0207668_12115415 | 3300025972 | Bacteria | 507 |
| 239 | Ga0207640_10112592 | 3300025981 | Bacteria | 1932 |
| 240 | Ga0207640_10567443 | 3300025981 | Bacteria | 956 |
| 241 | Ga0207658_10396614 | 3300025986 | Bacteria | 1212 |
| 242 | Ga0207658_10428780 | 3300025986 | Bacteria | 1167 |
| 243 | Ga0207658_10849801 | 3300025986 | Bacteria | 830 |
| 244 | Ga0207677_10029498 | 3300026023 | Bacteria | 3487 |
| 245 | Ga0207677_10088203 | 3300026023 | Bacteria | 2248 |
| 246 | Ga0207677_10173351 | 3300026023 | Bacteria | 1689 |
| 247 | Ga0207703_10087351 | 3300026035 | Bacteria | 2614 |
| 248 | Ga0207703_10551390 | 3300026035 | Bacteria | 1087 |
| 249 | Ga0207639_10158178 | 3300026041 | Bacteria | 1906 |
| 250 | Ga0207678_10000314 | 3300026067 | Bacteria | 43676 |
| 251 | Ga0207678_10037560 | 3300026067 | Bacteria | 4212 |
| 252 | Ga0207678_10065198 | 3300026067 | Bacteria | 3128 |
| 253 | Ga0207678_10230295 | 3300026067 | Bacteria | 1586 |
| 254 | Ga0207708_10269888 | 3300026075 | Bacteria | 1376 |
| 255 | Ga0207708_10564314 | 3300026075 | Bacteria | 961 |
| 256 | Ga0207708_10656241 | 3300026075 | Bacteria | 893 |
| 257 | Ga0207708_11036099 | 3300026075 | Bacteria | 714 |
| 258 | Ga0207702_10361772 | 3300026078 | Bacteria | 1391 |
| 259 | Ga0207702_10617836 | 3300026078 | Bacteria | 1064 |
| 260 | Ga0207702_11275340 | 3300026078 | Bacteria | 729 |
| 261 | Ga0207641_10105936 | 3300026088 | Bacteria | 2484 |
| 262 | Ga0207641_11330508 | 3300026088 | Bacteria | 719 |
| 263 | Ga0207648_10315635 | 3300026089 | Bacteria | 1404 |
| 264 | Ga0207676_10162642 | 3300026095 | Bacteria | 1935 |
| 265 | Ga0207676_11635771 | 3300026095 | Bacteria | 642 |
| 266 | Ga0207676_12440977 | 3300026095 | Bacteria | 520 |
| 267 | Ga0207674_10048933 | 3300026116 | Bacteria | 4325 |
| 268 | Ga0207674_10198458 | 3300026116 | Bacteria | 1956 |
| 269 | Ga0207674_10900824 | 3300026116 | Bacteria | 853 |
| 270 | Ga0207674_11599728 | 3300026116 | Bacteria | 620 |
| 271 | Ga0207675_100165113 | 3300026118 | Bacteria | 2114 |
| 272 | Ga0207675_100221368 | 3300026118 | Bacteria | 1824 |
| 273 | Ga0207675_100830527 | 3300026118 | Bacteria | 938 |
| 274 | Ga0207683_10076164 | 3300026121 | Bacteria | 2970 |
| 275 | Ga0207683_10426422 | 3300026121 | Bacteria | 1222 |
| 276 | Ga0207698_10110995 | 3300026142 | Bacteria | 2298 |
| 277 | Ga0207698_10307224 | 3300026142 | Bacteria | 1479 |
| 278 | Ga0268266_10013711 | 3300028379 | Bacteria | 6980 |
| 279 | Ga0268266_10112529 | 3300028379 | Bacteria | 2413 |
| 280 | Ga0268266_10176996 | 3300028379 | Bacteria | 1940 |
| 281 | Ga0268266_10416481 | 3300028379 | Bacteria | 1272 |
| 282 | Ga0268265_11258868 | 3300028380 | Bacteria | 739 |
| 283 | Ga0268264_10008083 | 3300028381 | Bacteria | 8749 |
| 284 | Ga0268264_10486881 | 3300028381 | Bacteria | 1201 |
| 285 | Ga0307513_10052060 | 3300031456 | Bacteria | 4411 |
| 286 | Ga0307408_101100507 | 3300031548 | Bacteria | 737 |
| 287 | Ga0307405_10203021 | 3300031731 | Bacteria | 1441 |
| 288 | Ga0307405_10257565 | 3300031731 | Bacteria | 1301 |
| 289 | Ga0307405_10332957 | 3300031731 | Bacteria | 1164 |
| 290 | Ga0307405_10562259 | 3300031731 | Bacteria | 925 |
| 291 | Ga0307413_10277088 | 3300031824 | Bacteria | 1259 |
| 292 | Ga0307413_10392391 | 3300031824 | Bacteria | 1085 |
| 293 | Ga0307413_10802573 | 3300031824 | Bacteria | 791 |
| 294 | Ga0307410_10016988 | 3300031852 | Bacteria | 4356 |
| 295 | Ga0307410_10118415 | 3300031852 | Bacteria | 1927 |
| 296 | Ga0307410_10162267 | 3300031852 | Bacteria | 1676 |
| 297 | Ga0307410_10225713 | 3300031852 | Bacteria | 1443 |
| 298 | Ga0307410_10244451 | 3300031852 | Bacteria | 1392 |
| 299 | Ga0307410_10662954 | 3300031852 | Bacteria | 876 |
| 300 | Ga0307410_10702803 | 3300031852 | Bacteria | 852 |
| 301 | Ga0307410_11831940 | 3300031852 | Bacteria | 539 |
| 302 | Ga0307406_10014342 | 3300031901 | Bacteria | 4558 |
| 303 | Ga0307406_10152468 | 3300031901 | Bacteria | 1650 |
| 304 | Ga0307406_12089429 | 3300031901 | Bacteria | 507 |
| 305 | Ga0307406_12123630 | 3300031901 | Bacteria | 503 |
| 306 | Ga0307407_10034549 | 3300031903 | Bacteria | 2769 |
| 307 | Ga0307407_10211387 | 3300031903 | Bacteria | 1306 |
| 308 | Ga0307407_10456062 | 3300031903 | Bacteria | 929 |
| 309 | Ga0307412_10184827 | 3300031911 | Bacteria | 1571 |
| 310 | Ga0307412_10541266 | 3300031911 | Bacteria | 976 |
| 311 | Ga0307409_100253164 | 3300031995 | Bacteria | 1611 |
| 312 | Ga0307409_100259222 | 3300031995 | Bacteria | 1594 |
| 313 | Ga0307409_100276946 | 3300031995 | Bacteria | 1548 |
| 314 | Ga0307409_100345194 | 3300031995 | Bacteria | 1402 |
| 315 | Ga0307409_100445573 | 3300031995 | Bacteria | 1248 |
| 316 | Ga0307409_100906225 | 3300031995 | Bacteria | 896 |
| 317 | Ga0307409_101514750 | 3300031995 | Bacteria | 698 |
| 318 | Ga0307409_101727881 | 3300031995 | Bacteria | 654 |
| 319 | Ga0307416_100006810 | 3300032002 | Bacteria | 7189 |
| 320 | Ga0307416_100052929 | 3300032002 | Bacteria | 3253 |
| 321 | Ga0307416_100707586 | 3300032002 | Bacteria | 1097 |
| 322 | Ga0307416_101319095 | 3300032002 | Bacteria | 827 |
| 323 | Ga0307416_101547146 | 3300032002 | Bacteria | 769 |
| 324 | Ga0307416_102204462 | 3300032002 | Bacteria | 652 |
| 325 | Ga0307416_103013596 | 3300032002 | Bacteria | 563 |
| 326 | Ga0307414_10230363 | 3300032004 | Bacteria | 1527 |
| 327 | Ga0307414_10744700 | 3300032004 | Bacteria | 890 |
| 328 | Ga0307414_10936421 | 3300032004 | Bacteria | 795 |
| 329 | Ga0307414_10980978 | 3300032004 | Bacteria | 777 |
| 330 | Ga0307414_11098905 | 3300032004 | Bacteria | 734 |
| 331 | Ga0307414_12063431 | 3300032004 | Bacteria | 532 |
| 332 | Ga0307411_10082528 | 3300032005 | Bacteria | 2217 |
| 333 | Ga0307411_10130150 | 3300032005 | Bacteria | 1838 |
| 334 | Ga0307411_10632964 | 3300032005 | Bacteria | 924 |
| 335 | Ga0307411_10907144 | 3300032005 | Bacteria | 783 |
| 336 | Ga0307415_100001340 | 3300032126 | Bacteria | 11693 |
| 337 | Ga0307415_100060707 | 3300032126 | Bacteria | 2614 |
| 338 | Ga0307415_100359781 | 3300032126 | Bacteria | 1228 |
| 339 | Ga0307415_100591492 | 3300032126 | Bacteria | 986 |
| 340 | Ga0307415_100721349 | 3300032126 | Bacteria | 902 |
| 341 | Ga0307415_100783752 | 3300032126 | Bacteria | 868 |
| 342 | Ga0307415_100913198 | 3300032126 | Bacteria | 810 |
| 343 | Ga0373926_0000194 | 3300035083 | Bacteria | 13938 |
| 344 | Ga0373934_0155486 | 3300035086 | Bacteria | 937 |
| 345 | Ga0373923_0082203 | 3300035111 | Bacteria | 1398 |
| 346 | Ga0373936_0002169 | 3300035113 | Bacteria | 7316 |
| 347 | Ga0373945_0000105 | 3300035116 | Bacteria | 19853 |
| 348 | Ga0373943_0002905 | 3300035170 | Bacteria | 7771 |
| 349 | Ga0373946_0000340 | 3300035171 | Bacteria | 15068 |
| 350 | Ga0373955_0014029 | 3300035172 | Bacteria | 3890 |
| 351 | Ga0373924_0110158 | 3300035410 | Bacteria | 1189 |
| 352 | Ga0373931_0379485 | 3300035691 | Bacteria | 891 |
| 353 | Ga0373935_0000837 | 3300035692 | Bacteria | 16568 |
| 354 | Ga0373927_0001172 | 3300035695 | Bacteria | 19853 |
| 355 | Ga0373933_0083061 | 3300035724 | Bacteria | 1967 |
| 356 | Ga0373947_0001050 | 3300035725 | Bacteria | 16852 |
| 357 | Ga0373937_0244094 | 3300036401 | Bacteria | 1692 |
| 358 | Ga0373937_1107752 | 3300036401 | Bacteria | 740 |
| 359 | Ga0373937_1686181 | 3300036401 | Bacteria | 581 |
| 360 | Ga0373925_0001881 | 3300037068 | Bacteria | 17436 |
| 361 | Ga0395899_0190128 | 3300037312 | Bacteria | 1437 |
| 362 | Ga0395900_0010397 | 3300037418 | Bacteria | 9515 |
| 363 | Ga0395900_0263376 | 3300037418 | Bacteria | 1721 |
| 364 | Ga0395900_0352956 | 3300037418 | Bacteria | 1444 |
| 365 | Ga0395898_0218095 | 3300037466 | Bacteria | 1820 |
| 366 | Ga0395898_0365696 | 3300037466 | Bacteria | 1375 |
| 367 | Ga0395905_0443169 | 3300037471 | Bacteria | 1196 |
| 368 | Ga0395905_1517683 | 3300037471 | Bacteria | 574 |
| 369 | Ga0436364_1349894 | 3300037853 | Bacteria | 5412 |
| 370 | Ga0436364_1565185 | 3300037853 | Bacteria | 6222 |
| 371 | Ga0395901_0020349 | 3300038443 | Bacteria | 6793 |
| 372 | Ga0436365_1315947 | 3300039437 | Bacteria | 1730 |
| 373 | Ga0436365_1348550 | 3300039437 | Bacteria | 1825 |
| 374 | Ga0436365_1766708 | 3300039437 | Bacteria | 2186 |
| 375 | Ga0436363_0364438 | 3300039450 | Bacteria | 683 |
| 376 | Ga0436363_0611301 | 3300039450 | Bacteria | 1024 |
| 377 | Ga0436363_1696899 | 3300039450 | Bacteria | 530 |
| 378 | Ga0451791_1509369 | 3300041451 | Bacteria | 1235 |
| 379 | Ga0451791_1519585 | 3300041451 | Bacteria | 520 |
| 380 | Ga0451795_0932728 | 3300041456 | Bacteria | 1113 |
| 381 | Ga0451802_2100189 | 3300041460 | Bacteria | 644 |
| 382 | Ga0451804_0899706 | 3300041463 | Bacteria | 746 |
| 383 | Ga0451845_0191103 | 3300041501 | Bacteria | 654 |
| 384 | Ga0439440_0072210 | 3300042993 | Bacteria | 900 |
| 385 | Ga0466969_0332187 | 3300044656 | Bacteria | 688 |
| 386 | Ga0466972_0009259 | 3300044658 | Bacteria | 4948 |
| 387 | Ga0466972_0221839 | 3300044658 | Bacteria | 884 |
| 388 | Ga0466972_0495730 | 3300044658 | Bacteria | 575 |
| 389 | Ga0466965_0013665 | 3300044683 | Bacteria | 3833 |
| 390 | Ga0466965_0109885 | 3300044683 | Bacteria | 1416 |
| 391 | Ga0466965_0115925 | 3300044683 | Bacteria | 1380 |
| 392 | Ga0466965_0132017 | 3300044683 | Bacteria | 1296 |
| 393 | Ga0466965_0146068 | 3300044683 | Bacteria | 1234 |
| 394 | Ga0466965_0212713 | 3300044683 | Bacteria | 1028 |
| 395 | Ga0466965_0266200 | 3300044683 | Bacteria | 922 |
| 396 | Ga0466965_0309531 | 3300044683 | Bacteria | 858 |
| 397 | Ga0466965_0748531 | 3300044683 | Bacteria | 563 |
| 398 | Ga0466966_0017769 | 3300044684 | Bacteria | 4696 |
| 399 | Ga0466966_0119260 | 3300044684 | Bacteria | 1622 |
| 400 | Ga0466966_0265220 | 3300044684 | Bacteria | 1034 |
| 401 | Ga0466966_0277251 | 3300044684 | Bacteria | 1009 |
| 402 | Ga0466966_0278157 | 3300044684 | Bacteria | 1007 |
| 403 | Ga0466966_0306645 | 3300044684 | Bacteria | 954 |
| 404 | Ga0466966_0318221 | 3300044684 | Bacteria | 935 |
| 405 | Ga0466961_0014273 | 3300044693 | Bacteria | 5099 |
| 406 | Ga0466961_0357448 | 3300044693 | Bacteria | 888 |
| 407 | Ga0466961_0403772 | 3300044693 | Bacteria | 829 |
| 408 | Ga0466961_0428840 | 3300044693 | Bacteria | 801 |
| 409 | Ga0466961_0642096 | 3300044693 | Bacteria | 637 |
| 410 | Ga0466961_0677403 | 3300044693 | Bacteria | 618 |
| 411 | Ga0466963_0070176 | 3300044694 | Bacteria | 2356 |
| 412 | Ga0466963_0278197 | 3300044694 | Bacteria | 1176 |
| 413 | Ga0466963_0314297 | 3300044694 | Bacteria | 1102 |
| 414 | Ga0466963_0346501 | 3300044694 | Bacteria | 1046 |
| 415 | Ga0466963_0420631 | 3300044694 | Bacteria | 942 |
| 416 | Ga0466963_0556022 | 3300044694 | Bacteria | 810 |
| 417 | Ga0466963_0576829 | 3300044694 | Bacteria | 794 |
| 418 | Ga0466963_0758678 | 3300044694 | Bacteria | 684 |
| 419 | Ga0466963_0781445 | 3300044694 | Bacteria | 673 |
| 420 | Ga0466963_1034945 | 3300044694 | Bacteria | 578 |
| 421 | Ga0466964_0185912 | 3300044706 | Bacteria | 988 |
| 422 | Ga0466964_0857081 | 3300044706 | Bacteria | 517 |
| 423 | Ga0466964_0883207 | 3300044706 | Bacteria | 510 |
| 424 | Ga0466971_0046224 | 3300044719 | Bacteria | 1957 |
| 425 | Ga0466971_0111762 | 3300044719 | Bacteria | 1261 |
| 426 | Ga0466971_0177692 | 3300044719 | Bacteria | 1000 |
| 427 | Ga0466971_0231490 | 3300044719 | Bacteria | 877 |
| 428 | Ga0466971_0418321 | 3300044719 | Bacteria | 655 |
| 429 | Ga0466968_0188409 | 3300044735 | Bacteria | 962 |
| 430 | Ga0466968_0664211 | 3300044735 | Bacteria | 530 |
| 431 | Ga0466970_0017578 | 3300044765 | Bacteria | 3696 |
| 432 | Ga0466970_0018477 | 3300044765 | Bacteria | 3609 |
| 433 | Ga0466970_0066688 | 3300044765 | Bacteria | 1932 |
| 434 | Ga0466970_0110371 | 3300044765 | Bacteria | 1502 |
| 435 | Ga0466970_0135278 | 3300044765 | Bacteria | 1356 |
| 436 | Ga0466970_0171037 | 3300044765 | Bacteria | 1204 |
| 437 | Ga0466970_0281640 | 3300044765 | Bacteria | 935 |
| 438 | Ga0466970_0346297 | 3300044765 | Bacteria | 843 |
| 439 | Ga0466970_0561845 | 3300044765 | Bacteria | 660 |
| 440 | Ga0466970_0680592 | 3300044765 | Bacteria | 599 |
| 441 | Ga0466957_0062976 | 3300044842 | Bacteria | 2279 |
| 442 | Ga0466957_0129200 | 3300044842 | Bacteria | 1617 |
| 443 | Ga0466957_0173790 | 3300044842 | Bacteria | 1404 |
| 444 | Ga0466957_0174924 | 3300044842 | Bacteria | 1400 |
| 445 | Ga0466957_0176787 | 3300044842 | Bacteria | 1392 |
| 446 | Ga0466957_0292105 | 3300044842 | Bacteria | 1093 |
| 447 | Ga0466957_0548290 | 3300044842 | Bacteria | 806 |
| 448 | Ga0466960_0001071 | 3300044901 | Bacteria | 9809 |
| 449 | Ga0466960_0015607 | 3300044901 | Bacteria | 3278 |
| 450 | Ga0466960_0032398 | 3300044901 | Bacteria | 2419 |
| 451 | Ga0466960_0118444 | 3300044901 | Bacteria | 1384 |
| 452 | Ga0466960_0258515 | 3300044901 | Bacteria | 969 |
| 453 | Ga0466960_0326648 | 3300044901 | Bacteria | 870 |
| 454 | Ga0466960_0352644 | 3300044901 | Bacteria | 839 |
| 455 | Ga0466960_0432166 | 3300044901 | Bacteria | 763 |
| 456 | Ga0466960_0440660 | 3300044901 | Bacteria | 756 |
| 457 | Ga0466960_0630885 | 3300044901 | Bacteria | 638 |
| 458 | Ga0466960_0658606 | 3300044901 | Bacteria | 625 |
| 459 | Ga0466960_0828128 | 3300044901 | Bacteria | 561 |
| 460 | Ga0466959_0151691 | 3300045049 | Bacteria | 1633 |
| 461 | Ga0466959_0286376 | 3300045049 | Bacteria | 1130 |
| 462 | Ga0466959_0295720 | 3300045049 | Bacteria | 1109 |
| 463 | Ga0466959_0397504 | 3300045049 | Bacteria | 937 |
| 464 | Ga0466959_0398750 | 3300045049 | Bacteria | 935 |
| 465 | Ga0466959_0410028 | 3300045049 | Bacteria | 920 |
| 466 | Ga0466959_0415623 | 3300045049 | Bacteria | 913 |
| 467 | Ga0466959_0505406 | 3300045049 | Bacteria | 817 |
| 468 | Ga0466958_0109356 | 3300045836 | Bacteria | 1725 |
| 469 | Ga0466958_0193846 | 3300045836 | Bacteria | 1292 |
| 470 | Ga0466958_0306344 | 3300045836 | Bacteria | 1020 |
| 471 | Ga0466958_0315236 | 3300045836 | Bacteria | 1005 |
| 472 | Ga0466958_0403811 | 3300045836 | Bacteria | 882 |
| 473 | Ga0466958_0516290 | 3300045836 | Bacteria | 775 |
| 474 | Ga0466958_0545877 | 3300045836 | Bacteria | 753 |
| 475 | Ga0466958_0592938 | 3300045836 | Bacteria | 721 |
| 476 | Ga0466958_0701008 | 3300045836 | Bacteria | 659 |
| 477 | Ga0466958_0737581 | 3300045836 | Bacteria | 642 |
| 478 | Ga0466967_0043011 | 3300045976 | Bacteria | 3909 |
| 479 | Ga0466967_0069258 | 3300045976 | Bacteria | 3153 |
| 480 | Ga0466967_0107869 | 3300045976 | Bacteria | 2554 |
| 481 | Ga0466967_0113444 | 3300045976 | Bacteria | 2493 |
| 482 | Ga0466967_0129378 | 3300045976 | Bacteria | 2342 |
| 483 | Ga0466967_0191642 | 3300045976 | Bacteria | 1932 |
| 484 | Ga0466967_0207899 | 3300045976 | Bacteria | 1856 |
| 485 | Ga0466967_0220429 | 3300045976 | Bacteria | 1802 |
| 486 | Ga0466967_0247435 | 3300045976 | Bacteria | 1702 |
| 487 | Ga0466967_0285056 | 3300045976 | Bacteria | 1586 |
| 488 | Ga0466967_0398054 | 3300045976 | Bacteria | 1339 |
| 489 | Ga0466967_0626237 | 3300045976 | Bacteria | 1063 |
| 490 | Ga0466967_0901519 | 3300045976 | Bacteria | 879 |
| 491 | Ga0466967_0939305 | 3300045976 | Bacteria | 860 |
| 492 | Ga0466967_0983356 | 3300045976 | Bacteria | 840 |
| 493 | Ga0466967_1953551 | 3300045976 | Bacteria | 583 |
| 494 | Ga0466967_2078526 | 3300045976 | Bacteria | 564 |
| 495 | Ga0466967_2112610 | 3300045976 | Bacteria | 559 |
| 496 | Ga0466967_2271923 | 3300045976 | Bacteria | 538 |
| 497 | Ga0466967_2283818 | 3300045976 | Bacteria | 537 |
| 498 | Ga0495653_0005402 | 3300046463 | Bacteria | 10402 |
| 499 | Ga0495582_0029785 | 3300046473 | Bacteria | 2997 |
| 500 | Ga0495662_0007276 | 3300046476 | Bacteria | 5478 |
| 501 | Ga0495664_0000357 | 3300046477 | Bacteria | 22053 |
| 502 | Ga0495608_0030423 | 3300046511 | Bacteria | 3655 |
| 503 | Ga0495616_0150365 | 3300046513 | Bacteria | 1054 |
| 504 | Ga0495618_0394399 | 3300046514 | Bacteria | 847 |
| 505 | Ga0495630_0003829 | 3300046517 | Bacteria | 10502 |
| 506 | Ga0495631_0177532 | 3300046518 | Bacteria | 913 |
| 507 | Ga0495652_0089898 | 3300046529 | Bacteria | 2513 |
| 508 | Ga0495640_0065901 | 3300046533 | Bacteria | 2444 |
| 509 | Ga0495667_0013507 | 3300046559 | Bacteria | 5525 |
| 510 | Ga0495656_0266203 | 3300046615 | Bacteria | 870 |
| 511 | Ga0495668_0556789 | 3300046616 | Bacteria | 633 |
| 512 | Ga0495668_0865714 | 3300046616 | Bacteria | 501 |
| 513 | Ga0495635_0003522 | 3300046663 | Bacteria | 10831 |
| 514 | Ga0495661_0628456 | 3300046665 | Bacteria | 503 |
| 515 | Ga0495657_0192638 | 3300046675 | Bacteria | 1245 |
| 516 | Ga0495599_0041964 | 3300046678 | Bacteria | 2871 |
| 517 | Ga0495647_0110872 | 3300046681 | Bacteria | 1145 |
| 518 | Ga0495624_0016684 | 3300046690 | Bacteria | 4943 |
| 519 | Ga0495600_0180717 | 3300046809 | Bacteria | 1359 |
| 520 | Ga0495674_0001081 | 3300047319 | Bacteria | 26211 |
| 521 | Ga0495672_0073765 | 3300047320 | Bacteria | 1924 |
| 522 | Ga0495676_0002364 | 3300047321 | Bacteria | 16733 |
| 523 | Ga0495680_0007093 | 3300047322 | Bacteria | 10320 |
| 524 | Ga0495677_0371654 | 3300047445 | Bacteria | 565 |
| 525 | Ga0495684_0002609 | 3300047471 | Bacteria | 14315 |
| 526 | Ga0495684_0699939 | 3300047471 | Bacteria | 672 |
| 527 | Ga0495602_0559756 | 3300048088 | Bacteria | 791 |
| 528 | Ga0496100_0302834 | 3300048903 | Bacteria | 1197 |
| 529 | Ga0496100_1373412 | 3300048903 | Bacteria | 558 |
| 530 | Ga0496101_0615169 | 3300048904 | Bacteria | 859 |
| 531 | Ga0496101_1031256 | 3300048904 | Bacteria | 647 |
| 532 | Ga0496102_0638202 | 3300048905 | Bacteria | 988 |
| 533 | Ga0496102_0761644 | 3300048905 | Bacteria | 891 |
| 534 | Ga0496104_0125821 | 3300048907 | Bacteria | 2461 |
| 535 | Ga0496104_0431487 | 3300048907 | Bacteria | 1230 |
| 536 | Ga0496104_1293549 | 3300048907 | Bacteria | 632 |
| 537 | Ga0496105_0370639 | 3300048908 | Bacteria | 1141 |
| 538 | Ga0496108_0060415 | 3300048911 | Bacteria | 3189 |
| 539 | Ga0496108_0287513 | 3300048911 | Bacteria | 1431 |
| 540 | Ga0496108_0572006 | 3300048911 | Bacteria | 985 |
| 541 | Ga0496109_0017069 | 3300048912 | Bacteria | 6352 |
| 542 | Ga0496109_1551917 | 3300048912 | Bacteria | 597 |
| 543 | Ga0496110_0106609 | 3300048913 | Bacteria | 2515 |
| 544 | Ga0496110_0981303 | 3300048913 | Bacteria | 752 |
| 545 | Ga0496110_1158524 | 3300048913 | Bacteria | 682 |
| 546 | Ga0496110_1219105 | 3300048913 | Bacteria | 661 |
| 547 | Ga0496111_0329832 | 3300048914 | Bacteria | 1130 |
| 548 | Ga0496111_0375678 | 3300048914 | Bacteria | 1051 |
| 549 | Ga0496112_0037625 | 3300048915 | Bacteria | 4723 |
| 550 | Ga0496112_0223913 | 3300048915 | Bacteria | 1837 |
| 551 | Ga0496112_0677272 | 3300048915 | Bacteria | 960 |
| 552 | Ga0496113_0347273 | 3300048916 | Bacteria | 1190 |
| 553 | Ga0496114_0127625 | 3300048917 | Bacteria | 2194 |
| 554 | Ga0496115_0420315 | 3300048918 | Bacteria | 1083 |
| 555 | Ga0496115_0538722 | 3300048918 | Bacteria | 934 |
| 556 | Ga0496115_1193444 | 3300048918 | Bacteria | 572 |
| 557 | Ga0501291_127489 | 3300049514 | Bacteria | 558 |
| 558 | Ga0501317_076601 | 3300049533 | Bacteria | 572 |
| 559 | Ga0501039_0437451 | 3300049575 | Bacteria | 1027 |
| 560 | Ga0501039_0491000 | 3300049575 | Bacteria | 964 |
| 561 | Ga0501041_0301309 | 3300049577 | Bacteria | 1010 |
| 562 | Ga0501042_0183154 | 3300049578 | Bacteria | 1511 |
| 563 | Ga0501043_0473099 | 3300049579 | Bacteria | 939 |
| 564 | Ga0501047_0000046 | 3300049581 | Bacteria | 170205 |
| 565 | Ga0501048_0164410 | 3300049582 | Bacteria | 1571 |
| 566 | Ga0501071_0143532 | 3300049587 | Bacteria | 1779 |
| 567 | Ga0501071_0243345 | 3300049587 | Bacteria | 1357 |
| 568 | Ga0501072_0115397 | 3300049588 | Bacteria | 2138 |
| 569 | Ga0501206_038869 | 3300049653 | Bacteria | 729 |
| 570 | Ga0501035_0830907 | 3300049822 | Bacteria | 736 |
| 571 | Ga0501044_0265717 | 3300049823 | Bacteria | 1653 |
| 572 | nmdc:mga03683_24353_c1 | 3300050489 | Bacteria | 2367 |
| 573 | nmdc:mga00v17_54503_c1 | 3300050491 | Bacteria | 2439 |
| 574 | nmdc:mga00v17_87173_c1 | 3300050491 | Bacteria | 1957 |
| 575 | nmdc:mga0yw44_719384_c1 | 3300050492 | Bacteria | 678 |
| 576 | nmdc:mga06z11_40931_c1 | 3300050494 | Bacteria | 2316 |
| 577 | nmdc:mga04h51_40752_c1 | 3300050495 | Bacteria | 1515 |
| 578 | nmdc:mga07m45_156915_c1 | 3300050496 | Bacteria | 1320 |
| 579 | nmdc:mga05p37_665334_c1 | 3300050507 | Bacteria | 1163 |
| 580 | nmdc:mga08y16_160167_c1 | 3300050511 | Bacteria | 2338 |
| 581 | nmdc:mga08y16_1859246_c1 | 3300050511 | Bacteria | 554 |
| 582 | nmdc:mga08y16_238428_c1 | 3300050511 | Bacteria | 1880 |
| 583 | Ga0495655_0129520 | 3300053083 | Bacteria | 776 |
| 584 | Ga0495595_0666693 | 3300053084 | Bacteria | 533 |
| 585 | Ga0500573_0002950 | 3300053140 | Bacteria | 8678 |
| 586 | Ga0500587_017719 | 3300053739 | Bacteria | 914 |
| 587 | Ga0501084_0672181 | 3300054114 | Bacteria | 874 |
| 588 | Ga0466962_0147868 | 3300061719 | Bacteria | 1139 |
| 589 | Ga0466962_0395057 | 3300061719 | Bacteria | 692 |
| 590 | Ga0466962_0621396 | 3300061719 | Bacteria | 551 |
| 591 | Ga0530510_0751157 | 3300061734 | Bacteria | 744 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_11072499 | Ga0070658_110724992 | 104 |
| 2 | 3300044694 | Ga0466963_0278197 | Ga0466963_0278197_624_968 | 104 |
| 3 | 3300044719 | Ga0466971_0418321 | Ga0466971_0418321_171_515 | 104 |
| 4 | 3300045836 | Ga0466958_0315236 | Ga0466958_0315236_592_942 | 104 |
| 5 | 3300045836 | Ga0466958_0737581 | Ga0466958_0737581_57_401 | 104 |
| 6 | 3300045976 | Ga0466967_0113444 | Ga0466967_0113444_1144_1488 | 104 |
| 7 | 3300025932 | Ga0207690_10595328 | Ga0207690_105953282 | 105 |
| 8 | 3300044683 | Ga0466965_0132017 | Ga0466965_0132017_45_398 | 106 |
| 9 | 3300044694 | Ga0466963_0758678 | Ga0466963_0758678_279_632 | 106 |
| 10 | 3300044719 | Ga0466971_0111762 | Ga0466971_0111762_336_689 | 106 |
| 11 | 3300044842 | Ga0466957_0062976 | Ga0466957_0062976_1162_1515 | 106 |
| 12 | 3300045836 | Ga0466958_0193846 | Ga0466958_0193846_813_1166 | 106 |
| 13 | 3300005366 | Ga0070659_100009212 | Ga0070659_1000092126 | 107 |
| 14 | 3300005455 | Ga0070663_100072005 | Ga0070663_1000720054 | 107 |
| 15 | 3300005455 | Ga0070663_100566307 | Ga0070663_1005663072 | 107 |
| 16 | 3300005564 | Ga0070664_100006472 | Ga0070664_1000064725 | 107 |
| 17 | 3300044683 | Ga0466965_0115925 | Ga0466965_0115925_299_655 | 107 |
| 18 | 3300044684 | Ga0466966_0277251 | Ga0466966_0277251_113_463 | 107 |
| 19 | 3300044706 | Ga0466964_0883207 | Ga0466964_0883207_138_494 | 107 |
| 20 | 3300045836 | Ga0466958_0545877 | Ga0466958_0545877_191_541 | 107 |
| 21 | 3300025920 | Ga0207649_10247874 | Ga0207649_102478742 | 108 |
| 22 | 3300037471 | Ga0395905_1517683 | Ga0395905_1517683_67_426 | 108 |
| 23 | 3300025932 | Ga0207690_11077102 | Ga0207690_110771021 | 109 |
| 24 | 3300048904 | Ga0496101_0615169 | Ga0496101_0615169_235_582 | 109 |
| 25 | 3300048913 | Ga0496110_1158524 | Ga0496110_1158524_17_364 | 109 |
| 26 | 3300009098 | Ga0105245_10052805 | Ga0105245_100528054 | 110 |
| 27 | 3300009176 | Ga0105242_10003049 | Ga0105242_100030493 | 110 |
| 28 | 3300009545 | Ga0105237_10056196 | Ga0105237_100561963 | 110 |
| 29 | 3300010375 | Ga0105239_10062376 | Ga0105239_100623764 | 110 |
| 30 | 3300013296 | Ga0157374_10121598 | Ga0157374_101215982 | 110 |
| 31 | 3300014745 | Ga0157377_11288940 | Ga0157377_112889402 | 110 |
| 32 | 3300026118 | Ga0207675_100165113 | Ga0207675_1001651132 | 110 |
| 33 | 3300050494 | nmdc:mga06z11_40931_c1 | nmdc:mga06z11_40931_c1_1842_2195 | 110 |
| 34 | 3300050495 | nmdc:mga04h51_40752_c1 | nmdc:mga04h51_40752_c1_220_573 | 110 |
| 35 | 3300045976 | Ga0466967_2078526 | Ga0466967_2078526_90_482 | 111 |
| 36 | 3300049581 | Ga0501047_0000046 | Ga0501047_0000046_52436_52819 | 111 |
| 37 | 3300049823 | Ga0501044_0265717 | Ga0501044_0265717_869_1252 | 111 |
| 38 | 3300044658 | Ga0466972_0009259 | Ga0466972_0009259_4488_4901 | 113 |
| 39 | 3300044683 | Ga0466965_0013665 | Ga0466965_0013665_1691_2104 | 113 |
| 40 | 3300044735 | Ga0466968_0188409 | Ga0466968_0188409_405_818 | 113 |
| 41 | 3300044765 | Ga0466970_0018477 | Ga0466970_0018477_1086_1499 | 113 |
| 42 | 3300044842 | Ga0466957_0176787 | Ga0466957_0176787_385_798 | 113 |
| 43 | 3300044901 | Ga0466960_0001071 | Ga0466960_0001071_1063_1476 | 113 |
| 44 | 3300045836 | Ga0466958_0109356 | Ga0466958_0109356_278_691 | 113 |
| 45 | 3300044683 | Ga0466965_0748531 | Ga0466965_0748531_15_365 | 114 |
| 46 | 3300044684 | Ga0466966_0278157 | Ga0466966_0278157_171_524 | 114 |
| 47 | 3300045976 | Ga0466967_0069258 | Ga0466967_0069258_2470_2823 | 114 |
| 48 | iso_pu_bacteria | 2795385470 | 2795783145 | 114 |
| 49 | iso_pu_bacteria | 8003314358 | 8003323405 | 114 |
| 50 | 3300005328 | Ga0070676_10036296 | Ga0070676_100362964 | 115 |
| 51 | 3300005329 | Ga0070683_100220769 | Ga0070683_1002207692 | 115 |
| 52 | 3300005330 | Ga0070690_100892606 | Ga0070690_1008926061 | 115 |
| 53 | 3300005330 | Ga0070690_101576087 | Ga0070690_1015760871 | 115 |
| 54 | 3300005331 | Ga0070670_100194595 | Ga0070670_1001945952 | 115 |
| 55 | 3300005331 | Ga0070670_100248279 | Ga0070670_1002482791 | 115 |
| 56 | 3300005331 | Ga0070670_101122017 | Ga0070670_1011220171 | 115 |
| 57 | 3300005334 | Ga0068869_100028918 | Ga0068869_1000289182 | 115 |
| 58 | 3300005334 | Ga0068869_100549990 | Ga0068869_1005499902 | 115 |
| 59 | 3300005334 | Ga0068869_101500091 | Ga0068869_1015000912 | 115 |
| 60 | 3300005337 | Ga0070682_100105339 | Ga0070682_1001053393 | 115 |
| 61 | 3300005337 | Ga0070682_100190225 | Ga0070682_1001902252 | 115 |
| 62 | 3300005337 | Ga0070682_100313011 | Ga0070682_1003130112 | 115 |
| 63 | 3300005338 | Ga0068868_100106928 | Ga0068868_1001069283 | 115 |
| 64 | 3300005338 | Ga0068868_100357344 | Ga0068868_1003573442 | 115 |
| 65 | 3300005338 | Ga0068868_100753042 | Ga0068868_1007530422 | 115 |
| 66 | 3300005340 | Ga0070689_100701741 | Ga0070689_1007017412 | 115 |
| 67 | 3300005344 | Ga0070661_100399382 | Ga0070661_1003993822 | 115 |
| 68 | 3300005345 | Ga0070692_10062655 | Ga0070692_100626553 | 115 |
| 69 | 3300005347 | Ga0070668_100020774 | Ga0070668_1000207746 | 115 |
| 70 | 3300005356 | Ga0070674_100016051 | Ga0070674_1000160512 | 115 |
| 71 | 3300005365 | Ga0070688_100259688 | Ga0070688_1002596882 | 115 |
| 72 | 3300005365 | Ga0070688_100545731 | Ga0070688_1005457312 | 115 |
| 73 | 3300005366 | Ga0070659_100894678 | Ga0070659_1008946782 | 115 |
| 74 | 3300005367 | Ga0070667_101147725 | Ga0070667_1011477251 | 115 |
| 75 | 3300005367 | Ga0070667_101372804 | Ga0070667_1013728042 | 115 |
| 76 | 3300005435 | Ga0070714_100511734 | Ga0070714_1005117342 | 115 |
| 77 | 3300005435 | Ga0070714_101161575 | Ga0070714_1011615752 | 115 |
| 78 | 3300005436 | Ga0070713_100213352 | Ga0070713_1002133522 | 115 |
| 79 | 3300005436 | Ga0070713_100600182 | Ga0070713_1006001822 | 115 |
| 80 | 3300005436 | Ga0070713_101937499 | Ga0070713_1019374992 | 115 |
| 81 | 3300005438 | Ga0070701_10631820 | Ga0070701_106318202 | 115 |
| 82 | 3300005441 | Ga0070700_100114084 | Ga0070700_1001140842 | 115 |
| 83 | 3300005441 | Ga0070700_101050019 | Ga0070700_1010500191 | 115 |
| 84 | 3300005441 | Ga0070700_101292022 | Ga0070700_1012920221 | 115 |
| 85 | 3300005455 | Ga0070663_100000691 | Ga0070663_1000006919 | 115 |
| 86 | 3300005455 | Ga0070663_100008282 | Ga0070663_1000082823 | 115 |
| 87 | 3300005455 | Ga0070663_100853972 | Ga0070663_1008539722 | 115 |
| 88 | 3300005456 | Ga0070678_100139753 | Ga0070678_1001397532 | 115 |
| 89 | 3300005456 | Ga0070678_100772213 | Ga0070678_1007722132 | 115 |
| 90 | 3300005456 | Ga0070678_101016011 | Ga0070678_1010160112 | 115 |
| 91 | 3300005457 | Ga0070662_100429064 | Ga0070662_1004290642 | 115 |
| 92 | 3300005466 | Ga0070685_10367558 | Ga0070685_103675582 | 115 |
| 93 | 3300005466 | Ga0070685_10431040 | Ga0070685_104310402 | 115 |
| 94 | 3300005535 | Ga0070684_100078631 | Ga0070684_1000786312 | 115 |
| 95 | 3300005535 | Ga0070684_101584601 | Ga0070684_1015846012 | 115 |
| 96 | 3300005548 | Ga0070665_100108059 | Ga0070665_1001080593 | 115 |
| 97 | 3300005548 | Ga0070665_100175177 | Ga0070665_1001751772 | 115 |
| 98 | 3300005548 | Ga0070665_101098648 | Ga0070665_1010986482 | 115 |
| 99 | 3300005564 | Ga0070664_100474221 | Ga0070664_1004742212 | 115 |
| 100 | 3300005564 | Ga0070664_100474704 | Ga0070664_1004747042 | 115 |
| 101 | 3300005564 | Ga0070664_100775832 | Ga0070664_1007758322 | 115 |
| 102 | 3300005577 | Ga0068857_100080862 | Ga0068857_1000808622 | 115 |
| 103 | 3300005577 | Ga0068857_100172991 | Ga0068857_1001729912 | 115 |
| 104 | 3300005577 | Ga0068857_100237112 | Ga0068857_1002371122 | 115 |
| 105 | 3300005577 | Ga0068857_101970127 | Ga0068857_1019701271 | 115 |
| 106 | 3300005614 | Ga0068856_100415097 | Ga0068856_1004150972 | 115 |
| 107 | 3300005614 | Ga0068856_100453302 | Ga0068856_1004533022 | 115 |
| 108 | 3300005614 | Ga0068856_101438173 | Ga0068856_1014381731 | 115 |
| 109 | 3300005616 | Ga0068852_100037968 | Ga0068852_1000379685 | 115 |
| 110 | 3300005616 | Ga0068852_100198975 | Ga0068852_1001989752 | 115 |
| 111 | 3300005616 | Ga0068852_100344764 | Ga0068852_1003447641 | 115 |
| 112 | 3300005617 | Ga0068859_100414361 | Ga0068859_1004143612 | 115 |
| 113 | 3300005617 | Ga0068859_102069549 | Ga0068859_1020695492 | 115 |
| 114 | 3300005618 | Ga0068864_100147606 | Ga0068864_1001476062 | 115 |
| 115 | 3300005618 | Ga0068864_100197539 | Ga0068864_1001975393 | 115 |
| 116 | 3300005834 | Ga0068851_10113572 | Ga0068851_101135722 | 115 |
| 117 | 3300005840 | Ga0068870_10091369 | Ga0068870_100913692 | 115 |
| 118 | 3300005842 | Ga0068858_100332844 | Ga0068858_1003328442 | 115 |
| 119 | 3300005842 | Ga0068858_101796537 | Ga0068858_1017965371 | 115 |
| 120 | 3300005843 | Ga0068860_100327261 | Ga0068860_1003272612 | 115 |
| 121 | 3300005843 | Ga0068860_102212982 | Ga0068860_1022129822 | 115 |
| 122 | 3300005844 | Ga0068862_100013982 | Ga0068862_1000139822 | 115 |
| 123 | 3300006028 | Ga0070717_10240354 | Ga0070717_102403542 | 115 |
| 124 | 3300006844 | Ga0075428_102583332 | Ga0075428_1025833322 | 115 |
| 125 | 3300006931 | Ga0097620_100414356 | Ga0097620_1004143562 | 115 |
| 126 | 3300006931 | Ga0097620_102069647 | Ga0097620_1020696472 | 115 |
| 127 | 3300009011 | Ga0105251_10190647 | Ga0105251_101906472 | 115 |
| 128 | 3300009098 | Ga0105245_10576387 | Ga0105245_105763872 | 115 |
| 129 | 3300009098 | Ga0105245_10773039 | Ga0105245_107730392 | 115 |
| 130 | 3300009098 | Ga0105245_12903688 | Ga0105245_129036881 | 115 |
| 131 | 3300009101 | Ga0105247_10059559 | Ga0105247_100595592 | 115 |
| 132 | 3300009101 | Ga0105247_10468662 | Ga0105247_104686622 | 115 |
| 133 | 3300009148 | Ga0105243_10734497 | Ga0105243_107344972 | 115 |
| 134 | 3300009148 | Ga0105243_10800371 | Ga0105243_108003712 | 115 |
| 135 | 3300009177 | Ga0105248_10317590 | Ga0105248_103175902 | 115 |
| 136 | 3300009545 | Ga0105237_11597797 | Ga0105237_115977972 | 115 |
| 137 | 3300009545 | Ga0105237_12055133 | Ga0105237_120551332 | 115 |
| 138 | 3300009553 | Ga0105249_10083692 | Ga0105249_100836924 | 115 |
| 139 | 3300009553 | Ga0105249_11256087 | Ga0105249_112560872 | 115 |
| 140 | 3300010375 | Ga0105239_10218122 | Ga0105239_102181222 | 115 |
| 141 | 3300010375 | Ga0105239_10705003 | Ga0105239_107050032 | 115 |
| 142 | 3300010375 | Ga0105239_13122216 | Ga0105239_131222161 | 115 |
| 143 | 3300011119 | Ga0105246_10369010 | Ga0105246_103690102 | 115 |
| 144 | 3300011119 | Ga0105246_10881363 | Ga0105246_108813632 | 115 |
| 145 | 3300013105 | Ga0157369_10520850 | Ga0157369_105208502 | 115 |
| 146 | 3300013296 | Ga0157374_10565014 | Ga0157374_105650142 | 115 |
| 147 | 3300013296 | Ga0157374_10765673 | Ga0157374_107656732 | 115 |
| 148 | 3300013296 | Ga0157374_11496161 | Ga0157374_114961611 | 115 |
| 149 | 3300013297 | Ga0157378_11185904 | Ga0157378_111859042 | 115 |
| 150 | 3300013297 | Ga0157378_11188518 | Ga0157378_111885182 | 115 |
| 151 | 3300013297 | Ga0157378_13029934 | Ga0157378_130299341 | 115 |
| 152 | 3300013306 | Ga0163162_10089061 | Ga0163162_100890612 | 115 |
| 153 | 3300013306 | Ga0163162_10799951 | Ga0163162_107999512 | 115 |
| 154 | 3300013307 | Ga0157372_10164614 | Ga0157372_101646144 | 115 |
| 155 | 3300013307 | Ga0157372_12182887 | Ga0157372_121828872 | 115 |
| 156 | 3300013308 | Ga0157375_10342218 | Ga0157375_103422183 | 115 |
| 157 | 3300013308 | Ga0157375_13200029 | Ga0157375_132000291 | 115 |
| 158 | 3300014325 | Ga0163163_10664361 | Ga0163163_106643612 | 115 |
| 159 | 3300014325 | Ga0163163_12059428 | Ga0163163_120594281 | 115 |
| 160 | 3300014326 | Ga0157380_10198317 | Ga0157380_101983173 | 115 |
| 161 | 3300014968 | Ga0157379_10964074 | Ga0157379_109640742 | 115 |
| 162 | 3300014968 | Ga0157379_12454913 | Ga0157379_124549132 | 115 |
| 163 | 3300020080 | Ga0206350_10093833 | Ga0206350_100938332 | 115 |
| 164 | 3300020081 | Ga0206354_10112504 | Ga0206354_101125042 | 115 |
| 165 | 3300021384 | Ga0213876_10079821 | Ga0213876_100798212 | 115 |
| 166 | 3300025321 | Ga0207656_10155617 | Ga0207656_101556172 | 115 |
| 167 | 3300025899 | Ga0207642_10278184 | Ga0207642_102781842 | 115 |
| 168 | 3300025900 | Ga0207710_10632123 | Ga0207710_106321231 | 115 |
| 169 | 3300025901 | Ga0207688_10064397 | Ga0207688_100643972 | 115 |
| 170 | 3300025901 | Ga0207688_10339570 | Ga0207688_103395701 | 115 |
| 171 | 3300025901 | Ga0207688_10354605 | Ga0207688_103546052 | 115 |
| 172 | 3300025907 | Ga0207645_10046690 | Ga0207645_100466903 | 115 |
| 173 | 3300025907 | Ga0207645_10169397 | Ga0207645_101693972 | 115 |
| 174 | 3300025908 | Ga0207643_10027448 | Ga0207643_100274482 | 115 |
| 175 | 3300025909 | Ga0207705_10642545 | Ga0207705_106425452 | 115 |
| 176 | 3300025909 | Ga0207705_11016734 | Ga0207705_110167342 | 115 |
| 177 | 3300025913 | Ga0207695_10760280 | Ga0207695_107602802 | 115 |
| 178 | 3300025914 | Ga0207671_10255181 | Ga0207671_102551812 | 115 |
| 179 | 3300025919 | Ga0207657_10052911 | Ga0207657_100529113 | 115 |
| 180 | 3300025920 | Ga0207649_10023680 | Ga0207649_100236802 | 115 |
| 181 | 3300025925 | Ga0207650_10364322 | Ga0207650_103643221 | 115 |
| 182 | 3300025925 | Ga0207650_10518328 | Ga0207650_105183282 | 115 |
| 183 | 3300025926 | Ga0207659_10339880 | Ga0207659_103398801 | 115 |
| 184 | 3300025926 | Ga0207659_11795545 | Ga0207659_117955452 | 115 |
| 185 | 3300025927 | Ga0207687_10244508 | Ga0207687_102445082 | 115 |
| 186 | 3300025927 | Ga0207687_10518425 | Ga0207687_105184252 | 115 |
| 187 | 3300025928 | Ga0207700_10106839 | Ga0207700_101068392 | 115 |
| 188 | 3300025932 | Ga0207690_10431260 | Ga0207690_104312602 | 115 |
| 189 | 3300025932 | Ga0207690_10993985 | Ga0207690_109939852 | 115 |
| 190 | 3300025933 | Ga0207706_10232184 | Ga0207706_102321842 | 115 |
| 191 | 3300025933 | Ga0207706_10609402 | Ga0207706_106094021 | 115 |
| 192 | 3300025935 | Ga0207709_10607702 | Ga0207709_106077022 | 115 |
| 193 | 3300025936 | Ga0207670_11306249 | Ga0207670_113062491 | 115 |
| 194 | 3300025936 | Ga0207670_11421573 | Ga0207670_114215731 | 115 |
| 195 | 3300025940 | Ga0207691_10057259 | Ga0207691_100572595 | 115 |
| 196 | 3300025941 | Ga0207711_10528909 | Ga0207711_105289092 | 115 |
| 197 | 3300025942 | Ga0207689_10092906 | Ga0207689_100929064 | 115 |
| 198 | 3300025942 | Ga0207689_10221508 | Ga0207689_102215082 | 115 |
| 199 | 3300025942 | Ga0207689_10434379 | Ga0207689_104343792 | 115 |
| 200 | 3300025944 | Ga0207661_10657465 | Ga0207661_106574652 | 115 |
| 201 | 3300025944 | Ga0207661_11557065 | Ga0207661_115570651 | 115 |
| 202 | 3300025945 | Ga0207679_10683221 | Ga0207679_106832212 | 115 |
| 203 | 3300025945 | Ga0207679_11169718 | Ga0207679_111697181 | 115 |
| 204 | 3300025960 | Ga0207651_10868728 | Ga0207651_108687282 | 115 |
| 205 | 3300025961 | Ga0207712_10212330 | Ga0207712_102123302 | 115 |
| 206 | 3300025961 | Ga0207712_11248439 | Ga0207712_112484392 | 115 |
| 207 | 3300025972 | Ga0207668_10048725 | Ga0207668_100487252 | 115 |
| 208 | 3300025981 | Ga0207640_10112592 | Ga0207640_101125922 | 115 |
| 209 | 3300025981 | Ga0207640_10567443 | Ga0207640_105674431 | 115 |
| 210 | 3300025986 | Ga0207658_10396614 | Ga0207658_103966141 | 115 |
| 211 | 3300025986 | Ga0207658_10849801 | Ga0207658_108498012 | 115 |
| 212 | 3300026023 | Ga0207677_10029498 | Ga0207677_100294983 | 115 |
| 213 | 3300026023 | Ga0207677_10088203 | Ga0207677_100882032 | 115 |
| 214 | 3300026023 | Ga0207677_10173351 | Ga0207677_101733512 | 115 |
| 215 | 3300026035 | Ga0207703_10087351 | Ga0207703_100873514 | 115 |
| 216 | 3300026035 | Ga0207703_10551390 | Ga0207703_105513902 | 115 |
| 217 | 3300026041 | Ga0207639_10158178 | Ga0207639_101581782 | 115 |
| 218 | 3300026067 | Ga0207678_10000314 | Ga0207678_100003149 | 115 |
| 219 | 3300026067 | Ga0207678_10037560 | Ga0207678_100375602 | 115 |
| 220 | 3300026067 | Ga0207678_10065198 | Ga0207678_100651982 | 115 |
| 221 | 3300026067 | Ga0207678_10230295 | Ga0207678_102302952 | 115 |
| 222 | 3300026075 | Ga0207708_10269888 | Ga0207708_102698882 | 115 |
| 223 | 3300026075 | Ga0207708_10564314 | Ga0207708_105643142 | 115 |
| 224 | 3300026078 | Ga0207702_10361772 | Ga0207702_103617722 | 115 |
| 225 | 3300026088 | Ga0207641_11330508 | Ga0207641_113305081 | 115 |
| 226 | 3300026089 | Ga0207648_10315635 | Ga0207648_103156352 | 115 |
| 227 | 3300026095 | Ga0207676_10162642 | Ga0207676_101626422 | 115 |
| 228 | 3300026095 | Ga0207676_12440977 | Ga0207676_124409771 | 115 |
| 229 | 3300026116 | Ga0207674_10048933 | Ga0207674_100489336 | 115 |
| 230 | 3300026116 | Ga0207674_10198458 | Ga0207674_101984582 | 115 |
| 231 | 3300026116 | Ga0207674_10900824 | Ga0207674_109008242 | 115 |
| 232 | 3300026116 | Ga0207674_11599728 | Ga0207674_115997281 | 115 |
| 233 | 3300026118 | Ga0207675_100221368 | Ga0207675_1002213682 | 115 |
| 234 | 3300026121 | Ga0207683_10076164 | Ga0207683_100761641 | 115 |
| 235 | 3300026121 | Ga0207683_10426422 | Ga0207683_104264222 | 115 |
| 236 | 3300026142 | Ga0207698_10110995 | Ga0207698_101109954 | 115 |
| 237 | 3300026142 | Ga0207698_10307224 | Ga0207698_103072242 | 115 |
| 238 | 3300028379 | Ga0268266_10112529 | Ga0268266_101125292 | 115 |
| 239 | 3300028379 | Ga0268266_10176996 | Ga0268266_101769962 | 115 |
| 240 | 3300028379 | Ga0268266_10416481 | Ga0268266_104164811 | 115 |
| 241 | 3300028380 | Ga0268265_11258868 | Ga0268265_112588682 | 115 |
| 242 | 3300028381 | Ga0268264_10486881 | Ga0268264_104868812 | 115 |
| 243 | 3300031901 | Ga0307406_12089429 | Ga0307406_120894292 | 115 |
| 244 | 3300035691 | Ga0373931_0379485 | Ga0373931_0379485_287_643 | 115 |
| 245 | 3300039437 | Ga0436365_1315947 | Ga0436365_1315947_896_1252 | 115 |
| 246 | 3300041460 | Ga0451802_2100189 | Ga0451802_2100189_279_632 | 115 |
| 247 | 3300044658 | Ga0466972_0221839 | Ga0466972_0221839_304_660 | 115 |
| 248 | 3300044683 | Ga0466965_0266200 | Ga0466965_0266200_548_910 | 115 |
| 249 | 3300044693 | Ga0466961_0014273 | Ga0466961_0014273_152_514 | 115 |
| 250 | 3300044694 | Ga0466963_0781445 | Ga0466963_0781445_141_500 | 115 |
| 251 | 3300044765 | Ga0466970_0017578 | Ga0466970_0017578_2669_3031 | 115 |
| 252 | 3300044765 | Ga0466970_0680592 | Ga0466970_0680592_229_585 | 115 |
| 253 | 3300044842 | Ga0466957_0129200 | Ga0466957_0129200_433_795 | 115 |
| 254 | 3300044901 | Ga0466960_0015607 | Ga0466960_0015607_321_707 | 115 |
| 255 | 3300044901 | Ga0466960_0118444 | Ga0466960_0118444_359_721 | 115 |
| 256 | 3300044901 | Ga0466960_0432166 | Ga0466960_0432166_103_459 | 115 |
| 257 | 3300045049 | Ga0466959_0410028 | Ga0466959_0410028_80_442 | 115 |
| 258 | 3300045976 | Ga0466967_0191642 | Ga0466967_0191642_667_1029 | 115 |
| 259 | 3300045976 | Ga0466967_0626237 | Ga0466967_0626237_239_595 | 115 |
| 260 | 3300045976 | Ga0466967_0939305 | Ga0466967_0939305_98_457 | 115 |
| 261 | 3300045976 | Ga0466967_1953551 | Ga0466967_1953551_67_423 | 115 |
| 262 | 3300045976 | Ga0466967_2271923 | Ga0466967_2271923_22_384 | 115 |
| 263 | 3300048903 | Ga0496100_1373412 | Ga0496100_1373412_95_451 | 115 |
| 264 | 3300048905 | Ga0496102_0638202 | Ga0496102_0638202_549_905 | 115 |
| 265 | 3300048905 | Ga0496102_0761644 | Ga0496102_0761644_135_494 | 115 |
| 266 | 3300048907 | Ga0496104_0125821 | Ga0496104_0125821_248_607 | 115 |
| 267 | 3300048907 | Ga0496104_0431487 | Ga0496104_0431487_534_890 | 115 |
| 268 | 3300048908 | Ga0496105_0370639 | Ga0496105_0370639_765_1121 | 115 |
| 269 | 3300048911 | Ga0496108_0060415 | Ga0496108_0060415_102_461 | 115 |
| 270 | 3300048911 | Ga0496108_0287513 | Ga0496108_0287513_250_606 | 115 |
| 271 | 3300048912 | Ga0496109_0017069 | Ga0496109_0017069_562_921 | 115 |
| 272 | 3300048913 | Ga0496110_0106609 | Ga0496110_0106609_979_1335 | 115 |
| 273 | 3300048913 | Ga0496110_0981303 | Ga0496110_0981303_104_460 | 115 |
| 274 | 3300048914 | Ga0496111_0329832 | Ga0496111_0329832_416_772 | 115 |
| 275 | 3300048914 | Ga0496111_0375678 | Ga0496111_0375678_634_990 | 115 |
| 276 | 3300048915 | Ga0496112_0037625 | Ga0496112_0037625_1357_1716 | 115 |
| 277 | 3300048915 | Ga0496112_0223913 | Ga0496112_0223913_620_976 | 115 |
| 278 | 3300048916 | Ga0496113_0347273 | Ga0496113_0347273_300_656 | 115 |
| 279 | 3300048917 | Ga0496114_0127625 | Ga0496114_0127625_700_1056 | 115 |
| 280 | 3300048918 | Ga0496115_0538722 | Ga0496115_0538722_395_754 | 115 |
| 281 | 3300048918 | Ga0496115_1193444 | Ga0496115_1193444_195_551 | 115 |
| 282 | 3300050511 | nmdc:mga08y16_160167_c1 | nmdc:mga08y16_160167_c1_496_852 | 115 |
| 283 | 3300050511 | nmdc:mga08y16_1859246_c1 | nmdc:mga08y16_1859246_c1_69_425 | 115 |
| 284 | 3300050511 | nmdc:mga08y16_238428_c1 | nmdc:mga08y16_238428_c1_819_1175 | 115 |
| 285 | 3300005343 | Ga0070687_101507977 | Ga0070687_1015079771 | 116 |
| 286 | 3300005467 | Ga0070706_100522069 | Ga0070706_1005220692 | 116 |
| 287 | 3300025910 | Ga0207684_10627105 | Ga0207684_106271052 | 116 |
| 288 | 3300031852 | Ga0307410_10662954 | Ga0307410_106629542 | 116 |
| 289 | 3300031903 | Ga0307407_10456062 | Ga0307407_104560622 | 116 |
| 290 | 3300031995 | Ga0307409_101514750 | Ga0307409_1015147501 | 116 |
| 291 | 3300035086 | Ga0373934_0155486 | Ga0373934_0155486_499_861 | 116 |
| 292 | 3300036401 | Ga0373937_0244094 | Ga0373937_0244094_516_878 | 116 |
| 293 | 3300036401 | Ga0373937_1686181 | Ga0373937_1686181_93_452 | 116 |
| 294 | 3300039450 | Ga0436363_1696899 | Ga0436363_1696899_94_453 | 116 |
| 295 | 3300041463 | Ga0451804_0899706 | Ga0451804_0899706_138_500 | 116 |
| 296 | 3300042993 | Ga0439440_0072210 | Ga0439440_0072210_179_550 | 116 |
| 297 | 3300047471 | Ga0495684_0699939 | Ga0495684_0699939_128_487 | 116 |
| 298 | 3300049587 | Ga0501071_0143532 | Ga0501071_0143532_168_584 | 116 |
| 299 | 3300049588 | Ga0501072_0115397 | Ga0501072_0115397_999_1415 | 116 |
| 300 | 3300053084 | Ga0495595_0666693 | Ga0495595_0666693_81_440 | 116 |
| 301 | iso_pu_bacteria | 2643221641 | 2644230811 | 116 |
| 302 | iso_pu_bacteria | 2738543034 | 2739362811 | 116 |
| 303 | iso_pu_bacteria | 2739367898 | 2740167559 | 116 |
| 304 | iso_pu_bacteria | 2739367898 | 2740169548 | 116 |
| 305 | iso_pu_bacteria | 2904765812 | 2904768217 | 116 |
| 306 | iso_pu_bacteria | 2908811453 | 2908815517 | 116 |
| 307 | iso_pu_bacteria | 2919420072 | 2919423362 | 116 |
| 308 | iso_pu_bacteria | 2919432681 | 2919435970 | 116 |
| 309 | 3300005347 | Ga0070668_100223470 | Ga0070668_1002234702 | 117 |
| 310 | 3300005355 | Ga0070671_100001754 | Ga0070671_1000017545 | 117 |
| 311 | 3300005367 | Ga0070667_100704230 | Ga0070667_1007042302 | 117 |
| 312 | 3300005434 | Ga0070709_10574087 | Ga0070709_105740872 | 117 |
| 313 | 3300005445 | Ga0070708_100685636 | Ga0070708_1006856362 | 117 |
| 314 | 3300005548 | Ga0070665_100002791 | Ga0070665_1000027912 | 117 |
| 315 | 3300005564 | Ga0070664_100155191 | Ga0070664_1001551914 | 117 |
| 316 | 3300005614 | Ga0068856_100120619 | Ga0068856_1001206193 | 117 |
| 317 | 3300005841 | Ga0068863_100125060 | Ga0068863_1001250602 | 117 |
| 318 | 3300005841 | Ga0068863_100934144 | Ga0068863_1009341442 | 117 |
| 319 | 3300005843 | Ga0068860_100077660 | Ga0068860_1000776602 | 117 |
| 320 | 3300006051 | Ga0075364_10077973 | Ga0075364_100779732 | 117 |
| 321 | 3300006173 | Ga0070716_100204696 | Ga0070716_1002046962 | 117 |
| 322 | 3300006177 | Ga0075362_10180173 | Ga0075362_101801732 | 117 |
| 323 | 3300009147 | Ga0114129_11368718 | Ga0114129_113687182 | 117 |
| 324 | 3300021388 | Ga0213875_10006652 | Ga0213875_100066527 | 117 |
| 325 | 3300021388 | Ga0213875_10024074 | Ga0213875_100240743 | 117 |
| 326 | 3300021388 | Ga0213875_10026935 | Ga0213875_100269352 | 117 |
| 327 | 3300022467 | Ga0224712_10055690 | Ga0224712_100556902 | 117 |
| 328 | 3300025898 | Ga0207692_10043552 | Ga0207692_100435522 | 117 |
| 329 | 3300025906 | Ga0207699_10263628 | Ga0207699_102636282 | 117 |
| 330 | 3300025915 | Ga0207693_10007426 | Ga0207693_100074265 | 117 |
| 331 | 3300025916 | Ga0207663_10077362 | Ga0207663_100773621 | 117 |
| 332 | 3300025928 | Ga0207700_10117145 | Ga0207700_101171452 | 117 |
| 333 | 3300025929 | Ga0207664_10128207 | Ga0207664_101282073 | 117 |
| 334 | 3300025931 | Ga0207644_10001034 | Ga0207644_100010345 | 117 |
| 335 | 3300025937 | Ga0207669_11243339 | Ga0207669_112433392 | 117 |
| 336 | 3300025939 | Ga0207665_10034114 | Ga0207665_100341146 | 117 |
| 337 | 3300025944 | Ga0207661_10097432 | Ga0207661_100974324 | 117 |
| 338 | 3300025972 | Ga0207668_10407151 | Ga0207668_104071512 | 117 |
| 339 | 3300025972 | Ga0207668_12115415 | Ga0207668_121154151 | 117 |
| 340 | 3300025986 | Ga0207658_10428780 | Ga0207658_104287802 | 117 |
| 341 | 3300026075 | Ga0207708_10656241 | Ga0207708_106562411 | 117 |
| 342 | 3300026078 | Ga0207702_10617836 | Ga0207702_106178362 | 117 |
| 343 | 3300026088 | Ga0207641_10105936 | Ga0207641_101059363 | 117 |
| 344 | 3300026118 | Ga0207675_100830527 | Ga0207675_1008305272 | 117 |
| 345 | 3300028379 | Ga0268266_10013711 | Ga0268266_100137112 | 117 |
| 346 | 3300028381 | Ga0268264_10008083 | Ga0268264_100080835 | 117 |
| 347 | 3300031456 | Ga0307513_10052060 | Ga0307513_100520602 | 117 |
| 348 | 3300031731 | Ga0307405_10562259 | Ga0307405_105622592 | 117 |
| 349 | 3300032002 | Ga0307416_100707586 | Ga0307416_1007075862 | 117 |
| 350 | 3300032002 | Ga0307416_102204462 | Ga0307416_1022044621 | 117 |
| 351 | 3300032004 | Ga0307414_11098905 | Ga0307414_110989051 | 117 |
| 352 | 3300032005 | Ga0307411_10632964 | Ga0307411_106329642 | 117 |
| 353 | 3300032126 | Ga0307415_100060707 | Ga0307415_1000607074 | 117 |
| 354 | 3300035083 | Ga0373926_0000194 | Ga0373926_0000194_3119_3481 | 117 |
| 355 | 3300035111 | Ga0373923_0082203 | Ga0373923_0082203_122_484 | 117 |
| 356 | 3300035113 | Ga0373936_0002169 | Ga0373936_0002169_4304_4666 | 117 |
| 357 | 3300035116 | Ga0373945_0000105 | Ga0373945_0000105_15540_15902 | 117 |
| 358 | 3300035170 | Ga0373943_0002905 | Ga0373943_0002905_1160_1522 | 117 |
| 359 | 3300035171 | Ga0373946_0000340 | Ga0373946_0000340_13328_13690 | 117 |
| 360 | 3300035172 | Ga0373955_0014029 | Ga0373955_0014029_1736_2098 | 117 |
| 361 | 3300035410 | Ga0373924_0110158 | Ga0373924_0110158_396_758 | 117 |
| 362 | 3300035692 | Ga0373935_0000837 | Ga0373935_0000837_7786_8148 | 117 |
| 363 | 3300035695 | Ga0373927_0001172 | Ga0373927_0001172_10391_10753 | 117 |
| 364 | 3300035724 | Ga0373933_0083061 | Ga0373933_0083061_352_714 | 117 |
| 365 | 3300035725 | Ga0373947_0001050 | Ga0373947_0001050_6528_6890 | 117 |
| 366 | 3300036401 | Ga0373937_1107752 | Ga0373937_1107752_298_660 | 117 |
| 367 | 3300037068 | Ga0373925_0001881 | Ga0373925_0001881_6183_6545 | 117 |
| 368 | 3300037853 | Ga0436364_1349894 | Ga0436364_1349894_3193_3555 | 117 |
| 369 | 3300037853 | Ga0436364_1565185 | Ga0436364_1565185_4901_5266 | 117 |
| 370 | 3300039437 | Ga0436365_1348550 | Ga0436365_1348550_789_1154 | 117 |
| 371 | 3300039437 | Ga0436365_1766708 | Ga0436365_1766708_28_390 | 117 |
| 372 | 3300039450 | Ga0436363_0611301 | Ga0436363_0611301_620_985 | 117 |
| 373 | 3300041451 | Ga0451791_1509369 | Ga0451791_1509369_574_936 | 117 |
| 374 | 3300041451 | Ga0451791_1519585 | Ga0451791_1519585_48_410 | 117 |
| 375 | 3300041456 | Ga0451795_0932728 | Ga0451795_0932728_161_523 | 117 |
| 376 | 3300041501 | Ga0451845_0191103 | Ga0451845_0191103_177_539 | 117 |
| 377 | 3300044658 | Ga0466972_0495730 | Ga0466972_0495730_186_557 | 117 |
| 378 | 3300044684 | Ga0466966_0017769 | Ga0466966_0017769_132_491 | 117 |
| 379 | 3300044684 | Ga0466966_0265220 | Ga0466966_0265220_457_819 | 117 |
| 380 | 3300044693 | Ga0466961_0403772 | Ga0466961_0403772_347_709 | 117 |
| 381 | 3300044694 | Ga0466963_0346501 | Ga0466963_0346501_346_729 | 117 |
| 382 | 3300044694 | Ga0466963_0556022 | Ga0466963_0556022_212_577 | 117 |
| 383 | 3300044694 | Ga0466963_1034945 | Ga0466963_1034945_128_490 | 117 |
| 384 | 3300044706 | Ga0466964_0185912 | Ga0466964_0185912_584_949 | 117 |
| 385 | 3300044719 | Ga0466971_0177692 | Ga0466971_0177692_607_990 | 117 |
| 386 | 3300044735 | Ga0466968_0664211 | Ga0466968_0664211_32_397 | 117 |
| 387 | 3300044765 | Ga0466970_0561845 | Ga0466970_0561845_157_516 | 117 |
| 388 | 3300044842 | Ga0466957_0548290 | Ga0466957_0548290_307_672 | 117 |
| 389 | 3300044901 | Ga0466960_0032398 | Ga0466960_0032398_1061_1435 | 117 |
| 390 | 3300045049 | Ga0466959_0398750 | Ga0466959_0398750_257_616 | 117 |
| 391 | 3300045049 | Ga0466959_0415623 | Ga0466959_0415623_427_792 | 117 |
| 392 | 3300045049 | Ga0466959_0505406 | Ga0466959_0505406_395_760 | 117 |
| 393 | 3300045976 | Ga0466967_0043011 | Ga0466967_0043011_539_901 | 117 |
| 394 | 3300045976 | Ga0466967_0220429 | Ga0466967_0220429_677_1042 | 117 |
| 395 | 3300045976 | Ga0466967_0247435 | Ga0466967_0247435_819_1202 | 117 |
| 396 | 3300045976 | Ga0466967_2112610 | Ga0466967_2112610_171_536 | 117 |
| 397 | 3300045976 | Ga0466967_2283818 | Ga0466967_2283818_106_471 | 117 |
| 398 | 3300046463 | Ga0495653_0005402 | Ga0495653_0005402_3791_4153 | 117 |
| 399 | 3300046473 | Ga0495582_0029785 | Ga0495582_0029785_478_840 | 117 |
| 400 | 3300046476 | Ga0495662_0007276 | Ga0495662_0007276_603_965 | 117 |
| 401 | 3300046477 | Ga0495664_0000357 | Ga0495664_0000357_9951_10313 | 117 |
| 402 | 3300046511 | Ga0495608_0030423 | Ga0495608_0030423_1353_1715 | 117 |
| 403 | 3300046514 | Ga0495618_0394399 | Ga0495618_0394399_88_450 | 117 |
| 404 | 3300046517 | Ga0495630_0003829 | Ga0495630_0003829_3369_3731 | 117 |
| 405 | 3300046518 | Ga0495631_0177532 | Ga0495631_0177532_19_384 | 117 |
| 406 | 3300046529 | Ga0495652_0089898 | Ga0495652_0089898_326_688 | 117 |
| 407 | 3300046533 | Ga0495640_0065901 | Ga0495640_0065901_517_879 | 117 |
| 408 | 3300046559 | Ga0495667_0013507 | Ga0495667_0013507_5079_5441 | 117 |
| 409 | 3300046663 | Ga0495635_0003522 | Ga0495635_0003522_7101_7463 | 117 |
| 410 | 3300046665 | Ga0495661_0628456 | Ga0495661_0628456_107_472 | 117 |
| 411 | 3300046675 | Ga0495657_0192638 | Ga0495657_0192638_240_602 | 117 |
| 412 | 3300046678 | Ga0495599_0041964 | Ga0495599_0041964_2283_2645 | 117 |
| 413 | 3300046681 | Ga0495647_0110872 | Ga0495647_0110872_602_964 | 117 |
| 414 | 3300046690 | Ga0495624_0016684 | Ga0495624_0016684_1237_1599 | 117 |
| 415 | 3300046809 | Ga0495600_0180717 | Ga0495600_0180717_672_1034 | 117 |
| 416 | 3300047319 | Ga0495674_0001081 | Ga0495674_0001081_15464_15826 | 117 |
| 417 | 3300047320 | Ga0495672_0073765 | Ga0495672_0073765_932_1300 | 117 |
| 418 | 3300047321 | Ga0495676_0002364 | Ga0495676_0002364_14217_14579 | 117 |
| 419 | 3300047322 | Ga0495680_0007093 | Ga0495680_0007093_3537_3899 | 117 |
| 420 | 3300047471 | Ga0495684_0002609 | Ga0495684_0002609_1057_1419 | 117 |
| 421 | 3300048088 | Ga0495602_0559756 | Ga0495602_0559756_399_761 | 117 |
| 422 | 3300048907 | Ga0496104_1293549 | Ga0496104_1293549_259_621 | 117 |
| 423 | 3300048913 | Ga0496110_1219105 | Ga0496110_1219105_100_462 | 117 |
| 424 | 3300048918 | Ga0496115_0420315 | Ga0496115_0420315_199_567 | 117 |
| 425 | 3300049575 | Ga0501039_0437451 | Ga0501039_0437451_360_722 | 117 |
| 426 | 3300049577 | Ga0501041_0301309 | Ga0501041_0301309_411_806 | 117 |
| 427 | 3300049578 | Ga0501042_0183154 | Ga0501042_0183154_561_923 | 117 |
| 428 | 3300049579 | Ga0501043_0473099 | Ga0501043_0473099_297_659 | 117 |
| 429 | 3300049582 | Ga0501048_0164410 | Ga0501048_0164410_777_1139 | 117 |
| 430 | 3300049587 | Ga0501071_0243345 | Ga0501071_0243345_470_832 | 117 |
| 431 | 3300049822 | Ga0501035_0830907 | Ga0501035_0830907_289_651 | 117 |
| 432 | 3300050489 | nmdc:mga03683_24353_c1 | nmdc:mga03683_24353_c1_1931_2293 | 117 |
| 433 | 3300050491 | nmdc:mga00v17_54503_c1 | nmdc:mga00v17_54503_c1_369_749 | 117 |
| 434 | 3300050491 | nmdc:mga00v17_87173_c1 | nmdc:mga00v17_87173_c1_588_950 | 117 |
| 435 | 3300050492 | nmdc:mga0yw44_719384_c1 | nmdc:mga0yw44_719384_c1_128_508 | 117 |
| 436 | 3300050496 | nmdc:mga07m45_156915_c1 | nmdc:mga07m45_156915_c1_43_405 | 117 |
| 437 | 3300050507 | nmdc:mga05p37_665334_c1 | nmdc:mga05p37_665334_c1_579_953 | 117 |
| 438 | 3300053083 | Ga0495655_0129520 | Ga0495655_0129520_76_453 | 117 |
| 439 | 3300053140 | Ga0500573_0002950 | Ga0500573_0002950_7025_7396 | 117 |
| 440 | 3300061719 | Ga0466962_0395057 | Ga0466962_0395057_103_465 | 117 |
| 441 | iso_pu_bacteria | 2816332139 | 2816510946 | 117 |
| 442 | iso_pu_bacteria | 2904770941 | 2904775459 | 117 |
| 443 | iso_pu_bacteria | 8054472261 | 8054477036 | 117 |
| 444 | 3300005327 | Ga0070658_10269501 | Ga0070658_102695012 | 118 |
| 445 | 3300005329 | Ga0070683_101643794 | Ga0070683_1016437942 | 118 |
| 446 | 3300005337 | Ga0070682_100413008 | Ga0070682_1004130081 | 118 |
| 447 | 3300005344 | Ga0070661_101511007 | Ga0070661_1015110071 | 118 |
| 448 | 3300005344 | Ga0070661_101745912 | Ga0070661_1017459122 | 118 |
| 449 | 3300005354 | Ga0070675_101669049 | Ga0070675_1016690492 | 118 |
| 450 | 3300005366 | Ga0070659_101900861 | Ga0070659_1019008612 | 118 |
| 451 | 3300005435 | Ga0070714_100589793 | Ga0070714_1005897932 | 118 |
| 452 | 3300005435 | Ga0070714_101362271 | Ga0070714_1013622712 | 118 |
| 453 | 3300005455 | Ga0070663_101159059 | Ga0070663_1011590591 | 118 |
| 454 | 3300005458 | Ga0070681_10230902 | Ga0070681_102309021 | 118 |
| 455 | 3300005530 | Ga0070679_100281467 | Ga0070679_1002814672 | 118 |
| 456 | 3300005530 | Ga0070679_101999825 | Ga0070679_1019998251 | 118 |
| 457 | 3300005564 | Ga0070664_100460327 | Ga0070664_1004603272 | 118 |
| 458 | 3300005614 | Ga0068856_100085216 | Ga0068856_1000852162 | 118 |
| 459 | 3300005614 | Ga0068856_101586838 | Ga0068856_1015868382 | 118 |
| 460 | 3300009093 | Ga0105240_11584503 | Ga0105240_115845032 | 118 |
| 461 | 3300009545 | Ga0105237_10139646 | Ga0105237_101396463 | 118 |
| 462 | 3300013306 | Ga0163162_11067355 | Ga0163162_110673552 | 118 |
| 463 | 3300020069 | Ga0197907_11378065 | Ga0197907_113780652 | 118 |
| 464 | 3300020077 | Ga0206351_10913268 | Ga0206351_109132682 | 118 |
| 465 | 3300020078 | Ga0206352_11204810 | Ga0206352_112048101 | 118 |
| 466 | 3300020081 | Ga0206354_11164954 | Ga0206354_111649542 | 118 |
| 467 | 3300020082 | Ga0206353_11199355 | Ga0206353_111993552 | 118 |
| 468 | 3300022467 | Ga0224712_10074108 | Ga0224712_100741082 | 118 |
| 469 | 3300025909 | Ga0207705_10146402 | Ga0207705_101464022 | 118 |
| 470 | 3300025912 | Ga0207707_10406869 | Ga0207707_104068692 | 118 |
| 471 | 3300025917 | Ga0207660_10411964 | Ga0207660_104119642 | 118 |
| 472 | 3300025919 | Ga0207657_10122354 | Ga0207657_101223542 | 118 |
| 473 | 3300025921 | Ga0207652_10379756 | Ga0207652_103797562 | 118 |
| 474 | 3300025944 | Ga0207661_10482111 | Ga0207661_104821112 | 118 |
| 475 | 3300025949 | Ga0207667_10008089 | Ga0207667_1000808910 | 118 |
| 476 | 3300026075 | Ga0207708_11036099 | Ga0207708_110360992 | 118 |
| 477 | 3300026078 | Ga0207702_11275340 | Ga0207702_112753402 | 118 |
| 478 | 3300026095 | Ga0207676_11635771 | Ga0207676_116357712 | 118 |
| 479 | 3300031548 | Ga0307408_101100507 | Ga0307408_1011005072 | 118 |
| 480 | 3300031731 | Ga0307405_10203021 | Ga0307405_102030211 | 118 |
| 481 | 3300031731 | Ga0307405_10257565 | Ga0307405_102575652 | 118 |
| 482 | 3300031731 | Ga0307405_10332957 | Ga0307405_103329572 | 118 |
| 483 | 3300031824 | Ga0307413_10277088 | Ga0307413_102770882 | 118 |
| 484 | 3300031824 | Ga0307413_10392391 | Ga0307413_103923912 | 118 |
| 485 | 3300031824 | Ga0307413_10802573 | Ga0307413_108025732 | 118 |
| 486 | 3300031852 | Ga0307410_10016988 | Ga0307410_100169883 | 118 |
| 487 | 3300031852 | Ga0307410_10118415 | Ga0307410_101184152 | 118 |
| 488 | 3300031852 | Ga0307410_10162267 | Ga0307410_101622672 | 118 |
| 489 | 3300031852 | Ga0307410_10225713 | Ga0307410_102257132 | 118 |
| 490 | 3300031852 | Ga0307410_10244451 | Ga0307410_102444512 | 118 |
| 491 | 3300031852 | Ga0307410_10702803 | Ga0307410_107028032 | 118 |
| 492 | 3300031852 | Ga0307410_11831940 | Ga0307410_118319402 | 118 |
| 493 | 3300031901 | Ga0307406_10014342 | Ga0307406_100143422 | 118 |
| 494 | 3300031901 | Ga0307406_10152468 | Ga0307406_101524682 | 118 |
| 495 | 3300031901 | Ga0307406_12123630 | Ga0307406_121236301 | 118 |
| 496 | 3300031903 | Ga0307407_10034549 | Ga0307407_100345493 | 118 |
| 497 | 3300031903 | Ga0307407_10211387 | Ga0307407_102113872 | 118 |
| 498 | 3300031911 | Ga0307412_10184827 | Ga0307412_101848272 | 118 |
| 499 | 3300031911 | Ga0307412_10541266 | Ga0307412_105412662 | 118 |
| 500 | 3300031995 | Ga0307409_100253164 | Ga0307409_1002531642 | 118 |
| 501 | 3300031995 | Ga0307409_100259222 | Ga0307409_1002592222 | 118 |
| 502 | 3300031995 | Ga0307409_100276946 | Ga0307409_1002769462 | 118 |
| 503 | 3300031995 | Ga0307409_100345194 | Ga0307409_1003451942 | 118 |
| 504 | 3300031995 | Ga0307409_100445573 | Ga0307409_1004455732 | 118 |
| 505 | 3300031995 | Ga0307409_100906225 | Ga0307409_1009062252 | 118 |
| 506 | 3300031995 | Ga0307409_101727881 | Ga0307409_1017278811 | 118 |
| 507 | 3300032002 | Ga0307416_100006810 | Ga0307416_1000068109 | 118 |
| 508 | 3300032002 | Ga0307416_100052929 | Ga0307416_1000529294 | 118 |
| 509 | 3300032002 | Ga0307416_101319095 | Ga0307416_1013190952 | 118 |
| 510 | 3300032002 | Ga0307416_101547146 | Ga0307416_1015471462 | 118 |
| 511 | 3300032002 | Ga0307416_103013596 | Ga0307416_1030135962 | 118 |
| 512 | 3300032004 | Ga0307414_10230363 | Ga0307414_102303632 | 118 |
| 513 | 3300032004 | Ga0307414_10744700 | Ga0307414_107447002 | 118 |
| 514 | 3300032004 | Ga0307414_10936421 | Ga0307414_109364212 | 118 |
| 515 | 3300032004 | Ga0307414_10980978 | Ga0307414_109809782 | 118 |
| 516 | 3300032004 | Ga0307414_12063431 | Ga0307414_120634311 | 118 |
| 517 | 3300032005 | Ga0307411_10082528 | Ga0307411_100825282 | 118 |
| 518 | 3300032005 | Ga0307411_10130150 | Ga0307411_101301502 | 118 |
| 519 | 3300032005 | Ga0307411_10907144 | Ga0307411_109071442 | 118 |
| 520 | 3300032126 | Ga0307415_100001340 | Ga0307415_1000013408 | 118 |
| 521 | 3300032126 | Ga0307415_100359781 | Ga0307415_1003597812 | 118 |
| 522 | 3300032126 | Ga0307415_100591492 | Ga0307415_1005914922 | 118 |
| 523 | 3300032126 | Ga0307415_100721349 | Ga0307415_1007213492 | 118 |
| 524 | 3300032126 | Ga0307415_100783752 | Ga0307415_1007837522 | 118 |
| 525 | 3300032126 | Ga0307415_100913198 | Ga0307415_1009131982 | 118 |
| 526 | 3300037312 | Ga0395899_0190128 | Ga0395899_0190128_219_584 | 118 |
| 527 | 3300037418 | Ga0395900_0010397 | Ga0395900_0010397_4775_5140 | 118 |
| 528 | 3300037418 | Ga0395900_0263376 | Ga0395900_0263376_902_1270 | 118 |
| 529 | 3300037418 | Ga0395900_0352956 | Ga0395900_0352956_472_828 | 118 |
| 530 | 3300037466 | Ga0395898_0218095 | Ga0395898_0218095_924_1289 | 118 |
| 531 | 3300037466 | Ga0395898_0365696 | Ga0395898_0365696_584_940 | 118 |
| 532 | 3300037471 | Ga0395905_0443169 | Ga0395905_0443169_430_786 | 118 |
| 533 | 3300038443 | Ga0395901_0020349 | Ga0395901_0020349_496_852 | 118 |
| 534 | 3300039450 | Ga0436363_0364438 | Ga0436363_0364438_33_395 | 118 |
| 535 | 3300044656 | Ga0466969_0332187 | Ga0466969_0332187_260_628 | 118 |
| 536 | 3300044683 | Ga0466965_0109885 | Ga0466965_0109885_467_835 | 118 |
| 537 | 3300044683 | Ga0466965_0146068 | Ga0466965_0146068_317_682 | 118 |
| 538 | 3300044683 | Ga0466965_0212713 | Ga0466965_0212713_381_749 | 118 |
| 539 | 3300044683 | Ga0466965_0309531 | Ga0466965_0309531_234_629 | 118 |
| 540 | 3300044684 | Ga0466966_0119260 | Ga0466966_0119260_732_1088 | 118 |
| 541 | 3300044684 | Ga0466966_0306645 | Ga0466966_0306645_518_883 | 118 |
| 542 | 3300044684 | Ga0466966_0318221 | Ga0466966_0318221_318_686 | 118 |
| 543 | 3300044693 | Ga0466961_0357448 | Ga0466961_0357448_217_612 | 118 |
| 544 | 3300044693 | Ga0466961_0428840 | Ga0466961_0428840_66_443 | 118 |
| 545 | 3300044693 | Ga0466961_0642096 | Ga0466961_0642096_241_609 | 118 |
| 546 | 3300044693 | Ga0466961_0677403 | Ga0466961_0677403_58_426 | 118 |
| 547 | 3300044694 | Ga0466963_0070176 | Ga0466963_0070176_1561_1926 | 118 |
| 548 | 3300044694 | Ga0466963_0314297 | Ga0466963_0314297_142_510 | 118 |
| 549 | 3300044694 | Ga0466963_0420631 | Ga0466963_0420631_94_450 | 118 |
| 550 | 3300044694 | Ga0466963_0576829 | Ga0466963_0576829_25_393 | 118 |
| 551 | 3300044706 | Ga0466964_0857081 | Ga0466964_0857081_60_428 | 118 |
| 552 | 3300044719 | Ga0466971_0046224 | Ga0466971_0046224_487_855 | 118 |
| 553 | 3300044719 | Ga0466971_0231490 | Ga0466971_0231490_138_506 | 118 |
| 554 | 3300044765 | Ga0466970_0066688 | Ga0466970_0066688_291_659 | 118 |
| 555 | 3300044765 | Ga0466970_0110371 | Ga0466970_0110371_345_722 | 118 |
| 556 | 3300044765 | Ga0466970_0135278 | Ga0466970_0135278_484_849 | 118 |
| 557 | 3300044765 | Ga0466970_0171037 | Ga0466970_0171037_13_381 | 118 |
| 558 | 3300044765 | Ga0466970_0281640 | Ga0466970_0281640_488_844 | 118 |
| 559 | 3300044765 | Ga0466970_0346297 | Ga0466970_0346297_70_438 | 118 |
| 560 | 3300044842 | Ga0466957_0173790 | Ga0466957_0173790_607_972 | 118 |
| 561 | 3300044842 | Ga0466957_0174924 | Ga0466957_0174924_875_1252 | 118 |
| 562 | 3300044842 | Ga0466957_0292105 | Ga0466957_0292105_468_836 | 118 |
| 563 | 3300044901 | Ga0466960_0258515 | Ga0466960_0258515_292_687 | 118 |
| 564 | 3300044901 | Ga0466960_0326648 | Ga0466960_0326648_92_457 | 118 |
| 565 | 3300044901 | Ga0466960_0352644 | Ga0466960_0352644_453_821 | 118 |
| 566 | 3300044901 | Ga0466960_0440660 | Ga0466960_0440660_244_612 | 118 |
| 567 | 3300044901 | Ga0466960_0630885 | Ga0466960_0630885_227_592 | 118 |
| 568 | 3300044901 | Ga0466960_0658606 | Ga0466960_0658606_57_425 | 118 |
| 569 | 3300044901 | Ga0466960_0828128 | Ga0466960_0828128_34_399 | 118 |
| 570 | 3300045049 | Ga0466959_0151691 | Ga0466959_0151691_412_777 | 118 |
| 571 | 3300045049 | Ga0466959_0286376 | Ga0466959_0286376_247_603 | 118 |
| 572 | 3300045049 | Ga0466959_0295720 | Ga0466959_0295720_474_842 | 118 |
| 573 | 3300045049 | Ga0466959_0397504 | Ga0466959_0397504_77_445 | 118 |
| 574 | 3300045836 | Ga0466958_0306344 | Ga0466958_0306344_619_984 | 118 |
| 575 | 3300045836 | Ga0466958_0403811 | Ga0466958_0403811_323_691 | 118 |
| 576 | 3300045836 | Ga0466958_0516290 | Ga0466958_0516290_346_714 | 118 |
| 577 | 3300045836 | Ga0466958_0592938 | Ga0466958_0592938_169_564 | 118 |
| 578 | 3300045836 | Ga0466958_0701008 | Ga0466958_0701008_158_526 | 118 |
| 579 | 3300045976 | Ga0466967_0107869 | Ga0466967_0107869_170_538 | 118 |
| 580 | 3300045976 | Ga0466967_0129378 | Ga0466967_0129378_1793_2161 | 118 |
| 581 | 3300045976 | Ga0466967_0207899 | Ga0466967_0207899_131_499 | 118 |
| 582 | 3300045976 | Ga0466967_0285056 | Ga0466967_0285056_428_796 | 118 |
| 583 | 3300045976 | Ga0466967_0398054 | Ga0466967_0398054_514_870 | 118 |
| 584 | 3300045976 | Ga0466967_0901519 | Ga0466967_0901519_13_381 | 118 |
| 585 | 3300045976 | Ga0466967_0983356 | Ga0466967_0983356_109_477 | 118 |
| 586 | 3300046513 | Ga0495616_0150365 | Ga0495616_0150365_27_392 | 118 |
| 587 | 3300046615 | Ga0495656_0266203 | Ga0495656_0266203_450_815 | 118 |
| 588 | 3300046616 | Ga0495668_0556789 | Ga0495668_0556789_100_465 | 118 |
| 589 | 3300046616 | Ga0495668_0865714 | Ga0495668_0865714_122_487 | 118 |
| 590 | 3300047445 | Ga0495677_0371654 | Ga0495677_0371654_153_518 | 118 |
| 591 | 3300048903 | Ga0496100_0302834 | Ga0496100_0302834_237_605 | 118 |
| 592 | 3300048904 | Ga0496101_1031256 | Ga0496101_1031256_127_489 | 118 |
| 593 | 3300048911 | Ga0496108_0572006 | Ga0496108_0572006_559_921 | 118 |
| 594 | 3300048912 | Ga0496109_1551917 | Ga0496109_1551917_126_515 | 118 |
| 595 | 3300048915 | Ga0496112_0677272 | Ga0496112_0677272_437_805 | 118 |
| 596 | 3300049514 | Ga0501291_127489 | Ga0501291_127489_88_456 | 118 |
| 597 | 3300049533 | Ga0501317_076601 | Ga0501317_076601_156_512 | 118 |
| 598 | 3300049575 | Ga0501039_0491000 | Ga0501039_0491000_362_727 | 118 |
| 599 | 3300049653 | Ga0501206_038869 | Ga0501206_038869_172_537 | 118 |
| 600 | 3300053739 | Ga0500587_017719 | Ga0500587_017719_61_426 | 118 |
| 601 | 3300054114 | Ga0501084_0672181 | Ga0501084_0672181_443_808 | 118 |
| 602 | 3300061719 | Ga0466962_0147868 | Ga0466962_0147868_93_461 | 118 |
| 603 | 3300061719 | Ga0466962_0621396 | Ga0466962_0621396_118_486 | 118 |
| 604 | 3300061734 | Ga0530510_0751157 | Ga0530510_0751157_244_609 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iit-assembly1.cif.gz_B-2 | the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa | 0.877 | 29 | 88 |
| 3egr-assembly1.cif.gz_B-2 | crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution | 0.8709 | 29 | 88 |
| 3egr-assembly1.cif.gz_B-2 | crystal structure of a phenylacetate-coa oxygenase subunit paab (reut_a2307) from ralstonia eutropha jmp134 at 2.65 a resolution | 0.8331 | 29 | 88 |
| 4iit-assembly1.cif.gz_B-2 | the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa | 0.8266 | 29 | 88 |
| 2nzi-assembly2.cif.gz_B | crystal structure of domains a168-a170 from titin | 0.7539 | 29 | 53 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76078_2_65_3.10.20.520 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.8775 | 29 | 88 | 3.10.20.520 |
| 3egrB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.8684 | 29 | 88 | 3.10.20.520 |
| 3egrB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.8301 | 29 | 88 | 3.10.20.520 |
| af_P76078_2_65_3.10.20.520 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phenylacetic acid degradation B | 0.8146 | 29 | 88 | 3.10.20.520 |
| 2nziB03 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7539 | 29 | 53 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0R5H2-F1-model_v4 | 1,2-phenylacetyl-CoA epoxidase, subunit B (EC 1.14.13.149) | 0.9004 | 29 | 83 |
GO:0097266
|
| AF-A0A2T0LAA4-F1-model_v4 | Ring-1,2-phenylacetyl-CoA epoxidase subunit PaaB | 0.8976 | 29 | 87 |
|
| AF-A0A1K1Y778-F1-model_v4 | deleted | 0.8961 | 30 | 87 |
|
| AF-A0A7W1XAX1-F1-model_v4 | Phenylacetic acid degradation protein | 0.8906 | 29 | 87 |
|
| AF-A0A4R1BCV9-F1-model_v4 | Uncharacterized protein | 0.8904 | 30 | 87 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar