F468303

General Info

Members Datasets Scaffolds Average Seq Length
603 303 1206 195

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0190918|Ga0395898_0190918_788_1471
Length 227
Sequence VKLVLATRNDHKLREFREALPGIEIVPLPDDVELPPETGETFAENAVEKARAARAATGLPSIADDSGIEAAALGGRPGVRSARYAGDNATDEENLQKLLDEVAAADGDRTVAYVCALVHVTDEGEEWLFENSCTGELATEPRGDGGFGYDPAFIPDDYPDDERTMAELTPDEKDAISHRGRAARALVARLMVLEEADRPPGTLRTLLGGLGDRRGERQRRRGLGGRP

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0
Rhizoplane 9.45
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0190918 3300037466 Bacteria 1957
2 Ga0070658_10390175 3300005327 Bacteria 1195
3 Ga0070658_10506128 3300005327 Bacteria 1043
4 Ga0070683_100004888 3300005329 Bacteria 11106
5 Ga0070683_100701915 3300005329 Bacteria 969
6 Ga0070670_100157320 3300005331 Bacteria 1969
7 Ga0068869_100131581 3300005334 Bacteria 1924
8 Ga0068869_100146447 3300005334 Bacteria 1828
9 Ga0070666_10025177 3300005335 Bacteria 3879
10 Ga0070666_10268483 3300005335 Bacteria 1210
11 Ga0070680_100001187 3300005336 Bacteria 18758
12 Ga0070680_100226359 3300005336 Bacteria 1579
13 Ga0070682_100058436 3300005337 Bacteria 2432
14 Ga0068868_100019717 3300005338 Bacteria 5056
15 Ga0068868_100212379 3300005338 Bacteria 1618
16 Ga0070660_100001800 3300005339 Bacteria 14717
17 Ga0070660_100152960 3300005339 Bacteria 1856
18 Ga0070660_100561260 3300005339 Bacteria 953
19 Ga0070691_10070395 3300005341 Bacteria 1697
20 Ga0070691_10137449 3300005341 Bacteria 1243
21 Ga0070687_100240057 3300005343 Bacteria 1120
22 Ga0070687_100282618 3300005343 Bacteria 1045
23 Ga0070692_10002883 3300005345 Bacteria 6820
24 Ga0070669_100335713 3300005353 Bacteria 1224
25 Ga0070675_100065205 3300005354 Bacteria 3011
26 Ga0070675_100165231 3300005354 Bacteria 1906
27 Ga0070675_100401422 3300005354 Bacteria 1223
28 Ga0070671_100047538 3300005355 Bacteria 3568
29 Ga0070671_100097689 3300005355 Bacteria 2463
30 Ga0070674_100011436 3300005356 Bacteria 5407
31 Ga0070674_100069788 3300005356 Bacteria 2480
32 Ga0070674_100288352 3300005356 Bacteria 1304
33 Ga0070673_100019278 3300005364 Bacteria 4896
34 Ga0070673_100112487 3300005364 Bacteria 2260
35 Ga0070673_100630538 3300005364 Bacteria 980
36 Ga0070688_100524677 3300005365 Bacteria 897
37 Ga0070688_100909022 3300005365 Bacteria 695
38 Ga0070659_100012202 3300005366 Bacteria 6368
39 Ga0070659_100028328 3300005366 Bacteria 4324
40 Ga0070659_100144830 3300005366 Bacteria 1935
41 Ga0070659_100186747 3300005366 Bacteria 1703
42 Ga0070659_100200245 3300005366 Bacteria 1644
43 Ga0070659_100341426 3300005366 Bacteria 1255
44 Ga0070659_100643540 3300005366 Bacteria 914
45 Ga0070667_100000011 3300005367 Bacteria 269772
46 Ga0070667_100011335 3300005367 Bacteria 7373
47 Ga0070703_10107505 3300005406 Bacteria 993
48 Ga0070714_100017912 3300005435 Bacteria 5744
49 Ga0070714_100021016 3300005435 Bacteria 5337
50 Ga0070714_100140010 3300005435 Bacteria 2171
51 Ga0070714_100167479 3300005435 Bacteria 1992
52 Ga0070714_100334124 3300005435 Bacteria 1420
53 Ga0070710_10002764 3300005437 Bacteria 8357
54 Ga0070711_100006463 3300005439 Bacteria 7067
55 Ga0070705_100063019 3300005440 Bacteria 2210
56 Ga0070705_101026283 3300005440 Bacteria 671
57 Ga0070700_100000366 3300005441 Bacteria 23158
58 Ga0070708_100104976 3300005445 Bacteria 2591
59 Ga0070663_100002635 3300005455 Bacteria 10153
60 Ga0070662_100003679 3300005457 Bacteria 9583
61 Ga0070681_10476337 3300005458 Bacteria 1161
62 Ga0070681_10997571 3300005458 Bacteria 757
63 Ga0068867_100452263 3300005459 Bacteria 1094
64 Ga0070685_10683539 3300005466 Bacteria 747
65 Ga0070706_100042966 3300005467 Bacteria 4176
66 Ga0070706_100387847 3300005467 Bacteria 1300
67 Ga0070679_100583808 3300005530 Bacteria 1061
68 Ga0070684_100005323 3300005535 Bacteria 9854
69 Ga0068853_100008170 3300005539 Bacteria 8401
70 Ga0070672_100632314 3300005543 Bacteria 934
71 Ga0070686_100114487 3300005544 Bacteria 1843
72 Ga0070693_100016430 3300005547 Bacteria 3832
73 Ga0070665_100322934 3300005548 Bacteria 1548
74 Ga0070704_100347095 3300005549 Bacteria 1252
75 Ga0070704_100470686 3300005549 Bacteria 1085
76 Ga0068855_100046852 3300005563 Bacteria 5109
77 Ga0068855_100308728 3300005563 Bacteria 1751
78 Ga0070664_100018963 3300005564 Bacteria 5656
79 Ga0068857_100017303 3300005577 Bacteria 6317
80 Ga0068854_100087064 3300005578 Bacteria 2317
81 Ga0068854_100097342 3300005578 Bacteria 2200
82 Ga0068854_100116754 3300005578 Bacteria 2020
83 Ga0068856_100012449 3300005614 Bacteria 8235
84 Ga0068856_100142617 3300005614 Bacteria 2403
85 Ga0068856_100901676 3300005614 Bacteria 903
86 Ga0070702_100027058 3300005615 Bacteria 3090
87 Ga0070702_100271045 3300005615 Bacteria 1161
88 Ga0068852_100303255 3300005616 Bacteria 1547
89 Ga0068859_100047384 3300005617 Bacteria 4318
90 Ga0068859_100077896 3300005617 Bacteria 3356
91 Ga0068859_100330290 3300005617 Bacteria 1619
92 Ga0068859_100601422 3300005617 Bacteria 1193
93 Ga0068864_100058447 3300005618 Bacteria 3333
94 Ga0068864_100076206 3300005618 Bacteria 2930
95 Ga0068864_100637335 3300005618 Bacteria 1037
96 Ga0068864_100833606 3300005618 Bacteria 908
97 Ga0068866_10001752 3300005718 Bacteria 9130
98 Ga0068861_100155618 3300005719 Bacteria 1880
99 Ga0068861_100224443 3300005719 Bacteria 1590
100 Ga0068870_10037646 3300005840 Bacteria 2494
101 Ga0068870_10095312 3300005840 Bacteria 1671
102 Ga0068863_100014371 3300005841 Bacteria 7625
103 Ga0068858_100004113 3300005842 Bacteria 14325
104 Ga0068858_100070510 3300005842 Bacteria 3240
105 Ga0068858_100275657 3300005842 Bacteria 1601
106 Ga0068860_100014579 3300005843 Bacteria 7690
107 Ga0068860_100462702 3300005843 Bacteria 1262
108 Ga0081455_10005417 3300005937 Bacteria 14000
109 Ga0081455_10036539 3300005937 Bacteria 4372
110 Ga0081455_10171837 3300005937 Bacteria 1650
111 Ga0070717_10653225 3300006028 Bacteria 955
112 Ga0075365_10001155 3300006038 Bacteria 11575
113 Ga0075365_10021354 3300006038 Bacteria 4038
114 Ga0075365_10031662 3300006038 Bacteria 3394
115 Ga0075365_10276854 3300006038 Bacteria 1180
116 Ga0075368_10061585 3300006042 Bacteria 1503
117 Ga0075363_100024596 3300006048 Bacteria 3063
118 Ga0075363_100048252 3300006048 Bacteria 2263
119 Ga0075364_10027283 3300006051 Bacteria 3646
120 Ga0075364_10117492 3300006051 Bacteria 1778
121 Ga0070715_10000771 3300006163 Bacteria 8661
122 Ga0070716_100005490 3300006173 Bacteria 6146
123 Ga0070712_100014228 3300006175 Bacteria 5106
124 Ga0070712_100771067 3300006175 Bacteria 824
125 Ga0097621_100018620 3300006237 Bacteria 5310
126 Ga0075428_101513728 3300006844 Bacteria 703
127 Ga0075433_10330383 3300006852 Bacteria 1348
128 Ga0075434_100008417 3300006871 Bacteria 9593
129 Ga0068865_100005828 3300006881 Bacteria 7493
130 Ga0068865_100013826 3300006881 Bacteria 5117
131 Ga0068865_100399252 3300006881 Bacteria 1126
132 Ga0068865_100824370 3300006881 Bacteria 802
133 Ga0097620_100047383 3300006931 Bacteria 4318
134 Ga0097620_100077895 3300006931 Bacteria 3356
135 Ga0097620_100330306 3300006931 Bacteria 1619
136 Ga0097620_100601400 3300006931 Bacteria 1193
137 Ga0075435_100003643 3300007076 Bacteria 10490
138 Ga0105240_10023807 3300009093 Bacteria 8089
139 Ga0105240_10283098 3300009093 Bacteria 1904
140 Ga0111539_10001745 3300009094 Bacteria 28884
141 Ga0111539_10059046 3300009094 Bacteria 4550
142 Ga0111539_10876199 3300009094 Bacteria 1044
143 Ga0111539_11223676 3300009094 Bacteria 872
144 Ga0105245_10006845 3300009098 Bacteria 9998
145 Ga0105245_10013106 3300009098 Bacteria 7224
146 Ga0105245_10112054 3300009098 Bacteria 2538
147 Ga0105245_10133638 3300009098 Bacteria 2329
148 Ga0105245_10324724 3300009098 Bacteria 1517
149 Ga0105245_10471847 3300009098 Bacteria 1267
150 Ga0105245_10855243 3300009098 Bacteria 950
151 Ga0105245_11708005 3300009098 Bacteria 682
152 Ga0105247_10010440 3300009101 Bacteria 5614
153 Ga0105247_10010745 3300009101 Bacteria 5529
154 Ga0105247_10044118 3300009101 Bacteria 2734
155 Ga0114129_10093213 3300009147 Bacteria 4172
156 Ga0114129_11661380 3300009147 Bacteria 780
157 Ga0105243_10005068 3300009148 Bacteria 10339
158 Ga0105243_10410129 3300009148 Bacteria 1261
159 Ga0105242_10013545 3300009176 Bacteria 6308
160 Ga0105242_10153272 3300009176 Bacteria 2011
161 Ga0105242_10635617 3300009176 Bacteria 1036
162 Ga0105242_10938578 3300009176 Bacteria 868
163 Ga0105248_10058939 3300009177 Bacteria 4312
164 Ga0105237_10018771 3300009545 Bacteria 7151
165 Ga0105237_10228484 3300009545 Bacteria 1861
166 Ga0105238_10004657 3300009551 Bacteria 13573
167 Ga0105238_10006637 3300009551 Bacteria 11536
168 Ga0105249_10250605 3300009553 Bacteria 1755
169 Ga0105249_10264711 3300009553 Bacteria 1710
170 Ga0105239_10053644 3300010375 Bacteria 4422
171 Ga0105239_10072974 3300010375 Bacteria 3774
172 Ga0105239_10228335 3300010375 Bacteria 2088
173 Ga0105239_10348779 3300010375 Bacteria 1671
174 Ga0105239_11033687 3300010375 Bacteria 945
175 Ga0105246_10105430 3300011119 Bacteria 2060
176 Ga0157370_10011232 3300013104 Bacteria 9389
177 Ga0157369_10052735 3300013105 Bacteria 4399
178 Ga0157369_10492247 3300013105 Bacteria 1269
179 Ga0157374_10009758 3300013296 Bacteria 8242
180 Ga0157374_11695023 3300013296 Bacteria 657
181 Ga0157378_10033100 3300013297 Bacteria 4569
182 Ga0163162_10271211 3300013306 Bacteria 1829
183 Ga0163162_10275682 3300013306 Bacteria 1814
184 Ga0163162_10680326 3300013306 Bacteria 1151
185 Ga0157372_10066490 3300013307 Bacteria 4050
186 Ga0157372_10104421 3300013307 Bacteria 3239
187 Ga0157372_10593813 3300013307 Bacteria 1291
188 Ga0157375_10098272 3300013308 Bacteria 3004
189 Ga0157375_10180823 3300013308 Bacteria 2260
190 Ga0157375_10395722 3300013308 Bacteria 1548
191 Ga0157375_11014390 3300013308 Bacteria 969
192 Ga0163163_10014760 3300014325 Bacteria 7189
193 Ga0163163_10071872 3300014325 Bacteria 3448
194 Ga0163163_10139164 3300014325 Bacteria 2469
195 Ga0163163_10193664 3300014325 Bacteria 2081
196 Ga0157380_10100546 3300014326 Bacteria 2408
197 Ga0157380_11468008 3300014326 Bacteria 734
198 Ga0157377_10000425 3300014745 Bacteria 18277
199 Ga0157377_10010703 3300014745 Bacteria 4549
200 Ga0157377_10756751 3300014745 Bacteria 712
201 Ga0157379_10018118 3300014968 Bacteria 6206
202 Ga0157379_10083176 3300014968 Bacteria 2869
203 Ga0157379_10450920 3300014968 Bacteria 1187
204 Ga0157376_10145895 3300014969 Bacteria 2128
205 Ga0157376_10733821 3300014969 Bacteria 995
206 Ga0163161_10615758 3300017792 Bacteria 897
207 Ga0206354_11359713 3300020081 Bacteria 1664
208 Ga0213873_10040778 3300021358 Bacteria 1195
209 Ga0207692_10019201 3300025898 Bacteria 3085
210 Ga0207642_10106367 3300025899 Bacteria 1420
211 Ga0207642_10137590 3300025899 Bacteria 1283
212 Ga0207642_10168583 3300025899 Bacteria 1182
213 Ga0207710_10009094 3300025900 Bacteria 4181
214 Ga0207688_10004040 3300025901 Bacteria 7988
215 Ga0207688_10024555 3300025901 Bacteria 3306
216 Ga0207680_10010726 3300025903 Bacteria 4597
217 Ga0207680_10061016 3300025903 Bacteria 2298
218 Ga0207647_10225176 3300025904 Bacteria 1080
219 Ga0207685_10027719 3300025905 Bacteria 1986
220 Ga0207685_10058979 3300025905 Bacteria 1512
221 Ga0207699_10031187 3300025906 Bacteria 2991
222 Ga0207643_10083601 3300025908 Bacteria 1852
223 Ga0207643_10703095 3300025908 Bacteria 653
224 Ga0207705_10296310 3300025909 Bacteria 1240
225 Ga0207654_10191970 3300025911 Bacteria 1339
226 Ga0207707_10232378 3300025912 Bacteria 1604
227 Ga0207707_10432174 3300025912 Bacteria 1128
228 Ga0207707_10719823 3300025912 Bacteria 837
229 Ga0207671_10257390 3300025914 Bacteria 1373
230 Ga0207693_10000064 3300025915 Bacteria 92381
231 Ga0207693_10081516 3300025915 Bacteria 2533
232 Ga0207663_10007335 3300025916 Bacteria 5713
233 Ga0207660_10051171 3300025917 Bacteria 2936
234 Ga0207660_10164108 3300025917 Bacteria 1716
235 Ga0207660_10331929 3300025917 Bacteria 1216
236 Ga0207662_10313176 3300025918 Bacteria 1046
237 Ga0207662_10380655 3300025918 Bacteria 953
238 Ga0207657_10000307 3300025919 Bacteria 51966
239 Ga0207657_10003497 3300025919 Bacteria 16771
240 Ga0207657_10007490 3300025919 Bacteria 11186
241 Ga0207649_10803527 3300025920 Bacteria 734
242 Ga0207652_10239691 3300025921 Bacteria 1635
243 Ga0207652_10496542 3300025921 Bacteria 1099
244 Ga0207681_10140494 3300025923 Bacteria 1798
245 Ga0207694_10033106 3300025924 Bacteria 3959
246 Ga0207694_10668137 3300025924 Bacteria 876
247 Ga0207650_10502552 3300025925 Bacteria 1013
248 Ga0207659_10572374 3300025926 Bacteria 961
249 Ga0207687_10016830 3300025927 Bacteria 4806
250 Ga0207687_10075910 3300025927 Bacteria 2413
251 Ga0207687_10383546 3300025927 Bacteria 1152
252 Ga0207664_10104080 3300025929 Bacteria 2350
253 Ga0207664_10675384 3300025929 Bacteria 929
254 Ga0207690_10031404 3300025932 Bacteria 3398
255 Ga0207690_10048680 3300025932 Bacteria 2820
256 Ga0207690_10658226 3300025932 Bacteria 859
257 Ga0207706_10024643 3300025933 Bacteria 5392
258 Ga0207686_10231568 3300025934 Bacteria 1340
259 Ga0207686_10566440 3300025934 Bacteria 890
260 Ga0207709_10143429 3300025935 Bacteria 1645
261 Ga0207709_10249819 3300025935 Bacteria 1295
262 Ga0207709_10253360 3300025935 Bacteria 1287
263 Ga0207670_10254537 3300025936 Bacteria 1358
264 Ga0207669_10345662 3300025937 Bacteria 1147
265 Ga0207704_10249941 3300025938 Bacteria 1330
266 Ga0207665_10019488 3300025939 Bacteria 4460
267 Ga0207665_10030244 3300025939 Bacteria 3579
268 Ga0207665_10497619 3300025939 Bacteria 941
269 Ga0207691_10158164 3300025940 Bacteria 1989
270 Ga0207689_10155141 3300025942 Bacteria 1887
271 Ga0207661_10002636 3300025944 Bacteria 12347
272 Ga0207661_10109109 3300025944 Bacteria 2338
273 Ga0207661_10493000 3300025944 Bacteria 1119
274 Ga0207661_10535827 3300025944 Bacteria 1072
275 Ga0207661_10875994 3300025944 Bacteria 827
276 Ga0207679_10004493 3300025945 Bacteria 8688
277 Ga0207667_10094724 3300025949 Bacteria 3083
278 Ga0207667_10132967 3300025949 Bacteria 2562
279 Ga0207667_10484577 3300025949 Bacteria 1255
280 Ga0207651_10420500 3300025960 Bacteria 1141
281 Ga0207651_10516648 3300025960 Bacteria 1034
282 Ga0207668_10449971 3300025972 Bacteria 1099
283 Ga0207640_10045693 3300025981 Bacteria 2813
284 Ga0207658_10000046 3300025986 Bacteria 130772
285 Ga0207658_10594588 3300025986 Bacteria 994
286 Ga0207677_10248536 3300026023 Bacteria 1443
287 Ga0207703_10054064 3300026035 Bacteria 3265
288 Ga0207703_10708222 3300026035 Bacteria 958
289 Ga0207639_10015402 3300026041 Bacteria 5396
290 Ga0207639_10360558 3300026041 Bacteria 1301
291 Ga0207639_10415435 3300026041 Bacteria 1215
292 Ga0207678_10014338 3300026067 Bacteria 6969
293 Ga0207678_10063071 3300026067 Bacteria 3185
294 Ga0207678_10174237 3300026067 Bacteria 1837
295 Ga0207678_10968298 3300026067 Bacteria 753
296 Ga0207708_10002454 3300026075 Bacteria 13628
297 Ga0207708_10039406 3300026075 Bacteria 3600
298 Ga0207702_10046235 3300026078 Bacteria 3663
299 Ga0207702_10052876 3300026078 Bacteria 3438
300 Ga0207702_10201679 3300026078 Bacteria 1844
301 Ga0207702_10286925 3300026078 Bacteria 1558
302 Ga0207641_10448121 3300026088 Bacteria 1247
303 Ga0207648_10198920 3300026089 Bacteria 1777
304 Ga0207648_10344340 3300026089 Bacteria 1343
305 Ga0207676_10054940 3300026095 Bacteria 3123
306 Ga0207676_10089267 3300026095 Bacteria 2526
307 Ga0207676_10201554 3300026095 Bacteria 1759
308 Ga0207674_10023644 3300026116 Bacteria 6579
309 Ga0207674_10483580 3300026116 Bacteria 1197
310 Ga0207674_10789319 3300026116 Bacteria 917
311 Ga0207675_100182720 3300026118 Bacteria 2009
312 Ga0207675_100199980 3300026118 Bacteria 1919
313 Ga0207675_100237385 3300026118 Bacteria 1761
314 Ga0207675_101040733 3300026118 Bacteria 838
315 Ga0207683_10005464 3300026121 Bacteria 10885
316 Ga0207683_10579057 3300026121 Bacteria 1038
317 Ga0207698_10238100 3300026142 Bacteria 1657
318 Ga0207698_10566581 3300026142 Bacteria 1115
319 Ga0207698_10846800 3300026142 Bacteria 919
320 Ga0207428_10197503 3300027907 Bacteria 1514
321 Ga0207428_10202490 3300027907 Bacteria 1493
322 Ga0265357_1001097 3300028023 Bacteria 1878
323 Ga0268266_10040285 3300028379 Bacteria 3982
324 Ga0268266_10960453 3300028379 Bacteria 827
325 Ga0268265_10090969 3300028380 Bacteria 2439
326 Ga0268265_10204480 3300028380 Bacteria 1716
327 Ga0268265_10381589 3300028380 Bacteria 1297
328 Ga0268264_10096101 3300028381 Bacteria 2565
329 Ga0268264_10408949 3300028381 Bacteria 1306
330 Ga0268264_10415402 3300028381 Bacteria 1296
331 Ga0268264_11021783 3300028381 Bacteria 834
332 Ga0268264_11186913 3300028381 Bacteria 772
333 Ga0265763_1009161 3300030763 Bacteria 896
334 Ga0316576_10000819 3300031727 Bacteria 15743
335 Ga0316576_10362186 3300031727 Bacteria 1078
336 Ga0316578_10008480 3300031728 Bacteria 5233
337 Ga0307405_10146713 3300031731 Bacteria 1654
338 Ga0307410_10041837 3300031852 Bacteria 3024
339 Ga0307406_10031039 3300031901 Bacteria 3251
340 Ga0307406_10787727 3300031901 Bacteria 801
341 Ga0307406_11267182 3300031901 Bacteria 642
342 Ga0307412_10248788 3300031911 Bacteria 1379
343 Ga0307409_100063226 3300031995 Bacteria 2902
344 Ga0307409_100330726 3300031995 Bacteria 1430
345 Ga0307409_100387577 3300031995 Bacteria 1331
346 Ga0307409_100430515 3300031995 Bacteria 1268
347 Ga0307411_10046249 3300032005 Bacteria 2804
348 Ga0307411_10269776 3300032005 Bacteria 1349
349 Ga0307415_100096448 3300032126 Bacteria 2155
350 Ga0373938_0082765 3300034957 Bacteria 784
351 Ga0373926_0065215 3300035083 Bacteria 1332
352 Ga0373934_0223966 3300035086 Bacteria 776
353 Ga0373944_0016685 3300035089 Bacteria 2075
354 Ga0373923_0077151 3300035111 Bacteria 1440
355 Ga0373923_0081663 3300035111 Bacteria 1403
356 Ga0373936_0017391 3300035113 Bacteria 2768
357 Ga0373936_0252401 3300035113 Bacteria 788
358 Ga0373945_0001909 3300035116 Bacteria 6467
359 Ga0373945_0009466 3300035116 Bacteria 3192
360 Ga0373953_0138080 3300035117 Bacteria 1042
361 Ga0373954_0030773 3300035118 Bacteria 2476
362 Ga0373954_0111175 3300035118 Bacteria 1325
363 Ga0373956_0072876 3300035119 Bacteria 1569
364 Ga0373943_0214744 3300035170 Bacteria 1069
365 Ga0373946_0002023 3300035171 Bacteria 7107
366 Ga0373955_0040148 3300035172 Bacteria 2501
367 Ga0373955_0201702 3300035172 Bacteria 1184
368 Ga0316574_0017262 3300035398 Bacteria 4222
369 Ga0373935_0023242 3300035692 Bacteria 3808
370 Ga0373927_0046953 3300035695 Bacteria 2793
371 Ga0373927_0391944 3300035695 Bacteria 916
372 Ga0373933_0032695 3300035724 Bacteria 3024
373 Ga0373947_0001280 3300035725 Bacteria 15508
374 Ga0373947_0273843 3300035725 Bacteria 1121
375 Ga0373937_0075001 3300036401 Bacteria 3122
376 Ga0373937_0111520 3300036401 Bacteria 2544
377 Ga0316584_0412685 3300036712 Bacteria 960
378 Ga0316584_0677388 3300036712 Bacteria 709
379 Ga0373925_0009158 3300037068 Bacteria 7207
380 Ga0373925_0016574 3300037068 Bacteria 5339
381 Ga0395899_0002217 3300037312 Bacteria 15928
382 Ga0395899_0028896 3300037312 Bacteria 4172
383 Ga0395900_0003449 3300037418 Bacteria 17094
384 Ga0395900_0841071 3300037418 Bacteria 844
385 Ga0395898_0007223 3300037466 Bacteria 11788
386 Ga0395898_0010952 3300037466 Bacteria 9457
387 Ga0395898_0011174 3300037466 Bacteria 9349
388 Ga0395898_0310878 3300037466 Bacteria 1503
389 Ga0395898_1082777 3300037466 Bacteria 735
390 Ga0395905_0006082 3300037471 Bacteria 12198
391 Ga0395905_0018450 3300037471 Bacteria 6622
392 Ga0395901_0002087 3300038443 Bacteria 20495
393 Ga0395901_0030008 3300038443 Bacteria 5601
394 Ga0395901_0070191 3300038443 Bacteria 3649
395 Ga0395901_0251829 3300038443 Bacteria 1840
396 Ga0395901_0480273 3300038443 Bacteria 1268
397 Ga0436365_0587317 3300039437 Bacteria 1106
398 Ga0436362_0548035 3300039453 Bacteria 2947
399 Ga0451577_0000011 3300042876 Bacteria 597389
400 Ga0453683_0000043 3300044673 Bacteria 217530
401 Ga0466966_0046630 3300044684 Bacteria 2766
402 Ga0466966_0058248 3300044684 Bacteria 2442
403 Ga0466961_0047708 3300044693 Bacteria 2738
404 Ga0466963_0030354 3300044694 Bacteria 3487
405 Ga0466963_0045382 3300044694 Bacteria 2895
406 Ga0466963_0117096 3300044694 Bacteria 1831
407 Ga0453684_0000224 3300044712 Bacteria 248668
408 Ga0466971_0050882 3300044719 Bacteria 1864
409 Ga0466960_0010844 3300044901 Bacteria 3795
410 Ga0466960_0157705 3300044901 Bacteria 1216
411 Ga0466959_0009988 3300045049 Bacteria 6764
412 Ga0466959_0336802 3300045049 Bacteria 1030
413 Ga0451576_0042124 3300045051 Bacteria 4822
414 Ga0466958_0016648 3300045836 Bacteria 4237
415 Ga0466958_0070197 3300045836 Bacteria 2143
416 Ga0466967_0170380 3300045976 Bacteria 2048
417 Ga0466967_0892971 3300045976 Bacteria 884
418 Ga0495592_0158818 3300046454 Bacteria 1557
419 Ga0495603_0074770 3300046455 Bacteria 1989
420 Ga0495603_0165366 3300046455 Bacteria 1282
421 Ga0495651_0010594 3300046462 Bacteria 7089
422 Ga0495653_0001005 3300046463 Bacteria 21756
423 Ga0495580_0004543 3300046472 Bacteria 11653
424 Ga0495580_0062078 3300046472 Bacteria 2622
425 Ga0495580_0068677 3300046472 Bacteria 2478
426 Ga0495580_0115944 3300046472 Bacteria 1860
427 Ga0495582_0004219 3300046473 Bacteria 8084
428 Ga0495639_0003545 3300046475 Bacteria 6739
429 Ga0495639_0073253 3300046475 Bacteria 1585
430 Ga0495664_0007811 3300046477 Bacteria 5952
431 Ga0495594_0006825 3300046499 Bacteria 5865
432 Ga0495618_0003282 3300046514 Bacteria 10129
433 Ga0495618_0253401 3300046514 Bacteria 1104
434 Ga0495628_0441436 3300046516 Bacteria 946
435 Ga0495630_0002930 3300046517 Bacteria 11857
436 Ga0495630_0098113 3300046517 Bacteria 2216
437 Ga0495630_0169021 3300046517 Bacteria 1665
438 Ga0495644_0187951 3300046523 Bacteria 795
439 Ga0495666_0013413 3300046526 Bacteria 4087
440 Ga0495665_0006838 3300046531 Bacteria 6152
441 Ga0495665_0040099 3300046531 Bacteria 2494
442 Ga0495640_0001412 3300046533 Bacteria 18925
443 Ga0495640_0071026 3300046533 Bacteria 2337
444 Ga0495586_0027166 3300046535 Bacteria 3063
445 Ga0495587_0028121 3300046536 Bacteria 3422
446 Ga0495645_0482531 3300046543 Bacteria 777
447 Ga0495667_0021805 3300046559 Bacteria 4320
448 Ga0495667_0389688 3300046559 Bacteria 878
449 Ga0495634_0003694 3300046642 Bacteria 12207
450 Ga0495634_0138086 3300046642 Bacteria 1550
451 Ga0495634_0290078 3300046642 Bacteria 992
452 Ga0495635_0022463 3300046663 Bacteria 4393
453 Ga0495588_0092932 3300046674 Bacteria 1581
454 Ga0495588_0151075 3300046674 Bacteria 1227
455 Ga0495657_0029275 3300046675 Bacteria 3864
456 Ga0495623_0042648 3300046679 Bacteria 2890
457 Ga0495647_0024005 3300046681 Bacteria 2216
458 Ga0495658_0051836 3300046683 Bacteria 2325
459 Ga0495658_0126195 3300046683 Bacteria 1553
460 Ga0495624_0043132 3300046690 Bacteria 2878
461 Ga0495624_0058745 3300046690 Bacteria 2415
462 Ga0495624_0173597 3300046690 Bacteria 1315
463 Ga0495589_0101926 3300046794 Bacteria 1389
464 Ga0495600_0012435 3300046809 Bacteria 5322
465 Ga0495581_0061283 3300047315 Bacteria 2174
466 Ga0495581_0088257 3300047315 Bacteria 1798
467 Ga0495674_0014283 3300047319 Bacteria 7435
468 Ga0495674_0041302 3300047319 Bacteria 4121
469 Ga0495674_0141930 3300047319 Bacteria 2018
470 Ga0495674_0187060 3300047319 Bacteria 1723
471 Ga0495676_0011393 3300047321 Bacteria 8026
472 Ga0495676_0037200 3300047321 Bacteria 4054
473 Ga0495680_0604635 3300047322 Bacteria 733
474 Ga0495687_044522 3300047443 Bacteria 1929
475 Ga0495675_0190143 3300047444 Bacteria 1253
476 Ga0495684_0048488 3300047471 Bacteria 3247
477 Ga0495684_0354059 3300047471 Bacteria 1041
478 Ga0495593_0005634 3300047673 Bacteria 7391
479 Ga0495602_0238002 3300048088 Bacteria 1363
480 Ga0495614_0017367 3300048089 Bacteria 3126
481 Ga0496100_0051021 3300048903 Bacteria 2683
482 Ga0496100_0116273 3300048903 Bacteria 1866
483 Ga0496100_0198253 3300048903 Bacteria 1461
484 Ga0496101_0013274 3300048904 Bacteria 5517
485 Ga0496101_0014312 3300048904 Bacteria 5327
486 Ga0496102_0006018 3300048905 Bacteria 10331
487 Ga0496102_0010825 3300048905 Bacteria 7852
488 Ga0496102_0038091 3300048905 Bacteria 4338
489 Ga0496102_0504422 3300048905 Bacteria 1132
490 Ga0496102_0531578 3300048905 Bacteria 1098
491 Ga0496103_0128312 3300048906 Bacteria 1618
492 Ga0496104_0026711 3300048907 Bacteria 5335
493 Ga0496104_0253963 3300048907 Unclassified 1671
494 Ga0496106_0004435 3300048909 Bacteria 10404
495 Ga0496106_0005780 3300048909 Bacteria 9147
496 Ga0496106_0024927 3300048909 Bacteria 4448
497 Ga0496106_0089427 3300048909 Bacteria 2375
498 Ga0496106_0121322 3300048909 Bacteria 2043
499 Ga0496106_0524255 3300048909 Bacteria 951
500 Ga0496107_0019894 3300048910 Bacteria 4740
501 Ga0496107_0054139 3300048910 Bacteria 2895
502 Ga0496107_0068329 3300048910 Bacteria 2579
503 Ga0496107_0139532 3300048910 Bacteria 1792
504 Ga0496107_0260388 3300048910 Bacteria 1290
505 Ga0496108_0003581 3300048911 Bacteria 12441
506 Ga0496108_0004892 3300048911 Bacteria 10817
507 Ga0496108_0016552 3300048911 Bacteria 6019
508 Ga0496108_0026443 3300048911 Bacteria 4785
509 Ga0496109_0001392 3300048912 Bacteria 20061
510 Ga0496109_0004286 3300048912 Bacteria 11915
511 Ga0496109_0014242 3300048912 Bacteria 6918
512 Ga0496109_0074508 3300048912 Bacteria 3120
513 Ga0496109_0089169 3300048912 Bacteria 2851
514 Ga0496109_0346840 3300048912 Bacteria 1402
515 Ga0496109_0446476 3300048912 Bacteria 1222
516 Ga0496109_0532188 3300048912 Bacteria 1109
517 Ga0496110_0021342 3300048913 Bacteria 5480
518 Ga0496110_0031346 3300048913 Bacteria 4587
519 Ga0496110_0048379 3300048913 Bacteria 3728
520 Ga0496110_0062896 3300048913 Bacteria 3279
521 Ga0496110_0219133 3300048913 Unclassified 1730
522 Ga0496110_1433671 3300048913 Bacteria 600
523 Ga0496111_0034749 3300048914 Bacteria 3600
524 Ga0496111_0093430 3300048914 Bacteria 2205
525 Ga0496112_0003168 3300048915 Bacteria 13515
526 Ga0496112_0391756 3300048915 Unclassified 1329
527 Ga0496112_0395767 3300048915 Bacteria 1321
528 Ga0496112_0742107 3300048915 Bacteria 908
529 Ga0496112_0784423 3300048915 Bacteria 878
530 Ga0496113_0004059 3300048916 Bacteria 8912
531 Ga0496113_0042364 3300048916 Bacteria 3364
532 Ga0496113_0065699 3300048916 Bacteria 2746
533 Ga0496113_0156160 3300048916 Bacteria 1802
534 Ga0496114_0006056 3300048917 Bacteria 9518
535 Ga0496115_0079241 3300048918 Bacteria 2673
536 Ga0496115_0121079 3300048918 Bacteria 2153
537 Ga0496115_0432862 3300048918 Bacteria 1064
538 Ga0501031_0038082 3300049568 Bacteria 3139
539 Ga0501036_0288718 3300049572 Bacteria 1373
540 Ga0501037_0420800 3300049573 Bacteria 914
541 Ga0501038_0323079 3300049574 Bacteria 1207
542 Ga0501039_0191063 3300049575 Bacteria 1610
543 Ga0501039_0441365 3300049575 Bacteria 1022
544 Ga0501039_0536109 3300049575 Unclassified 919
545 Ga0501040_0029309 3300049576 Bacteria 3715
546 Ga0501040_0102926 3300049576 Bacteria 1993
547 Ga0501042_0058933 3300049578 Bacteria 2741
548 Ga0501042_0524307 3300049578 Bacteria 861
549 Ga0501046_0074591 3300049580 Bacteria 2632
550 Ga0501046_0717732 3300049580 Unclassified 704
551 Ga0501067_0073648 3300049583 Bacteria 1892
552 Ga0501067_0341822 3300049583 Bacteria 834
553 Ga0501068_0059696 3300049584 Bacteria 2315
554 Ga0501071_0039006 3300049587 Bacteria 3397
555 Ga0501071_1079185 3300049587 Bacteria 620
556 Ga0501072_0094700 3300049588 Bacteria 2373
557 Ga0501072_0182027 3300049588 Bacteria 1676
558 Ga0501072_0248399 3300049588 Bacteria 1417
559 Ga0501074_0139391 3300049590 Bacteria 1735
560 Ga0501075_0147385 3300049591 Bacteria 1794
561 Ga0501075_0190469 3300049591 Bacteria 1564
562 Ga0501075_0243279 3300049591 Bacteria 1372
563 Ga0501075_0599060 3300049591 Bacteria 841
564 Ga0501077_0581193 3300049593 Bacteria 719
565 Ga0501079_0176467 3300049741 Bacteria 1666
566 Ga0501079_0755401 3300049741 Bacteria 765
567 Ga0501080_0501297 3300049742 Bacteria 1085
568 Ga0501081_0051910 3300049743 Bacteria 2828
569 Ga0501081_0127345 3300049743 Bacteria 1817
570 Ga0501083_0039942 3300049744 Bacteria 3186
571 nmdc:mga03n38_3451_c1 3300050490 Bacteria 5078
572 nmdc:mga03n38_94064_c1 3300050490 Bacteria 1433
573 nmdc:mga00v17_201286_c1 3300050491 Bacteria 1287
574 nmdc:mga00v17_301505_c1 3300050491 Bacteria 1041
575 nmdc:mga0yw44_13586_c1 3300050492 Bacteria 4292
576 nmdc:mga0yw44_254303_c1 3300050492 Bacteria 1170
577 nmdc:mga0yw44_274516_c1 3300050492 Bacteria 1126
578 nmdc:mga05p37_1303187_c1 3300050507 Bacteria 740
579 nmdc:mga05p37_687107_c1 3300050507 Bacteria 1139
580 nmdc:mga05p37_8487_c1 3300050507 Bacteria 12147
581 nmdc:mga09592_272776_c1 3300050508 Bacteria 1467
582 nmdc:mga0qj67_216770_c1 3300050509 Bacteria 1554
583 nmdc:mga06r32_276710_c1 3300050510 Bacteria 1666
584 nmdc:mga06r32_57122_c1 3300050510 Bacteria 3748
585 nmdc:mga08y16_18549_c1 3300050511 Bacteria 7331
586 nmdc:mga08y16_35627_c1 3300050511 Bacteria 5226
587 nmdc:mga08y16_370026_c1 3300050511 Bacteria 1470
588 nmdc:mga0n895_8258_c1 3300050512 Bacteria 9006
589 nmdc:mga0rr50_18456_c1 3300050513 Bacteria 4687
590 nmdc:mga0a205_86240_c1 3300050515 Bacteria 3032
591 Ga0495601_0005425 3300053077 Bacteria 7426
592 Ga0495601_0374442 3300053077 Bacteria 924
593 Ga0495612_0080023 3300053078 Bacteria 1372
594 Ga0495619_0047286 3300053085 Bacteria 2833
595 Ga0495619_0095349 3300053085 Bacteria 2018
596 Ga0500554_058016 3300053102 Bacteria 1235
597 Ga0501082_0172752 3300060353 Bacteria 1879
598 Ga0501082_0230312 3300060353 Bacteria 1612
599 Ga0466962_0127673 3300061719 Bacteria 1228
600 Ga0466962_0160957 3300061719 Bacteria 1091
601 Ga0530510_0043978 3300061734 Bacteria 3227
602 Ga0530510_0064463 3300061734 Bacteria 2653
603 Ga0530510_0071607 3300061734 Bacteria 2516
604 Ga0395898_0190918
605 Ga0070658_10390175
606 Ga0070658_10506128
607 Ga0070683_100004888
608 Ga0070683_100701915
609 Ga0070670_100157320
610 Ga0068869_100131581
611 Ga0068869_100146447
612 Ga0070666_10025177
613 Ga0070666_10268483
614 Ga0070680_100001187
615 Ga0070680_100226359
616 Ga0070682_100058436
617 Ga0068868_100019717
618 Ga0068868_100212379
619 Ga0070660_100001800
620 Ga0070660_100152960
621 Ga0070660_100561260
622 Ga0070691_10070395
623 Ga0070691_10137449
624 Ga0070687_100240057
625 Ga0070687_100282618
626 Ga0070692_10002883
627 Ga0070669_100335713
628 Ga0070675_100065205
629 Ga0070675_100165231
630 Ga0070675_100401422
631 Ga0070671_100047538
632 Ga0070671_100097689
633 Ga0070674_100011436
634 Ga0070674_100069788
635 Ga0070674_100288352
636 Ga0070673_100019278
637 Ga0070673_100112487
638 Ga0070673_100630538
639 Ga0070688_100524677
640 Ga0070688_100909022
641 Ga0070659_100012202
642 Ga0070659_100028328
643 Ga0070659_100144830
644 Ga0070659_100186747
645 Ga0070659_100200245
646 Ga0070659_100341426
647 Ga0070659_100643540
648 Ga0070667_100000011
649 Ga0070667_100011335
650 Ga0070703_10107505
651 Ga0070714_100017912
652 Ga0070714_100021016
653 Ga0070714_100140010
654 Ga0070714_100167479
655 Ga0070714_100334124
656 Ga0070710_10002764
657 Ga0070711_100006463
658 Ga0070705_100063019
659 Ga0070705_101026283
660 Ga0070700_100000366
661 Ga0070708_100104976
662 Ga0070663_100002635
663 Ga0070662_100003679
664 Ga0070681_10476337
665 Ga0070681_10997571
666 Ga0068867_100452263
667 Ga0070685_10683539
668 Ga0070706_100042966
669 Ga0070706_100387847
670 Ga0070679_100583808
671 Ga0070684_100005323
672 Ga0068853_100008170
673 Ga0070672_100632314
674 Ga0070686_100114487
675 Ga0070693_100016430
676 Ga0070665_100322934
677 Ga0070704_100347095
678 Ga0070704_100470686
679 Ga0068855_100046852
680 Ga0068855_100308728
681 Ga0070664_100018963
682 Ga0068857_100017303
683 Ga0068854_100087064
684 Ga0068854_100097342
685 Ga0068854_100116754
686 Ga0068856_100012449
687 Ga0068856_100142617
688 Ga0068856_100901676
689 Ga0070702_100027058
690 Ga0070702_100271045
691 Ga0068852_100303255
692 Ga0068859_100047384
693 Ga0068859_100077896
694 Ga0068859_100330290
695 Ga0068859_100601422
696 Ga0068864_100058447
697 Ga0068864_100076206
698 Ga0068864_100637335
699 Ga0068864_100833606
700 Ga0068866_10001752
701 Ga0068861_100155618
702 Ga0068861_100224443
703 Ga0068870_10037646
704 Ga0068870_10095312
705 Ga0068863_100014371
706 Ga0068858_100004113
707 Ga0068858_100070510
708 Ga0068858_100275657
709 Ga0068860_100014579
710 Ga0068860_100462702
711 Ga0081455_10005417
712 Ga0081455_10036539
713 Ga0081455_10171837
714 Ga0070717_10653225
715 Ga0075365_10001155
716 Ga0075365_10021354
717 Ga0075365_10031662
718 Ga0075365_10276854
719 Ga0075368_10061585
720 Ga0075363_100024596
721 Ga0075363_100048252
722 Ga0075364_10027283
723 Ga0075364_10117492
724 Ga0070715_10000771
725 Ga0070716_100005490
726 Ga0070712_100014228
727 Ga0070712_100771067
728 Ga0097621_100018620
729 Ga0075428_101513728
730 Ga0075433_10330383
731 Ga0075434_100008417
732 Ga0068865_100005828
733 Ga0068865_100013826
734 Ga0068865_100399252
735 Ga0068865_100824370
736 Ga0097620_100047383
737 Ga0097620_100077895
738 Ga0097620_100330306
739 Ga0097620_100601400
740 Ga0075435_100003643
741 Ga0105240_10023807
742 Ga0105240_10283098
743 Ga0111539_10001745
744 Ga0111539_10059046
745 Ga0111539_10876199
746 Ga0111539_11223676
747 Ga0105245_10006845
748 Ga0105245_10013106
749 Ga0105245_10112054
750 Ga0105245_10133638
751 Ga0105245_10324724
752 Ga0105245_10471847
753 Ga0105245_10855243
754 Ga0105245_11708005
755 Ga0105247_10010440
756 Ga0105247_10010745
757 Ga0105247_10044118
758 Ga0114129_10093213
759 Ga0114129_11661380
760 Ga0105243_10005068
761 Ga0105243_10410129
762 Ga0105242_10013545
763 Ga0105242_10153272
764 Ga0105242_10635617
765 Ga0105242_10938578
766 Ga0105248_10058939
767 Ga0105237_10018771
768 Ga0105237_10228484
769 Ga0105238_10004657
770 Ga0105238_10006637
771 Ga0105249_10250605
772 Ga0105249_10264711
773 Ga0105239_10053644
774 Ga0105239_10072974
775 Ga0105239_10228335
776 Ga0105239_10348779
777 Ga0105239_11033687
778 Ga0105246_10105430
779 Ga0157370_10011232
780 Ga0157369_10052735
781 Ga0157369_10492247
782 Ga0157374_10009758
783 Ga0157374_11695023
784 Ga0157378_10033100
785 Ga0163162_10271211
786 Ga0163162_10275682
787 Ga0163162_10680326
788 Ga0157372_10066490
789 Ga0157372_10104421
790 Ga0157372_10593813
791 Ga0157375_10098272
792 Ga0157375_10180823
793 Ga0157375_10395722
794 Ga0157375_11014390
795 Ga0163163_10014760
796 Ga0163163_10071872
797 Ga0163163_10139164
798 Ga0163163_10193664
799 Ga0157380_10100546
800 Ga0157380_11468008
801 Ga0157377_10000425
802 Ga0157377_10010703
803 Ga0157377_10756751
804 Ga0157379_10018118
805 Ga0157379_10083176
806 Ga0157379_10450920
807 Ga0157376_10145895
808 Ga0157376_10733821
809 Ga0163161_10615758
810 Ga0206354_11359713
811 Ga0213873_10040778
812 Ga0207692_10019201
813 Ga0207642_10106367
814 Ga0207642_10137590
815 Ga0207642_10168583
816 Ga0207710_10009094
817 Ga0207688_10004040
818 Ga0207688_10024555
819 Ga0207680_10010726
820 Ga0207680_10061016
821 Ga0207647_10225176
822 Ga0207685_10027719
823 Ga0207685_10058979
824 Ga0207699_10031187
825 Ga0207643_10083601
826 Ga0207643_10703095
827 Ga0207705_10296310
828 Ga0207654_10191970
829 Ga0207707_10232378
830 Ga0207707_10432174
831 Ga0207707_10719823
832 Ga0207671_10257390
833 Ga0207693_10000064
834 Ga0207693_10081516
835 Ga0207663_10007335
836 Ga0207660_10051171
837 Ga0207660_10164108
838 Ga0207660_10331929
839 Ga0207662_10313176
840 Ga0207662_10380655
841 Ga0207657_10000307
842 Ga0207657_10003497
843 Ga0207657_10007490
844 Ga0207649_10803527
845 Ga0207652_10239691
846 Ga0207652_10496542
847 Ga0207681_10140494
848 Ga0207694_10033106
849 Ga0207694_10668137
850 Ga0207650_10502552
851 Ga0207659_10572374
852 Ga0207687_10016830
853 Ga0207687_10075910
854 Ga0207687_10383546
855 Ga0207664_10104080
856 Ga0207664_10675384
857 Ga0207690_10031404
858 Ga0207690_10048680
859 Ga0207690_10658226
860 Ga0207706_10024643
861 Ga0207686_10231568
862 Ga0207686_10566440
863 Ga0207709_10143429
864 Ga0207709_10249819
865 Ga0207709_10253360
866 Ga0207670_10254537
867 Ga0207669_10345662
868 Ga0207704_10249941
869 Ga0207665_10019488
870 Ga0207665_10030244
871 Ga0207665_10497619
872 Ga0207691_10158164
873 Ga0207689_10155141
874 Ga0207661_10002636
875 Ga0207661_10109109
876 Ga0207661_10493000
877 Ga0207661_10535827
878 Ga0207661_10875994
879 Ga0207679_10004493
880 Ga0207667_10094724
881 Ga0207667_10132967
882 Ga0207667_10484577
883 Ga0207651_10420500
884 Ga0207651_10516648
885 Ga0207668_10449971
886 Ga0207640_10045693
887 Ga0207658_10000046
888 Ga0207658_10594588
889 Ga0207677_10248536
890 Ga0207703_10054064
891 Ga0207703_10708222
892 Ga0207639_10015402
893 Ga0207639_10360558
894 Ga0207639_10415435
895 Ga0207678_10014338
896 Ga0207678_10063071
897 Ga0207678_10174237
898 Ga0207678_10968298
899 Ga0207708_10002454
900 Ga0207708_10039406
901 Ga0207702_10046235
902 Ga0207702_10052876
903 Ga0207702_10201679
904 Ga0207702_10286925
905 Ga0207641_10448121
906 Ga0207648_10198920
907 Ga0207648_10344340
908 Ga0207676_10054940
909 Ga0207676_10089267
910 Ga0207676_10201554
911 Ga0207674_10023644
912 Ga0207674_10483580
913 Ga0207674_10789319
914 Ga0207675_100182720
915 Ga0207675_100199980
916 Ga0207675_100237385
917 Ga0207675_101040733
918 Ga0207683_10005464
919 Ga0207683_10579057
920 Ga0207698_10238100
921 Ga0207698_10566581
922 Ga0207698_10846800
923 Ga0207428_10197503
924 Ga0207428_10202490
925 Ga0265357_1001097
926 Ga0268266_10040285
927 Ga0268266_10960453
928 Ga0268265_10090969
929 Ga0268265_10204480
930 Ga0268265_10381589
931 Ga0268264_10096101
932 Ga0268264_10408949
933 Ga0268264_10415402
934 Ga0268264_11021783
935 Ga0268264_11186913
936 Ga0265763_1009161
937 Ga0316576_10000819
938 Ga0316576_10362186
939 Ga0316578_10008480
940 Ga0307405_10146713
941 Ga0307410_10041837
942 Ga0307406_10031039
943 Ga0307406_10787727
944 Ga0307406_11267182
945 Ga0307412_10248788
946 Ga0307409_100063226
947 Ga0307409_100330726
948 Ga0307409_100387577
949 Ga0307409_100430515
950 Ga0307411_10046249
951 Ga0307411_10269776
952 Ga0307415_100096448
953 Ga0373938_0082765
954 Ga0373926_0065215
955 Ga0373934_0223966
956 Ga0373944_0016685
957 Ga0373923_0077151
958 Ga0373923_0081663
959 Ga0373936_0017391
960 Ga0373936_0252401
961 Ga0373945_0001909
962 Ga0373945_0009466
963 Ga0373953_0138080
964 Ga0373954_0030773
965 Ga0373954_0111175
966 Ga0373956_0072876
967 Ga0373943_0214744
968 Ga0373946_0002023
969 Ga0373955_0040148
970 Ga0373955_0201702
971 Ga0316574_0017262
972 Ga0373935_0023242
973 Ga0373927_0046953
974 Ga0373927_0391944
975 Ga0373933_0032695
976 Ga0373947_0001280
977 Ga0373947_0273843
978 Ga0373937_0075001
979 Ga0373937_0111520
980 Ga0316584_0412685
981 Ga0316584_0677388
982 Ga0373925_0009158
983 Ga0373925_0016574
984 Ga0395899_0002217
985 Ga0395899_0028896
986 Ga0395900_0003449
987 Ga0395900_0841071
988 Ga0395898_0007223
989 Ga0395898_0010952
990 Ga0395898_0011174
991 Ga0395898_0310878
992 Ga0395898_1082777
993 Ga0395905_0006082
994 Ga0395905_0018450
995 Ga0395901_0002087
996 Ga0395901_0030008
997 Ga0395901_0070191
998 Ga0395901_0251829
999 Ga0395901_0480273
1000 Ga0436365_0587317
1001 Ga0436362_0548035
1002 Ga0451577_0000011
1003 Ga0453683_0000043
1004 Ga0466966_0046630
1005 Ga0466966_0058248
1006 Ga0466961_0047708
1007 Ga0466963_0030354
1008 Ga0466963_0045382
1009 Ga0466963_0117096
1010 Ga0453684_0000224
1011 Ga0466971_0050882
1012 Ga0466960_0010844
1013 Ga0466960_0157705
1014 Ga0466959_0009988
1015 Ga0466959_0336802
1016 Ga0451576_0042124
1017 Ga0466958_0016648
1018 Ga0466958_0070197
1019 Ga0466967_0170380
1020 Ga0466967_0892971
1021 Ga0495592_0158818
1022 Ga0495603_0074770
1023 Ga0495603_0165366
1024 Ga0495651_0010594
1025 Ga0495653_0001005
1026 Ga0495580_0004543
1027 Ga0495580_0062078
1028 Ga0495580_0068677
1029 Ga0495580_0115944
1030 Ga0495582_0004219
1031 Ga0495639_0003545
1032 Ga0495639_0073253
1033 Ga0495664_0007811
1034 Ga0495594_0006825
1035 Ga0495618_0003282
1036 Ga0495618_0253401
1037 Ga0495628_0441436
1038 Ga0495630_0002930
1039 Ga0495630_0098113
1040 Ga0495630_0169021
1041 Ga0495644_0187951
1042 Ga0495666_0013413
1043 Ga0495665_0006838
1044 Ga0495665_0040099
1045 Ga0495640_0001412
1046 Ga0495640_0071026
1047 Ga0495586_0027166
1048 Ga0495587_0028121
1049 Ga0495645_0482531
1050 Ga0495667_0021805
1051 Ga0495667_0389688
1052 Ga0495634_0003694
1053 Ga0495634_0138086
1054 Ga0495634_0290078
1055 Ga0495635_0022463
1056 Ga0495588_0092932
1057 Ga0495588_0151075
1058 Ga0495657_0029275
1059 Ga0495623_0042648
1060 Ga0495647_0024005
1061 Ga0495658_0051836
1062 Ga0495658_0126195
1063 Ga0495624_0043132
1064 Ga0495624_0058745
1065 Ga0495624_0173597
1066 Ga0495589_0101926
1067 Ga0495600_0012435
1068 Ga0495581_0061283
1069 Ga0495581_0088257
1070 Ga0495674_0014283
1071 Ga0495674_0041302
1072 Ga0495674_0141930
1073 Ga0495674_0187060
1074 Ga0495676_0011393
1075 Ga0495676_0037200
1076 Ga0495680_0604635
1077 Ga0495687_044522
1078 Ga0495675_0190143
1079 Ga0495684_0048488
1080 Ga0495684_0354059
1081 Ga0495593_0005634
1082 Ga0495602_0238002
1083 Ga0495614_0017367
1084 Ga0496100_0051021
1085 Ga0496100_0116273
1086 Ga0496100_0198253
1087 Ga0496101_0013274
1088 Ga0496101_0014312
1089 Ga0496102_0006018
1090 Ga0496102_0010825
1091 Ga0496102_0038091
1092 Ga0496102_0504422
1093 Ga0496102_0531578
1094 Ga0496103_0128312
1095 Ga0496104_0026711
1096 Ga0496104_0253963
1097 Ga0496106_0004435
1098 Ga0496106_0005780
1099 Ga0496106_0024927
1100 Ga0496106_0089427
1101 Ga0496106_0121322
1102 Ga0496106_0524255
1103 Ga0496107_0019894
1104 Ga0496107_0054139
1105 Ga0496107_0068329
1106 Ga0496107_0139532
1107 Ga0496107_0260388
1108 Ga0496108_0003581
1109 Ga0496108_0004892
1110 Ga0496108_0016552
1111 Ga0496108_0026443
1112 Ga0496109_0001392
1113 Ga0496109_0004286
1114 Ga0496109_0014242
1115 Ga0496109_0074508
1116 Ga0496109_0089169
1117 Ga0496109_0346840
1118 Ga0496109_0446476
1119 Ga0496109_0532188
1120 Ga0496110_0021342
1121 Ga0496110_0031346
1122 Ga0496110_0048379
1123 Ga0496110_0062896
1124 Ga0496110_0219133
1125 Ga0496110_1433671
1126 Ga0496111_0034749
1127 Ga0496111_0093430
1128 Ga0496112_0003168
1129 Ga0496112_0391756
1130 Ga0496112_0395767
1131 Ga0496112_0742107
1132 Ga0496112_0784423
1133 Ga0496113_0004059
1134 Ga0496113_0042364
1135 Ga0496113_0065699
1136 Ga0496113_0156160
1137 Ga0496114_0006056
1138 Ga0496115_0079241
1139 Ga0496115_0121079
1140 Ga0496115_0432862
1141 Ga0501031_0038082
1142 Ga0501036_0288718
1143 Ga0501037_0420800
1144 Ga0501038_0323079
1145 Ga0501039_0191063
1146 Ga0501039_0441365
1147 Ga0501039_0536109
1148 Ga0501040_0029309
1149 Ga0501040_0102926
1150 Ga0501042_0058933
1151 Ga0501042_0524307
1152 Ga0501046_0074591
1153 Ga0501046_0717732
1154 Ga0501067_0073648
1155 Ga0501067_0341822
1156 Ga0501068_0059696
1157 Ga0501071_0039006
1158 Ga0501071_1079185
1159 Ga0501072_0094700
1160 Ga0501072_0182027
1161 Ga0501072_0248399
1162 Ga0501074_0139391
1163 Ga0501075_0147385
1164 Ga0501075_0190469
1165 Ga0501075_0243279
1166 Ga0501075_0599060
1167 Ga0501077_0581193
1168 Ga0501079_0176467
1169 Ga0501079_0755401
1170 Ga0501080_0501297
1171 Ga0501081_0051910
1172 Ga0501081_0127345
1173 Ga0501083_0039942
1174 nmdc:mga03n38_3451_c1
1175 nmdc:mga03n38_94064_c1
1176 nmdc:mga00v17_201286_c1
1177 nmdc:mga00v17_301505_c1
1178 nmdc:mga0yw44_13586_c1
1179 nmdc:mga0yw44_254303_c1
1180 nmdc:mga0yw44_274516_c1
1181 nmdc:mga05p37_1303187_c1
1182 nmdc:mga05p37_687107_c1
1183 nmdc:mga05p37_8487_c1
1184 nmdc:mga09592_272776_c1
1185 nmdc:mga0qj67_216770_c1
1186 nmdc:mga06r32_276710_c1
1187 nmdc:mga06r32_57122_c1
1188 nmdc:mga08y16_18549_c1
1189 nmdc:mga08y16_35627_c1
1190 nmdc:mga08y16_370026_c1
1191 nmdc:mga0n895_8258_c1
1192 nmdc:mga0rr50_18456_c1
1193 nmdc:mga0a205_86240_c1
1194 Ga0495601_0005425
1195 Ga0495601_0374442
1196 Ga0495612_0080023
1197 Ga0495619_0047286
1198 Ga0495619_0095349
1199 Ga0500554_058016
1200 Ga0501082_0172752
1201 Ga0501082_0230312
1202 Ga0466962_0127673
1203 Ga0466962_0160957
1204 Ga0530510_0043978
1205 Ga0530510_0064463
1206 Ga0530510_0071607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

3

189

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9308 1 186
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.922 1 187
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.9153 1 189
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.906 3 186
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9025 1 186
ID Description Score Start End Superfamily
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9399 2 186 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9308 1 186 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9222 1 186 3.90.950.10
af_Q9UU89_2_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9105 2 188 3.90.950.10
2ztiA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9073 1 188 3.90.950.10
ID Description Score Start End GO Terms
AF-R6I9R5-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9882 97 186 GO:0005829
GO:0009143
GO:0047429
AF-A0A7C6TLK3-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.988 106 187 GO:0005829
GO:0009143
GO:0047429
AF-A0A7V7WHK6-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9859 108 187 GO:0005829
GO:0009143
GO:0047429
AF-A0A3B0UHI4-F1-model_v4 Nucleoside 5-triphosphatase RdgB (DHAPTP, dITP, XTP-specific) (EC 3.6.1.66) 0.9847 77 186 GO:0005829
GO:0009143
GO:0035870
GO:0036220
GO:0036222
AF-A0A2N2ZCR9-F1-model_v4 Non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family 0.9824 60 187 GO:0005829
GO:0009143
GO:0047429

Map