F468205
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 602 | 311 | 598 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300046513|Ga0495616_0053522|Ga0495616_0053522_276_1127 |
| Length | 283 |
| Sequence | LAASYCARFIGQALQNLIEFFDHRPQNYSFFLPSPSRYTGLHRENNKERIMLEVRKSEERGQAHHGWLQSQHSFSFADYYDPRHVGYGPLRVINEDRVAPGGGFGTHGHRDMEIISYVLDGALEHKDSMGTGSVLHYGDVQRMSAGSGVRHSEFNGSKTDPVHFLQIWIQPNQQGIAPSYEEKHFPLEDKQGKLRLIASGDGREGSVLIHQDASLYAAILDGDDGAEHTLGAGRLGYVHVIRGQVEVNGVALKGGDAVKIEEEDHVRFTGAKAVELLLFDLPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 2 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 3 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 4 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 142 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 154 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 178 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 277 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 294 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 298 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 308 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 1.16 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.66 |
| Nodule | 0 |
| Rhizoplane | 3.49 |
| Rhizosphere | 93.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006777J48905_1134701 | 3300003308 | Bacteria | 800 |
| 2 | rootL2_10005622 | 3300003322 | Bacteria | 27902 |
| 3 | Ga0007417J51691_1028844 | 3300003544 | Bacteria | 839 |
| 4 | Ga0007410J51695_1043264 | 3300003574 | Bacteria | 828 |
| 5 | Ga0055543_1008850 | 3300004625 | Bacteria | 2201 |
| 6 | Ga0065165_1000156 | 3300005262 | Bacteria | 119261 |
| 7 | Ga0065165_1001173 | 3300005262 | Bacteria | 30458 |
| 8 | Ga0065715_10118230 | 3300005293 | Bacteria | 2322 |
| 9 | Ga0070658_10283787 | 3300005327 | Bacteria | 1410 |
| 10 | Ga0070658_10755037 | 3300005327 | Bacteria | 845 |
| 11 | Ga0070676_10013004 | 3300005328 | Bacteria | 4560 |
| 12 | Ga0070676_10013531 | 3300005328 | Bacteria | 4472 |
| 13 | Ga0070683_100061288 | 3300005329 | Bacteria | 3498 |
| 14 | Ga0070677_10008560 | 3300005333 | Bacteria | 3447 |
| 15 | Ga0070666_10277634 | 3300005335 | Bacteria | 1190 |
| 16 | Ga0070660_100007080 | 3300005339 | Bacteria | 7793 |
| 17 | Ga0070660_100200778 | 3300005339 | Bacteria | 1617 |
| 18 | Ga0070660_100227357 | 3300005339 | Bacteria | 1517 |
| 19 | Ga0070689_100001052 | 3300005340 | Bacteria | 17337 |
| 20 | Ga0070687_100045158 | 3300005343 | Bacteria | 2248 |
| 21 | Ga0070661_100003142 | 3300005344 | Bacteria | 11359 |
| 22 | Ga0070661_100005513 | 3300005344 | Bacteria | 8723 |
| 23 | Ga0070661_100375385 | 3300005344 | Bacteria | 1120 |
| 24 | Ga0070692_10189394 | 3300005345 | Bacteria | 1197 |
| 25 | Ga0070668_100084928 | 3300005347 | Bacteria | 2487 |
| 26 | Ga0070669_100004842 | 3300005353 | Bacteria | 9715 |
| 27 | Ga0070669_100132044 | 3300005353 | Bacteria | 1917 |
| 28 | Ga0070675_100275506 | 3300005354 | Bacteria | 1477 |
| 29 | Ga0070671_100127427 | 3300005355 | Bacteria | 2143 |
| 30 | Ga0070671_100191106 | 3300005355 | Bacteria | 1735 |
| 31 | Ga0070674_100033150 | 3300005356 | Bacteria | 3436 |
| 32 | Ga0070674_100045586 | 3300005356 | Bacteria | 2996 |
| 33 | Ga0070673_100064782 | 3300005364 | Bacteria | 2912 |
| 34 | Ga0070688_100059715 | 3300005365 | Bacteria | 2406 |
| 35 | Ga0070659_100014092 | 3300005366 | Bacteria | 5967 |
| 36 | Ga0070659_100038200 | 3300005366 | Bacteria | 3744 |
| 37 | Ga0070659_100140829 | 3300005366 | Bacteria | 1964 |
| 38 | Ga0070694_100176390 | 3300005444 | Bacteria | 1578 |
| 39 | Ga0070663_100054860 | 3300005455 | Bacteria | 2850 |
| 40 | Ga0070663_100091278 | 3300005455 | Bacteria | 2257 |
| 41 | Ga0070662_100001925 | 3300005457 | Bacteria | 12756 |
| 42 | Ga0070662_100515639 | 3300005457 | Bacteria | 998 |
| 43 | Ga0070681_10154428 | 3300005458 | Bacteria | 2221 |
| 44 | Ga0068867_100001711 | 3300005459 | Bacteria | 15285 |
| 45 | Ga0068867_100567231 | 3300005459 | Bacteria | 985 |
| 46 | Ga0070685_10003882 | 3300005466 | Bacteria | 7559 |
| 47 | Ga0070707_100235396 | 3300005468 | Bacteria | 1782 |
| 48 | Ga0070707_100294762 | 3300005468 | Bacteria | 1576 |
| 49 | Ga0068853_100014010 | 3300005539 | Bacteria | 6561 |
| 50 | Ga0068853_100015987 | 3300005539 | Bacteria | 6170 |
| 51 | Ga0068853_100090053 | 3300005539 | Bacteria | 2696 |
| 52 | Ga0068853_100468826 | 3300005539 | Bacteria | 1186 |
| 53 | Ga0070672_100044821 | 3300005543 | Bacteria | 3418 |
| 54 | Ga0070672_100132850 | 3300005543 | Bacteria | 2047 |
| 55 | Ga0070672_100209194 | 3300005543 | Bacteria | 1633 |
| 56 | Ga0070672_100209195 | 3300005543 | Bacteria | 1633 |
| 57 | Ga0070672_100613505 | 3300005543 | Bacteria | 948 |
| 58 | Ga0070686_100042258 | 3300005544 | Bacteria | 2854 |
| 59 | Ga0070695_100018431 | 3300005545 | Bacteria | 4240 |
| 60 | Ga0070696_100252591 | 3300005546 | Bacteria | 1334 |
| 61 | Ga0070665_100016480 | 3300005548 | Bacteria | 7410 |
| 62 | Ga0070704_100081732 | 3300005549 | Bacteria | 2381 |
| 63 | Ga0068855_100000068 | 3300005563 | Bacteria | 124575 |
| 64 | Ga0068855_100008552 | 3300005563 | Bacteria | 12372 |
| 65 | Ga0068855_100023030 | 3300005563 | Bacteria | 7465 |
| 66 | Ga0068855_100346632 | 3300005563 | Bacteria | 1637 |
| 67 | Ga0070664_100028732 | 3300005564 | Bacteria | 4629 |
| 68 | Ga0070664_100131783 | 3300005564 | Bacteria | 2196 |
| 69 | Ga0070664_100407802 | 3300005564 | Bacteria | 1243 |
| 70 | Ga0068854_100045905 | 3300005578 | Bacteria | 3108 |
| 71 | Ga0068856_100000181 | 3300005614 | Bacteria | 65631 |
| 72 | Ga0068852_100102756 | 3300005616 | Bacteria | 2583 |
| 73 | Ga0068859_100020248 | 3300005617 | Bacteria | 6678 |
| 74 | Ga0068859_100432758 | 3300005617 | Bacteria | 1412 |
| 75 | Ga0068864_100010007 | 3300005618 | Bacteria | 7826 |
| 76 | Ga0068866_10057609 | 3300005718 | Bacteria | 2003 |
| 77 | Ga0068861_100004408 | 3300005719 | Bacteria | 9432 |
| 78 | Ga0068861_100222406 | 3300005719 | Bacteria | 1596 |
| 79 | Ga0068851_10033082 | 3300005834 | Bacteria | 2575 |
| 80 | Ga0068870_10014284 | 3300005840 | Bacteria | 3750 |
| 81 | Ga0068870_10031964 | 3300005840 | Bacteria | 2670 |
| 82 | Ga0068863_100123501 | 3300005841 | Bacteria | 2470 |
| 83 | Ga0068858_100019450 | 3300005842 | Bacteria | 6351 |
| 84 | Ga0068860_100134569 | 3300005843 | Bacteria | 2373 |
| 85 | Ga0068860_100501551 | 3300005843 | Bacteria | 1212 |
| 86 | Ga0068862_100008611 | 3300005844 | Bacteria | 8440 |
| 87 | Ga0070716_100233933 | 3300006173 | Bacteria | 1242 |
| 88 | Ga0075367_10130353 | 3300006178 | Bacteria | 1554 |
| 89 | Ga0097621_100177020 | 3300006237 | Bacteria | 1841 |
| 90 | Ga0068871_100454979 | 3300006358 | Bacteria | 1148 |
| 91 | Ga0075428_100008854 | 3300006844 | Bacteria | 11165 |
| 92 | Ga0075430_100033965 | 3300006846 | Bacteria | 4328 |
| 93 | Ga0075430_100064131 | 3300006846 | Bacteria | 3086 |
| 94 | Ga0075430_100089951 | 3300006846 | Bacteria | 2568 |
| 95 | Ga0075429_100080541 | 3300006880 | Bacteria | 2839 |
| 96 | Ga0068865_100015443 | 3300006881 | Bacteria | 4870 |
| 97 | Ga0068865_100148732 | 3300006881 | Bacteria | 1774 |
| 98 | Ga0097620_100020248 | 3300006931 | Bacteria | 6678 |
| 99 | Ga0097620_100432740 | 3300006931 | Bacteria | 1412 |
| 100 | Ga0111539_10063522 | 3300009094 | Bacteria | 4369 |
| 101 | Ga0111539_10165559 | 3300009094 | Bacteria | 2585 |
| 102 | Ga0111539_10247938 | 3300009094 | Bacteria | 2074 |
| 103 | Ga0105241_10432856 | 3300009174 | Bacteria | 1160 |
| 104 | Ga0105237_10162351 | 3300009545 | Bacteria | 2233 |
| 105 | Ga0157373_10050969 | 3300013100 | Bacteria | 2947 |
| 106 | Ga0157373_10157378 | 3300013100 | Bacteria | 1598 |
| 107 | Ga0157371_10036801 | 3300013102 | Bacteria | 3505 |
| 108 | Ga0157370_10035249 | 3300013104 | Bacteria | 4866 |
| 109 | Ga0157370_10406970 | 3300013104 | Bacteria | 1252 |
| 110 | Ga0157369_10011852 | 3300013105 | Bacteria | 9902 |
| 111 | Ga0157369_10315825 | 3300013105 | Bacteria | 1624 |
| 112 | Ga0157369_10497438 | 3300013105 | Bacteria | 1261 |
| 113 | Ga0157374_10052046 | 3300013296 | Bacteria | 3812 |
| 114 | Ga0157374_10854038 | 3300013296 | Bacteria | 927 |
| 115 | Ga0157378_10223429 | 3300013297 | Bacteria | 1791 |
| 116 | Ga0157372_10000481 | 3300013307 | Bacteria | 44095 |
| 117 | Ga0157372_10080705 | 3300013307 | Bacteria | 3681 |
| 118 | Ga0157372_10157395 | 3300013307 | Bacteria | 2625 |
| 119 | Ga0157372_10225302 | 3300013307 | Bacteria | 2173 |
| 120 | Ga0157375_10124906 | 3300013308 | Bacteria | 2687 |
| 121 | Ga0163163_10002938 | 3300014325 | Bacteria | 14431 |
| 122 | Ga0163163_10069714 | 3300014325 | Bacteria | 3501 |
| 123 | Ga0157380_10025234 | 3300014326 | Bacteria | 4506 |
| 124 | Ga0157380_10048236 | 3300014326 | Bacteria | 3353 |
| 125 | Ga0157377_10002681 | 3300014745 | Bacteria | 7901 |
| 126 | Ga0157379_10056462 | 3300014968 | Bacteria | 3508 |
| 127 | Ga0157379_10062051 | 3300014968 | Bacteria | 3343 |
| 128 | Ga0157376_10431472 | 3300014969 | Bacteria | 1281 |
| 129 | Ga0209148_1000280 | 3300025254 | Bacteria | 78989 |
| 130 | Ga0209130_1000268 | 3300025284 | Bacteria | 65115 |
| 131 | Ga0207426_1007139 | 3300025302 | Bacteria | 4717 |
| 132 | Ga0207697_10002035 | 3300025315 | Bacteria | 10675 |
| 133 | Ga0207682_10008838 | 3300025893 | Bacteria | 3985 |
| 134 | Ga0207692_10147638 | 3300025898 | Bacteria | 1344 |
| 135 | Ga0207642_10006785 | 3300025899 | Bacteria | 3829 |
| 136 | Ga0207688_10003028 | 3300025901 | Bacteria | 9157 |
| 137 | Ga0207680_10010024 | 3300025903 | Bacteria | 4723 |
| 138 | Ga0207645_10004453 | 3300025907 | Bacteria | 10373 |
| 139 | Ga0207645_10122646 | 3300025907 | Bacteria | 1688 |
| 140 | Ga0207643_10011553 | 3300025908 | Bacteria | 4770 |
| 141 | Ga0207707_10208067 | 3300025912 | Bacteria | 1705 |
| 142 | Ga0207671_10128332 | 3300025914 | Bacteria | 1944 |
| 143 | Ga0207662_10013247 | 3300025918 | Bacteria | 4610 |
| 144 | Ga0207657_10006281 | 3300025919 | Bacteria | 12350 |
| 145 | Ga0207657_10020569 | 3300025919 | Bacteria | 6232 |
| 146 | Ga0207657_10052623 | 3300025919 | Bacteria | 3532 |
| 147 | Ga0207657_10177349 | 3300025919 | Bacteria | 1724 |
| 148 | Ga0207649_10007766 | 3300025920 | Bacteria | 5834 |
| 149 | Ga0207652_10339136 | 3300025921 | Bacteria | 1357 |
| 150 | Ga0207646_10113148 | 3300025922 | Bacteria | 2436 |
| 151 | Ga0207646_10412921 | 3300025922 | Bacteria | 1219 |
| 152 | Ga0207681_10002320 | 3300025923 | Bacteria | 12099 |
| 153 | Ga0207681_10067033 | 3300025923 | Bacteria | 2487 |
| 154 | Ga0207650_10002733 | 3300025925 | Bacteria | 12179 |
| 155 | Ga0207659_10038350 | 3300025926 | Bacteria | 3332 |
| 156 | Ga0207659_10124352 | 3300025926 | Bacteria | 1981 |
| 157 | Ga0207644_10095849 | 3300025931 | Bacteria | 2219 |
| 158 | Ga0207644_10171599 | 3300025931 | Bacteria | 1693 |
| 159 | Ga0207690_10002028 | 3300025932 | Bacteria | 12417 |
| 160 | Ga0207706_10000074 | 3300025933 | Bacteria | 103144 |
| 161 | Ga0207706_10013695 | 3300025933 | Bacteria | 7360 |
| 162 | Ga0207670_10010089 | 3300025936 | Bacteria | 5423 |
| 163 | Ga0207669_10018487 | 3300025937 | Bacteria | 3605 |
| 164 | Ga0207704_10010144 | 3300025938 | Bacteria | 4578 |
| 165 | Ga0207665_10416579 | 3300025939 | Bacteria | 1025 |
| 166 | Ga0207691_10033608 | 3300025940 | Bacteria | 4775 |
| 167 | Ga0207691_10076932 | 3300025940 | Bacteria | 3007 |
| 168 | Ga0207691_10234037 | 3300025940 | Bacteria | 1590 |
| 169 | Ga0207711_10068327 | 3300025941 | Bacteria | 3077 |
| 170 | Ga0207689_10001435 | 3300025942 | Bacteria | 22775 |
| 171 | Ga0207661_10040127 | 3300025944 | Bacteria | 3678 |
| 172 | Ga0207679_10023599 | 3300025945 | Bacteria | 4208 |
| 173 | Ga0207679_10362461 | 3300025945 | Bacteria | 1266 |
| 174 | Ga0207667_10000057 | 3300025949 | Bacteria | 202301 |
| 175 | Ga0207667_10013194 | 3300025949 | Bacteria | 9472 |
| 176 | Ga0207667_10069904 | 3300025949 | Bacteria | 3655 |
| 177 | Ga0207651_10032167 | 3300025960 | Bacteria | 3366 |
| 178 | Ga0207651_10407190 | 3300025960 | Bacteria | 1158 |
| 179 | Ga0207712_10014645 | 3300025961 | Bacteria | 5049 |
| 180 | Ga0207712_10052763 | 3300025961 | Bacteria | 2849 |
| 181 | Ga0207668_10005071 | 3300025972 | Bacteria | 7754 |
| 182 | Ga0207640_10087955 | 3300025981 | Bacteria | 2143 |
| 183 | Ga0207640_10204010 | 3300025981 | Bacteria | 1501 |
| 184 | Ga0207658_10038153 | 3300025986 | Bacteria | 3458 |
| 185 | Ga0207703_10027963 | 3300026035 | Bacteria | 4440 |
| 186 | Ga0207639_10001107 | 3300026041 | Bacteria | 18300 |
| 187 | Ga0207678_10006227 | 3300026067 | Bacteria | 10598 |
| 188 | Ga0207678_10031774 | 3300026067 | Bacteria | 4603 |
| 189 | Ga0207708_10008607 | 3300026075 | Bacteria | 7550 |
| 190 | Ga0207708_10049053 | 3300026075 | Bacteria | 3215 |
| 191 | Ga0207702_10001390 | 3300026078 | Bacteria | 24132 |
| 192 | Ga0207641_10036623 | 3300026088 | Bacteria | 4095 |
| 193 | Ga0207641_10090036 | 3300026088 | Bacteria | 2682 |
| 194 | Ga0207648_10002472 | 3300026089 | Bacteria | 19861 |
| 195 | Ga0207676_10001646 | 3300026095 | Bacteria | 16449 |
| 196 | Ga0207674_10000461 | 3300026116 | Bacteria | 53251 |
| 197 | Ga0207674_10336079 | 3300026116 | Bacteria | 1460 |
| 198 | Ga0207675_100011252 | 3300026118 | Bacteria | 8379 |
| 199 | Ga0207698_10412173 | 3300026142 | Bacteria | 1294 |
| 200 | Ga0207698_10869110 | 3300026142 | Bacteria | 908 |
| 201 | Ga0209996_1009199 | 3300027395 | Bacteria | 1301 |
| 202 | Ga0209983_1005879 | 3300027665 | Bacteria | 2533 |
| 203 | Ga0209588_1004244 | 3300027671 | Bacteria | 4030 |
| 204 | Ga0209971_1008028 | 3300027682 | Bacteria | 2507 |
| 205 | Ga0209998_10008078 | 3300027717 | Bacteria | 2184 |
| 206 | Ga0209974_10000467 | 3300027876 | Bacteria | 13434 |
| 207 | Ga0268265_10001364 | 3300028380 | Bacteria | 20788 |
| 208 | Ga0268265_10165657 | 3300028380 | Bacteria | 1883 |
| 209 | Ga0268264_10153153 | 3300028381 | Bacteria | 2069 |
| 210 | Ga0311001_1059652 | 3300029277 | Bacteria | 726 |
| 211 | Ga0307509_10000044 | 3300031507 | Bacteria | 176718 |
| 212 | Ga0307408_100079604 | 3300031548 | Bacteria | 2445 |
| 213 | Ga0307508_10056909 | 3300031616 | Bacteria | 3461 |
| 214 | Ga0307405_10022142 | 3300031731 | Bacteria | 3588 |
| 215 | Ga0307413_10004939 | 3300031824 | Bacteria | 5876 |
| 216 | Ga0307413_10238149 | 3300031824 | Bacteria | 1342 |
| 217 | Ga0307410_10025025 | 3300031852 | Bacteria | 3738 |
| 218 | Ga0307406_10005075 | 3300031901 | Bacteria | 7182 |
| 219 | Ga0307412_10011189 | 3300031911 | Bacteria | 5192 |
| 220 | Ga0307409_100008454 | 3300031995 | Bacteria | 6250 |
| 221 | Ga0307416_100059194 | 3300032002 | Bacteria | 3111 |
| 222 | Ga0307416_100156662 | 3300032002 | Bacteria | 2098 |
| 223 | Ga0307411_10014724 | 3300032005 | Bacteria | 4364 |
| 224 | Ga0307411_10238200 | 3300032005 | Bacteria | 1423 |
| 225 | Ga0307415_100008439 | 3300032126 | Bacteria | 5710 |
| 226 | Ga0307507_10234248 | 3300033179 | Bacteria | 1212 |
| 227 | Ga0373934_0000731 | 3300035086 | Bacteria | 11743 |
| 228 | Ga0373923_0000489 | 3300035111 | Bacteria | 9511 |
| 229 | Ga0373936_0002939 | 3300035113 | Bacteria | 6370 |
| 230 | Ga0373941_0015192 | 3300035115 | Bacteria | 2070 |
| 231 | Ga0373953_0138669 | 3300035117 | Bacteria | 1039 |
| 232 | Ga0373954_0000665 | 3300035118 | Bacteria | 13169 |
| 233 | Ga0373954_0012185 | 3300035118 | Bacteria | 3823 |
| 234 | Ga0373956_0006545 | 3300035119 | Bacteria | 4667 |
| 235 | Ga0373957_0012049 | 3300035120 | Bacteria | 2901 |
| 236 | Ga0373957_0108248 | 3300035120 | Bacteria | 1118 |
| 237 | Ga0373943_0242081 | 3300035170 | Bacteria | 1011 |
| 238 | Ga0373946_0010964 | 3300035171 | Bacteria | 3370 |
| 239 | Ga0316574_0494583 | 3300035398 | Bacteria | 763 |
| 240 | Ga0373924_0023342 | 3300035410 | Bacteria | 2425 |
| 241 | Ga0373935_0226082 | 3300035692 | Bacteria | 1301 |
| 242 | Ga0373927_0020223 | 3300035695 | Bacteria | 4365 |
| 243 | Ga0373927_0100850 | 3300035695 | Bacteria | 1877 |
| 244 | Ga0373933_0013442 | 3300035724 | Bacteria | 4537 |
| 245 | Ga0373937_0128403 | 3300036401 | Bacteria | 2366 |
| 246 | Ga0373925_0016379 | 3300037068 | Bacteria | 5369 |
| 247 | Ga0373925_0035075 | 3300037068 | Bacteria | 3700 |
| 248 | Ga0395899_0075913 | 3300037312 | Bacteria | 2454 |
| 249 | Ga0395899_0150009 | 3300037312 | Bacteria | 1653 |
| 250 | Ga0395900_0000297 | 3300037418 | Bacteria | 74817 |
| 251 | Ga0395900_0080416 | 3300037418 | Bacteria | 3349 |
| 252 | Ga0395900_0244365 | 3300037418 | Bacteria | 1799 |
| 253 | Ga0395898_0074976 | 3300037466 | Bacteria | 3268 |
| 254 | Ga0395905_0127754 | 3300037471 | Bacteria | 2390 |
| 255 | Ga0395905_0563293 | 3300037471 | Bacteria | 1041 |
| 256 | Ga0395901_0086487 | 3300038443 | Bacteria | 3278 |
| 257 | Ga0400483_057805 | 3300039062 | Bacteria | 1611 |
| 258 | Ga0400483_268566 | 3300039062 | Bacteria | 1999 |
| 259 | Ga0495617_000039 | 3300046452 | Bacteria | 128069 |
| 260 | Ga0495627_000303 | 3300046453 | Bacteria | 48679 |
| 261 | Ga0495627_004164 | 3300046453 | Bacteria | 6132 |
| 262 | Ga0495627_101361 | 3300046453 | Bacteria | 821 |
| 263 | Ga0495592_0021952 | 3300046454 | Bacteria | 4857 |
| 264 | Ga0495592_0213636 | 3300046454 | Bacteria | 1294 |
| 265 | Ga0495590_0000018 | 3300046457 | Bacteria | 216375 |
| 266 | Ga0495590_0014881 | 3300046457 | Bacteria | 2834 |
| 267 | Ga0495591_000134 | 3300046458 | Bacteria | 80820 |
| 268 | Ga0495638_0014015 | 3300046460 | Bacteria | 5434 |
| 269 | Ga0495638_0078208 | 3300046460 | Bacteria | 2013 |
| 270 | Ga0495641_0045813 | 3300046461 | Bacteria | 2012 |
| 271 | Ga0495651_0034753 | 3300046462 | Bacteria | 3928 |
| 272 | Ga0495653_0079220 | 3300046463 | Bacteria | 2433 |
| 273 | Ga0495650_0000048 | 3300046471 | Bacteria | 334427 |
| 274 | Ga0495650_0111221 | 3300046471 | Bacteria | 1017 |
| 275 | Ga0495580_0027507 | 3300046472 | Bacteria | 4137 |
| 276 | Ga0495580_0103538 | 3300046472 | Bacteria | 1978 |
| 277 | Ga0495582_0000534 | 3300046473 | Bacteria | 21025 |
| 278 | Ga0495582_0033767 | 3300046473 | Bacteria | 2813 |
| 279 | Ga0495582_0194237 | 3300046473 | Bacteria | 1158 |
| 280 | Ga0495605_0001258 | 3300046474 | Bacteria | 16801 |
| 281 | Ga0495605_0001847 | 3300046474 | Bacteria | 13542 |
| 282 | Ga0495605_0014011 | 3300046474 | Bacteria | 4399 |
| 283 | Ga0495605_0032164 | 3300046474 | Bacteria | 2673 |
| 284 | Ga0495639_0006735 | 3300046475 | Bacteria | 4941 |
| 285 | Ga0495664_0009228 | 3300046477 | Bacteria | 5514 |
| 286 | Ga0495584_0000243 | 3300046491 | Bacteria | 39445 |
| 287 | Ga0495584_0004813 | 3300046491 | Bacteria | 7212 |
| 288 | Ga0495584_0012074 | 3300046491 | Bacteria | 4416 |
| 289 | Ga0495584_0025191 | 3300046491 | Bacteria | 3015 |
| 290 | Ga0495584_0084103 | 3300046491 | Bacteria | 1602 |
| 291 | Ga0495584_0204916 | 3300046491 | Bacteria | 1002 |
| 292 | Ga0495585_0004757 | 3300046492 | Bacteria | 8739 |
| 293 | Ga0495585_0034364 | 3300046492 | Bacteria | 2865 |
| 294 | Ga0495585_0038865 | 3300046492 | Bacteria | 2677 |
| 295 | Ga0495585_0049092 | 3300046492 | Bacteria | 2344 |
| 296 | Ga0495585_0055116 | 3300046492 | Bacteria | 2197 |
| 297 | Ga0495594_0004358 | 3300046499 | Bacteria | 7283 |
| 298 | Ga0495594_0013300 | 3300046499 | Bacteria | 4293 |
| 299 | Ga0495594_0028902 | 3300046499 | Bacteria | 2993 |
| 300 | Ga0495594_0078827 | 3300046499 | Bacteria | 1838 |
| 301 | Ga0495594_0085781 | 3300046499 | Bacteria | 1761 |
| 302 | Ga0495596_0015492 | 3300046500 | Bacteria | 3190 |
| 303 | Ga0495596_0021676 | 3300046500 | Bacteria | 2620 |
| 304 | Ga0495596_0022501 | 3300046500 | Bacteria | 2565 |
| 305 | Ga0495596_0024640 | 3300046500 | Bacteria | 2435 |
| 306 | Ga0495596_0028461 | 3300046500 | Bacteria | 2243 |
| 307 | Ga0495596_0033331 | 3300046500 | Bacteria | 2049 |
| 308 | Ga0495596_0099100 | 3300046500 | Bacteria | 1131 |
| 309 | Ga0495607_0001206 | 3300046501 | Bacteria | 23354 |
| 310 | Ga0495607_0001465 | 3300046501 | Bacteria | 21024 |
| 311 | Ga0495607_0047107 | 3300046501 | Bacteria | 2527 |
| 312 | Ga0495607_0050603 | 3300046501 | Bacteria | 2417 |
| 313 | Ga0495607_0052716 | 3300046501 | Bacteria | 2354 |
| 314 | Ga0495607_0171275 | 3300046501 | Bacteria | 1096 |
| 315 | Ga0495583_0000377 | 3300046506 | Bacteria | 69237 |
| 316 | Ga0495583_0001102 | 3300046506 | Bacteria | 29889 |
| 317 | Ga0495583_0013112 | 3300046506 | Bacteria | 4644 |
| 318 | Ga0495583_0029758 | 3300046506 | Bacteria | 2668 |
| 319 | Ga0495583_0041668 | 3300046506 | Bacteria | 2149 |
| 320 | Ga0495583_0044111 | 3300046506 | Bacteria | 2072 |
| 321 | Ga0495606_0020046 | 3300046507 | Bacteria | 4945 |
| 322 | Ga0495606_0101758 | 3300046507 | Bacteria | 1748 |
| 323 | Ga0495606_0108041 | 3300046507 | Bacteria | 1682 |
| 324 | Ga0495610_0000147 | 3300046512 | Bacteria | 77304 |
| 325 | Ga0495616_0000175 | 3300046513 | Bacteria | 54795 |
| 326 | Ga0495616_0004688 | 3300046513 | Bacteria | 8575 |
| 327 | Ga0495616_0005403 | 3300046513 | Bacteria | 7870 |
| 328 | Ga0495616_0016092 | 3300046513 | Bacteria | 4144 |
| 329 | Ga0495616_0045377 | 3300046513 | Bacteria | 2224 |
| 330 | Ga0495616_0048260 | 3300046513 | Bacteria | 2140 |
| 331 | Ga0495616_0053522 | 3300046513 | Bacteria | 2005 |
| 332 | Ga0495628_0020369 | 3300046516 | Bacteria | 5472 |
| 333 | Ga0495630_0122796 | 3300046517 | Bacteria | 1970 |
| 334 | Ga0495631_0000028 | 3300046518 | Bacteria | 87180 |
| 335 | Ga0495631_0001122 | 3300046518 | Bacteria | 16601 |
| 336 | Ga0495631_0008662 | 3300046518 | Bacteria | 5118 |
| 337 | Ga0495631_0009878 | 3300046518 | Bacteria | 4747 |
| 338 | Ga0495631_0014639 | 3300046518 | Bacteria | 3779 |
| 339 | Ga0495631_0017486 | 3300046518 | Bacteria | 3391 |
| 340 | Ga0495631_0022437 | 3300046518 | Bacteria | 2935 |
| 341 | Ga0495631_0074151 | 3300046518 | Bacteria | 1469 |
| 342 | Ga0495632_0000267 | 3300046519 | Bacteria | 52020 |
| 343 | Ga0495632_0000684 | 3300046519 | Bacteria | 30931 |
| 344 | Ga0495632_0003767 | 3300046519 | Bacteria | 10600 |
| 345 | Ga0495632_0006115 | 3300046519 | Bacteria | 7804 |
| 346 | Ga0495632_0015831 | 3300046519 | Bacteria | 4214 |
| 347 | Ga0495632_0018018 | 3300046519 | Bacteria | 3882 |
| 348 | Ga0495632_0018226 | 3300046519 | Bacteria | 3856 |
| 349 | Ga0495632_0041634 | 3300046519 | Bacteria | 2307 |
| 350 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 351 | Ga0495643_0001557 | 3300046522 | Bacteria | 20441 |
| 352 | Ga0495643_0014626 | 3300046522 | Bacteria | 4663 |
| 353 | Ga0495643_0069576 | 3300046522 | Bacteria | 1849 |
| 354 | Ga0495644_0001291 | 3300046523 | Bacteria | 10283 |
| 355 | Ga0495644_0002623 | 3300046523 | Bacteria | 7154 |
| 356 | Ga0495644_0008124 | 3300046523 | Bacteria | 4038 |
| 357 | Ga0495644_0015220 | 3300046523 | Bacteria | 2945 |
| 358 | Ga0495644_0023219 | 3300046523 | Bacteria | 2361 |
| 359 | Ga0495648_0011379 | 3300046524 | Bacteria | 6706 |
| 360 | Ga0495648_0014105 | 3300046524 | Bacteria | 5870 |
| 361 | Ga0495648_0026581 | 3300046524 | Bacteria | 3893 |
| 362 | Ga0495648_0070625 | 3300046524 | Bacteria | 2028 |
| 363 | Ga0495666_0007773 | 3300046526 | Bacteria | 5367 |
| 364 | Ga0495666_0012947 | 3300046526 | Bacteria | 4156 |
| 365 | Ga0495666_0041319 | 3300046526 | Bacteria | 2233 |
| 366 | Ga0495642_0000081 | 3300046528 | Bacteria | 55669 |
| 367 | Ga0495642_0001200 | 3300046528 | Bacteria | 11930 |
| 368 | Ga0495642_0014072 | 3300046528 | Bacteria | 3101 |
| 369 | Ga0495642_0040548 | 3300046528 | Bacteria | 1891 |
| 370 | Ga0495642_0042669 | 3300046528 | Bacteria | 1848 |
| 371 | Ga0495652_0041160 | 3300046529 | Bacteria | 3990 |
| 372 | Ga0495652_0057079 | 3300046529 | Bacteria | 3313 |
| 373 | Ga0495654_0007829 | 3300046530 | Bacteria | 5940 |
| 374 | Ga0495654_0053124 | 3300046530 | Bacteria | 1970 |
| 375 | Ga0495665_0004851 | 3300046531 | Bacteria | 7254 |
| 376 | Ga0495640_0110622 | 3300046533 | Bacteria | 1796 |
| 377 | Ga0495640_0379882 | 3300046533 | Bacteria | 869 |
| 378 | Ga0495586_0015570 | 3300046535 | Bacteria | 4046 |
| 379 | Ga0495587_0006076 | 3300046536 | Bacteria | 7879 |
| 380 | Ga0495609_0006889 | 3300046538 | Bacteria | 5739 |
| 381 | Ga0495609_0008883 | 3300046538 | Bacteria | 4890 |
| 382 | Ga0495609_0015800 | 3300046538 | Bacteria | 3528 |
| 383 | Ga0495609_0016598 | 3300046538 | Bacteria | 3429 |
| 384 | Ga0495609_0031754 | 3300046538 | Bacteria | 2399 |
| 385 | Ga0495609_0093622 | 3300046538 | Bacteria | 1305 |
| 386 | Ga0495609_0128119 | 3300046538 | Bacteria | 1088 |
| 387 | Ga0495621_0013697 | 3300046539 | Bacteria | 2553 |
| 388 | Ga0495597_0000187 | 3300046542 | Bacteria | 55956 |
| 389 | Ga0495597_0000404 | 3300046542 | Bacteria | 37304 |
| 390 | Ga0495597_0002432 | 3300046542 | Bacteria | 11812 |
| 391 | Ga0495597_0028870 | 3300046542 | Bacteria | 2535 |
| 392 | Ga0495597_0031584 | 3300046542 | Bacteria | 2408 |
| 393 | Ga0495597_0044231 | 3300046542 | Bacteria | 1981 |
| 394 | Ga0495597_0092019 | 3300046542 | Bacteria | 1286 |
| 395 | Ga0495622_0049992 | 3300046557 | Bacteria | 1940 |
| 396 | Ga0495622_0257012 | 3300046557 | Bacteria | 767 |
| 397 | Ga0495633_0001359 | 3300046558 | Bacteria | 19163 |
| 398 | Ga0495633_0009075 | 3300046558 | Bacteria | 5529 |
| 399 | Ga0495633_0019652 | 3300046558 | Bacteria | 3413 |
| 400 | Ga0495633_0051380 | 3300046558 | Bacteria | 1942 |
| 401 | Ga0495667_0006636 | 3300046559 | Bacteria | 7855 |
| 402 | Ga0495667_0119177 | 3300046559 | Bacteria | 1704 |
| 403 | Ga0495656_0040782 | 3300046615 | Bacteria | 1936 |
| 404 | Ga0495656_0117989 | 3300046615 | Bacteria | 1249 |
| 405 | Ga0495656_0138753 | 3300046615 | Bacteria | 1164 |
| 406 | Ga0495668_0000603 | 3300046616 | Bacteria | 43532 |
| 407 | Ga0495668_0001327 | 3300046616 | Bacteria | 24338 |
| 408 | Ga0495668_0003472 | 3300046616 | Bacteria | 11763 |
| 409 | Ga0495668_0008015 | 3300046616 | Bacteria | 6654 |
| 410 | Ga0495668_0023093 | 3300046616 | Bacteria | 3550 |
| 411 | Ga0495668_0025211 | 3300046616 | Bacteria | 3380 |
| 412 | Ga0495668_0025226 | 3300046616 | Bacteria | 3379 |
| 413 | Ga0495668_0049134 | 3300046616 | Bacteria | 2339 |
| 414 | Ga0495668_0107029 | 3300046616 | Bacteria | 1529 |
| 415 | Ga0495668_0110488 | 3300046616 | Bacteria | 1503 |
| 416 | Ga0495668_0165995 | 3300046616 | Bacteria | 1209 |
| 417 | Ga0495668_0254734 | 3300046616 | Bacteria | 961 |
| 418 | Ga0495634_0004975 | 3300046642 | Bacteria | 10266 |
| 419 | Ga0495634_0043743 | 3300046642 | Bacteria | 3034 |
| 420 | Ga0495611_0001261 | 3300046648 | Bacteria | 13033 |
| 421 | Ga0495611_0002381 | 3300046648 | Bacteria | 8656 |
| 422 | Ga0495611_0032033 | 3300046648 | Bacteria | 2316 |
| 423 | Ga0495625_0019644 | 3300046660 | Bacteria | 5233 |
| 424 | Ga0495625_0063631 | 3300046660 | Bacteria | 2604 |
| 425 | Ga0495625_0096352 | 3300046660 | Bacteria | 2038 |
| 426 | Ga0495625_0141008 | 3300046660 | Bacteria | 1626 |
| 427 | Ga0495635_0054081 | 3300046663 | Bacteria | 2765 |
| 428 | Ga0495635_0081969 | 3300046663 | Bacteria | 2207 |
| 429 | Ga0495661_0003069 | 3300046665 | Bacteria | 12562 |
| 430 | Ga0495661_0003405 | 3300046665 | Bacteria | 11761 |
| 431 | Ga0495661_0007004 | 3300046665 | Bacteria | 7885 |
| 432 | Ga0495661_0019568 | 3300046665 | Bacteria | 4434 |
| 433 | Ga0495661_0034655 | 3300046665 | Bacteria | 3174 |
| 434 | Ga0495661_0066800 | 3300046665 | Bacteria | 2115 |
| 435 | Ga0495588_0004759 | 3300046674 | Bacteria | 6000 |
| 436 | Ga0495588_0005321 | 3300046674 | Bacteria | 5725 |
| 437 | Ga0495588_0022699 | 3300046674 | Bacteria | 3102 |
| 438 | Ga0495588_0143479 | 3300046674 | Bacteria | 1261 |
| 439 | Ga0495657_0003112 | 3300046675 | Bacteria | 13695 |
| 440 | Ga0495599_0023512 | 3300046678 | Bacteria | 3853 |
| 441 | Ga0495623_0002113 | 3300046679 | Bacteria | 13287 |
| 442 | Ga0495647_0010219 | 3300046681 | Bacteria | 3193 |
| 443 | Ga0495647_0051592 | 3300046681 | Bacteria | 1599 |
| 444 | Ga0495669_0000174 | 3300046684 | Bacteria | 40779 |
| 445 | Ga0495669_0002474 | 3300046684 | Bacteria | 7536 |
| 446 | Ga0495669_0004825 | 3300046684 | Bacteria | 5594 |
| 447 | Ga0495669_0007519 | 3300046684 | Bacteria | 4572 |
| 448 | Ga0495669_0017305 | 3300046684 | Bacteria | 3092 |
| 449 | Ga0495669_0025169 | 3300046684 | Bacteria | 2594 |
| 450 | Ga0495669_0056497 | 3300046684 | Bacteria | 1769 |
| 451 | Ga0495669_0078458 | 3300046684 | Bacteria | 1513 |
| 452 | Ga0495613_0129512 | 3300046689 | Bacteria | 1807 |
| 453 | Ga0495624_0147194 | 3300046690 | Bacteria | 1441 |
| 454 | Ga0495670_0001204 | 3300046691 | Bacteria | 12575 |
| 455 | Ga0495670_0017542 | 3300046691 | Bacteria | 3523 |
| 456 | Ga0495670_0058698 | 3300046691 | Bacteria | 1931 |
| 457 | Ga0495671_0000338 | 3300046692 | Bacteria | 39056 |
| 458 | Ga0495671_0000846 | 3300046692 | Bacteria | 21877 |
| 459 | Ga0495671_0016291 | 3300046692 | Bacteria | 3972 |
| 460 | Ga0495671_0240164 | 3300046692 | Bacteria | 875 |
| 461 | Ga0495649_0000355 | 3300046694 | Bacteria | 39453 |
| 462 | Ga0495649_0003389 | 3300046694 | Bacteria | 10775 |
| 463 | Ga0495649_0022143 | 3300046694 | Bacteria | 3556 |
| 464 | Ga0495649_0068786 | 3300046694 | Bacteria | 1899 |
| 465 | Ga0495649_0143406 | 3300046694 | Bacteria | 1256 |
| 466 | Ga0495589_0000441 | 3300046794 | Bacteria | 30525 |
| 467 | Ga0495589_0000813 | 3300046794 | Bacteria | 19744 |
| 468 | Ga0495589_0002969 | 3300046794 | Bacteria | 9344 |
| 469 | Ga0495589_0009670 | 3300046794 | Bacteria | 5011 |
| 470 | Ga0495589_0015895 | 3300046794 | Bacteria | 3869 |
| 471 | Ga0495589_0017623 | 3300046794 | Bacteria | 3664 |
| 472 | Ga0495600_0036797 | 3300046809 | Bacteria | 3181 |
| 473 | Ga0495660_0001242 | 3300046810 | Bacteria | 17743 |
| 474 | Ga0495660_0054162 | 3300046810 | Bacteria | 2174 |
| 475 | Ga0495660_0056767 | 3300046810 | Bacteria | 2114 |
| 476 | Ga0495660_0089629 | 3300046810 | Bacteria | 1601 |
| 477 | Ga0495581_0392117 | 3300047315 | Bacteria | 810 |
| 478 | Ga0495581_0484655 | 3300047315 | Bacteria | 719 |
| 479 | Ga0495604_0012212 | 3300047317 | Bacteria | 6826 |
| 480 | Ga0495604_0108536 | 3300047317 | Bacteria | 2027 |
| 481 | Ga0495636_0010339 | 3300047318 | Bacteria | 3684 |
| 482 | Ga0495636_0049678 | 3300047318 | Bacteria | 1754 |
| 483 | Ga0495674_0002348 | 3300047319 | Bacteria | 18570 |
| 484 | Ga0495672_0000126 | 3300047320 | Bacteria | 117782 |
| 485 | Ga0495672_0056639 | 3300047320 | Bacteria | 2279 |
| 486 | Ga0495676_0000047 | 3300047321 | Bacteria | 100683 |
| 487 | Ga0495680_0007593 | 3300047322 | Bacteria | 9911 |
| 488 | Ga0495680_0030498 | 3300047322 | Bacteria | 4403 |
| 489 | Ga0495680_0066852 | 3300047322 | Bacteria | 2749 |
| 490 | Ga0495683_0000214 | 3300047323 | Bacteria | 54728 |
| 491 | Ga0495683_0044543 | 3300047323 | Bacteria | 2231 |
| 492 | Ga0495683_0162185 | 3300047323 | Bacteria | 1033 |
| 493 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 494 | Ga0495687_000017 | 3300047443 | Bacteria | 350429 |
| 495 | Ga0495687_007764 | 3300047443 | Bacteria | 6247 |
| 496 | Ga0495675_0010331 | 3300047444 | Bacteria | 5837 |
| 497 | Ga0495675_0045135 | 3300047444 | Bacteria | 2806 |
| 498 | Ga0495675_0047688 | 3300047444 | Bacteria | 2725 |
| 499 | Ga0495675_0049677 | 3300047444 | Bacteria | 2665 |
| 500 | Ga0495677_0000292 | 3300047445 | Bacteria | 21858 |
| 501 | Ga0495677_0000887 | 3300047445 | Bacteria | 12070 |
| 502 | Ga0495677_0001264 | 3300047445 | Bacteria | 10128 |
| 503 | Ga0495677_0004012 | 3300047445 | Bacteria | 5683 |
| 504 | Ga0495677_0004242 | 3300047445 | Bacteria | 5521 |
| 505 | Ga0495679_008925 | 3300047446 | Bacteria | 4043 |
| 506 | Ga0495679_011252 | 3300047446 | Bacteria | 3465 |
| 507 | Ga0495679_024830 | 3300047446 | Bacteria | 2013 |
| 508 | Ga0495685_035140 | 3300047447 | Bacteria | 1722 |
| 509 | Ga0495685_073093 | 3300047447 | Bacteria | 1147 |
| 510 | Ga0495681_0000213 | 3300047470 | Bacteria | 48410 |
| 511 | Ga0495681_0000629 | 3300047470 | Bacteria | 26892 |
| 512 | Ga0495681_0004133 | 3300047470 | Bacteria | 9969 |
| 513 | Ga0495681_0017002 | 3300047470 | Bacteria | 4054 |
| 514 | Ga0495681_0028671 | 3300047470 | Bacteria | 2860 |
| 515 | Ga0495681_0037654 | 3300047470 | Bacteria | 2380 |
| 516 | Ga0495684_0012196 | 3300047471 | Bacteria | 6630 |
| 517 | Ga0495686_0000248 | 3300047472 | Bacteria | 97017 |
| 518 | Ga0495686_0000350 | 3300047472 | Bacteria | 75596 |
| 519 | Ga0495686_0035961 | 3300047472 | Bacteria | 3180 |
| 520 | Ga0495614_0114515 | 3300048089 | Bacteria | 1185 |
| 521 | Ga0495626_0010864 | 3300048091 | Bacteria | 4835 |
| 522 | Ga0495626_0012884 | 3300048091 | Bacteria | 4363 |
| 523 | Ga0495626_0014087 | 3300048091 | Bacteria | 4135 |
| 524 | Ga0495626_0020798 | 3300048091 | Bacteria | 3265 |
| 525 | Ga0495626_0024969 | 3300048091 | Bacteria | 2925 |
| 526 | Ga0495626_0031890 | 3300048091 | Bacteria | 2533 |
| 527 | Ga0495626_0068054 | 3300048091 | Bacteria | 1607 |
| 528 | Ga0495626_0080376 | 3300048091 | Bacteria | 1449 |
| 529 | Ga0496100_0016595 | 3300048903 | Bacteria | 4328 |
| 530 | Ga0496101_0362652 | 3300048904 | Bacteria | 1139 |
| 531 | Ga0496102_0000306 | 3300048905 | Bacteria | 62296 |
| 532 | Ga0496102_0009564 | 3300048905 | Bacteria | 8337 |
| 533 | Ga0496102_0112183 | 3300048905 | Bacteria | 2543 |
| 534 | Ga0496102_0300928 | 3300048905 | Bacteria | 1512 |
| 535 | Ga0496104_0003929 | 3300048907 | Bacteria | 12868 |
| 536 | Ga0496105_0008045 | 3300048908 | Bacteria | 8195 |
| 537 | Ga0496106_0007041 | 3300048909 | Bacteria | 8306 |
| 538 | Ga0496106_0217353 | 3300048909 | Bacteria | 1523 |
| 539 | Ga0496107_0104454 | 3300048910 | Bacteria | 2079 |
| 540 | Ga0496107_0466811 | 3300048910 | Bacteria | 937 |
| 541 | Ga0496108_0001996 | 3300048911 | Bacteria | 16344 |
| 542 | Ga0496109_0003539 | 3300048912 | Bacteria | 13034 |
| 543 | Ga0496110_0000031 | 3300048913 | Bacteria | 67672 |
| 544 | Ga0496110_0144508 | 3300048913 | Bacteria | 2151 |
| 545 | Ga0496110_0256538 | 3300048913 | Bacteria | 1592 |
| 546 | Ga0496110_0842252 | 3300048913 | Bacteria | 822 |
| 547 | Ga0496111_0034738 | 3300048914 | Bacteria | 3601 |
| 548 | Ga0496114_0276929 | 3300048917 | Bacteria | 1479 |
| 549 | Ga0496115_0280358 | 3300048918 | Bacteria | 1368 |
| 550 | Ga0496124_0023019 | 3300048927 | Bacteria | 5699 |
| 551 | Ga0496124_0227281 | 3300048927 | Bacteria | 1398 |
| 552 | Ga0501308_008319 | 3300049128 | Bacteria | 1108 |
| 553 | Ga0495678_000121 | 3300049459 | Bacteria | 91388 |
| 554 | Ga0495678_000371 | 3300049459 | Bacteria | 45956 |
| 555 | Ga0495678_000722 | 3300049459 | Bacteria | 30006 |
| 556 | Ga0495678_001149 | 3300049459 | Bacteria | 21969 |
| 557 | Ga0495678_015016 | 3300049459 | Bacteria | 3580 |
| 558 | Ga0495682_0000155 | 3300049460 | Bacteria | 58368 |
| 559 | Ga0495682_0008564 | 3300049460 | Bacteria | 4024 |
| 560 | Ga0495682_0026482 | 3300049460 | Bacteria | 2152 |
| 561 | Ga0495682_0043757 | 3300049460 | Bacteria | 1639 |
| 562 | Ga0501315_011342 | 3300049531 | Bacteria | 1086 |
| 563 | Ga0501315_012996 | 3300049531 | Bacteria | 1037 |
| 564 | Ga0501033_0274418 | 3300049570 | Bacteria | 1191 |
| 565 | Ga0501036_0256229 | 3300049572 | Bacteria | 1466 |
| 566 | Ga0501038_0372146 | 3300049574 | Bacteria | 1109 |
| 567 | Ga0501039_0317920 | 3300049575 | Bacteria | 1224 |
| 568 | Ga0501039_0419070 | 3300049575 | Bacteria | 1052 |
| 569 | Ga0501068_0026702 | 3300049584 | Bacteria | 3404 |
| 570 | Ga0501069_0025868 | 3300049585 | Bacteria | 3211 |
| 571 | Ga0501071_0021131 | 3300049587 | Bacteria | 4533 |
| 572 | Ga0501071_0085617 | 3300049587 | Bacteria | 2311 |
| 573 | Ga0501072_0131932 | 3300049588 | Bacteria | 1991 |
| 574 | Ga0501073_0004140 | 3300049589 | Bacteria | 10881 |
| 575 | Ga0501074_0147996 | 3300049590 | Bacteria | 1679 |
| 576 | Ga0501076_0078551 | 3300049592 | Bacteria | 2648 |
| 577 | Ga0501077_0000288 | 3300049593 | Bacteria | 29818 |
| 578 | Ga0501229_008742 | 3300049706 | Bacteria | 1268 |
| 579 | Ga0501079_0121060 | 3300049741 | Bacteria | 2035 |
| 580 | Ga0501080_0001913 | 3300049742 | Bacteria | 17955 |
| 581 | Ga0501083_0025178 | 3300049744 | Bacteria | 4120 |
| 582 | Ga0501269_013608 | 3300049766 | Bacteria | 997 |
| 583 | Ga0501283_019817 | 3300049779 | Bacteria | 1067 |
| 584 | nmdc:mga00v17_208130_c1 | 3300050491 | Bacteria | 1265 |
| 585 | nmdc:mga05p37_812439_c1 | 3300050507 | Bacteria | 1021 |
| 586 | nmdc:mga09592_255090_c1 | 3300050508 | Bacteria | 1520 |
| 587 | nmdc:mga0qj67_74741_c1 | 3300050509 | Bacteria | 2708 |
| 588 | nmdc:mga06r32_26525_c1 | 3300050510 | Bacteria | 5403 |
| 589 | nmdc:mga08y16_192886_c1 | 3300050511 | Bacteria | 2113 |
| 590 | nmdc:mga08y16_195630_c1 | 3300050511 | Bacteria | 2096 |
| 591 | nmdc:mga08y16_38519_c1 | 3300050511 | Bacteria | 5020 |
| 592 | Ga0495595_0005439 | 3300053084 | Bacteria | 5155 |
| 593 | Ga0495619_0007281 | 3300053085 | Bacteria | 7007 |
| 594 | Ga0500652_270818 | 3300053131 | Bacteria | 666 |
| 595 | Ga0500589_050561 | 3300053147 | Bacteria | 1929 |
| 596 | Ga0501084_0005439 | 3300054114 | Bacteria | 10446 |
| 597 | Ga0501084_0906055 | 3300054114 | Bacteria | 742 |
| 598 | Ga0501082_0077873 | 3300060353 | Bacteria | 2859 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039062 | Ga0400483_268566 | Ga0400483_268566_40_633 | 188 |
| 2 | 3300053131 | Ga0500652_270818 | Ga0500652_270818_19_612 | 197 |
| 3 | 3300029277 | Ga0311001_1059652 | Ga0311001_10596522 | 198 |
| 4 | 3300046471 | Ga0495650_0000048 | Ga0495650_0000048_65924_66664 | 220 |
| 5 | 3300053147 | Ga0500589_050561 | Ga0500589_050561_1192_1914 | 220 |
| 6 | 3300006178 | Ga0075367_10130353 | Ga0075367_101303532 | 229 |
| 7 | 3300039062 | Ga0400483_057805 | Ga0400483_057805_288_1019 | 229 |
| 8 | 3300049572 | Ga0501036_0256229 | Ga0501036_0256229_258_977 | 229 |
| 9 | 3300049587 | Ga0501071_0085617 | Ga0501071_0085617_1050_1769 | 229 |
| 10 | iso_pu_bacteria | 2643221556 | 2643802216 | 229 |
| 11 | iso_pu_bacteria | 2643221645 | 2644254254 | 229 |
| 12 | iso_pu_bacteria | 2643221684 | 2644475724 | 229 |
| 13 | iso_pu_bacteria | 8047673197 | 8047673926 | 229 |
| 14 | 3300005328 | Ga0070676_10013531 | Ga0070676_100135313 | 230 |
| 15 | 3300005345 | Ga0070692_10189394 | Ga0070692_101893941 | 230 |
| 16 | 3300005353 | Ga0070669_100004842 | Ga0070669_1000048425 | 230 |
| 17 | 3300005356 | Ga0070674_100033150 | Ga0070674_1000331503 | 230 |
| 18 | 3300005444 | Ga0070694_100176390 | Ga0070694_1001763902 | 230 |
| 19 | 3300005459 | Ga0068867_100001711 | Ga0068867_10000171110 | 230 |
| 20 | 3300005545 | Ga0070695_100018431 | Ga0070695_1000184312 | 230 |
| 21 | 3300005546 | Ga0070696_100252591 | Ga0070696_1002525911 | 230 |
| 22 | 3300005718 | Ga0068866_10057609 | Ga0068866_100576093 | 230 |
| 23 | 3300005719 | Ga0068861_100004408 | Ga0068861_1000044086 | 230 |
| 24 | 3300005840 | Ga0068870_10014284 | Ga0068870_100142842 | 230 |
| 25 | 3300005843 | Ga0068860_100501551 | Ga0068860_1005015512 | 230 |
| 26 | 3300005844 | Ga0068862_100008611 | Ga0068862_1000086114 | 230 |
| 27 | 3300006846 | Ga0075430_100089951 | Ga0075430_1000899513 | 230 |
| 28 | 3300006880 | Ga0075429_100080541 | Ga0075429_1000805412 | 230 |
| 29 | 3300006881 | Ga0068865_100015443 | Ga0068865_1000154436 | 230 |
| 30 | 3300009094 | Ga0111539_10063522 | Ga0111539_100635224 | 230 |
| 31 | 3300014326 | Ga0157380_10025234 | Ga0157380_100252343 | 230 |
| 32 | 3300025899 | Ga0207642_10006785 | Ga0207642_100067852 | 230 |
| 33 | 3300025923 | Ga0207681_10002320 | Ga0207681_100023209 | 230 |
| 34 | 3300025937 | Ga0207669_10018487 | Ga0207669_100184874 | 230 |
| 35 | 3300025938 | Ga0207704_10010144 | Ga0207704_100101446 | 230 |
| 36 | 3300025961 | Ga0207712_10014645 | Ga0207712_100146456 | 230 |
| 37 | 3300025972 | Ga0207668_10005071 | Ga0207668_100050715 | 230 |
| 38 | 3300026075 | Ga0207708_10008607 | Ga0207708_100086076 | 230 |
| 39 | 3300026089 | Ga0207648_10002472 | Ga0207648_100024729 | 230 |
| 40 | 3300026118 | Ga0207675_100011252 | Ga0207675_1000112526 | 230 |
| 41 | 3300027395 | Ga0209996_1009199 | Ga0209996_10091992 | 230 |
| 42 | 3300028380 | Ga0268265_10001364 | Ga0268265_100013646 | 230 |
| 43 | 3300031824 | Ga0307413_10238149 | Ga0307413_102381492 | 230 |
| 44 | 3300032002 | Ga0307416_100156662 | Ga0307416_1001566623 | 230 |
| 45 | 3300035115 | Ga0373941_0015192 | Ga0373941_0015192_830_1522 | 230 |
| 46 | 3300035398 | Ga0316574_0494583 | Ga0316574_0494583_25_720 | 230 |
| 47 | 3300046533 | Ga0495640_0110622 | Ga0495640_0110622_698_1390 | 230 |
| 48 | 3300046684 | Ga0495669_0078458 | Ga0495669_0078458_725_1417 | 230 |
| 49 | 3300050508 | nmdc:mga09592_255090_c1 | nmdc:mga09592_255090_c1_213_905 | 230 |
| 50 | 3300050511 | nmdc:mga08y16_192886_c1 | nmdc:mga08y16_192886_c1_41_733 | 230 |
| 51 | 3300005339 | Ga0070660_100227357 | Ga0070660_1002273572 | 231 |
| 52 | 3300005468 | Ga0070707_100235396 | Ga0070707_1002353963 | 231 |
| 53 | 3300005539 | Ga0068853_100468826 | Ga0068853_1004688262 | 231 |
| 54 | 3300005563 | Ga0068855_100000068 | Ga0068855_10000006812 | 231 |
| 55 | 3300005563 | Ga0068855_100023030 | Ga0068855_1000230303 | 231 |
| 56 | 3300006173 | Ga0070716_100233933 | Ga0070716_1002339332 | 231 |
| 57 | 3300006846 | Ga0075430_100033965 | Ga0075430_1000339653 | 231 |
| 58 | 3300013100 | Ga0157373_10157378 | Ga0157373_101573783 | 231 |
| 59 | 3300013104 | Ga0157370_10035249 | Ga0157370_100352494 | 231 |
| 60 | 3300013104 | Ga0157370_10406970 | Ga0157370_104069701 | 231 |
| 61 | 3300013105 | Ga0157369_10315825 | Ga0157369_103158252 | 231 |
| 62 | 3300013105 | Ga0157369_10497438 | Ga0157369_104974382 | 231 |
| 63 | 3300013307 | Ga0157372_10080705 | Ga0157372_100807053 | 231 |
| 64 | 3300025919 | Ga0207657_10006281 | Ga0207657_1000628112 | 231 |
| 65 | 3300025922 | Ga0207646_10113148 | Ga0207646_101131484 | 231 |
| 66 | 3300025939 | Ga0207665_10416579 | Ga0207665_104165792 | 231 |
| 67 | 3300025949 | Ga0207667_10000057 | Ga0207667_1000005716 | 231 |
| 68 | 3300025949 | Ga0207667_10069904 | Ga0207667_100699043 | 231 |
| 69 | 3300031507 | Ga0307509_10000044 | Ga0307509_1000004479 | 231 |
| 70 | 3300033179 | Ga0307507_10234248 | Ga0307507_102342481 | 231 |
| 71 | 3300037312 | Ga0395899_0075913 | Ga0395899_0075913_926_1633 | 231 |
| 72 | 3300037418 | Ga0395900_0244365 | Ga0395900_0244365_773_1480 | 231 |
| 73 | 3300037466 | Ga0395898_0074976 | Ga0395898_0074976_694_1401 | 231 |
| 74 | 3300038443 | Ga0395901_0086487 | Ga0395901_0086487_694_1401 | 231 |
| 75 | 3300046616 | Ga0495668_0254734 | Ga0495668_0254734_141_836 | 231 |
| 76 | 3300047318 | Ga0495636_0049678 | Ga0495636_0049678_644_1339 | 231 |
| 77 | 3300049575 | Ga0501039_0419070 | Ga0501039_0419070_176_871 | 231 |
| 78 | 3300049779 | Ga0501283_019817 | Ga0501283_019817_196_891 | 231 |
| 79 | 3300050509 | nmdc:mga0qj67_74741_c1 | nmdc:mga0qj67_74741_c1_1545_2243 | 231 |
| 80 | 3300054114 | Ga0501084_0906055 | Ga0501084_0906055_27_722 | 231 |
| 81 | 3300003322 | rootL2_10005622 | rootL2_1000562216 | 232 |
| 82 | 3300005293 | Ga0065715_10118230 | Ga0065715_101182302 | 232 |
| 83 | 3300005327 | Ga0070658_10283787 | Ga0070658_102837872 | 232 |
| 84 | 3300005327 | Ga0070658_10755037 | Ga0070658_107550371 | 232 |
| 85 | 3300005328 | Ga0070676_10013004 | Ga0070676_100130043 | 232 |
| 86 | 3300005329 | Ga0070683_100061288 | Ga0070683_1000612884 | 232 |
| 87 | 3300005333 | Ga0070677_10008560 | Ga0070677_100085603 | 232 |
| 88 | 3300005335 | Ga0070666_10277634 | Ga0070666_102776341 | 232 |
| 89 | 3300005339 | Ga0070660_100007080 | Ga0070660_1000070804 | 232 |
| 90 | 3300005339 | Ga0070660_100200778 | Ga0070660_1002007781 | 232 |
| 91 | 3300005340 | Ga0070689_100001052 | Ga0070689_1000010528 | 232 |
| 92 | 3300005343 | Ga0070687_100045158 | Ga0070687_1000451582 | 232 |
| 93 | 3300005344 | Ga0070661_100003142 | Ga0070661_10000314211 | 232 |
| 94 | 3300005344 | Ga0070661_100005513 | Ga0070661_1000055134 | 232 |
| 95 | 3300005344 | Ga0070661_100375385 | Ga0070661_1003753852 | 232 |
| 96 | 3300005347 | Ga0070668_100084928 | Ga0070668_1000849282 | 232 |
| 97 | 3300005353 | Ga0070669_100132044 | Ga0070669_1001320443 | 232 |
| 98 | 3300005354 | Ga0070675_100275506 | Ga0070675_1002755061 | 232 |
| 99 | 3300005355 | Ga0070671_100127427 | Ga0070671_1001274273 | 232 |
| 100 | 3300005355 | Ga0070671_100191106 | Ga0070671_1001911062 | 232 |
| 101 | 3300005356 | Ga0070674_100045586 | Ga0070674_1000455862 | 232 |
| 102 | 3300005364 | Ga0070673_100064782 | Ga0070673_1000647822 | 232 |
| 103 | 3300005365 | Ga0070688_100059715 | Ga0070688_1000597152 | 232 |
| 104 | 3300005366 | Ga0070659_100014092 | Ga0070659_1000140923 | 232 |
| 105 | 3300005366 | Ga0070659_100038200 | Ga0070659_1000382001 | 232 |
| 106 | 3300005366 | Ga0070659_100140829 | Ga0070659_1001408292 | 232 |
| 107 | 3300005455 | Ga0070663_100054860 | Ga0070663_1000548602 | 232 |
| 108 | 3300005455 | Ga0070663_100091278 | Ga0070663_1000912783 | 232 |
| 109 | 3300005457 | Ga0070662_100001925 | Ga0070662_1000019253 | 232 |
| 110 | 3300005457 | Ga0070662_100515639 | Ga0070662_1005156392 | 232 |
| 111 | 3300005458 | Ga0070681_10154428 | Ga0070681_101544282 | 232 |
| 112 | 3300005459 | Ga0068867_100567231 | Ga0068867_1005672311 | 232 |
| 113 | 3300005466 | Ga0070685_10003882 | Ga0070685_100038826 | 232 |
| 114 | 3300005468 | Ga0070707_100294762 | Ga0070707_1002947622 | 232 |
| 115 | 3300005539 | Ga0068853_100014010 | Ga0068853_1000140105 | 232 |
| 116 | 3300005539 | Ga0068853_100015987 | Ga0068853_1000159872 | 232 |
| 117 | 3300005539 | Ga0068853_100090053 | Ga0068853_1000900532 | 232 |
| 118 | 3300005543 | Ga0070672_100132850 | Ga0070672_1001328503 | 232 |
| 119 | 3300005543 | Ga0070672_100209194 | Ga0070672_1002091943 | 232 |
| 120 | 3300005543 | Ga0070672_100209195 | Ga0070672_1002091953 | 232 |
| 121 | 3300005543 | Ga0070672_100613505 | Ga0070672_1006135052 | 232 |
| 122 | 3300005544 | Ga0070686_100042258 | Ga0070686_1000422583 | 232 |
| 123 | 3300005548 | Ga0070665_100016480 | Ga0070665_1000164802 | 232 |
| 124 | 3300005549 | Ga0070704_100081732 | Ga0070704_1000817323 | 232 |
| 125 | 3300005563 | Ga0068855_100008552 | Ga0068855_1000085524 | 232 |
| 126 | 3300005563 | Ga0068855_100346632 | Ga0068855_1003466322 | 232 |
| 127 | 3300005564 | Ga0070664_100028732 | Ga0070664_1000287322 | 232 |
| 128 | 3300005564 | Ga0070664_100131783 | Ga0070664_1001317833 | 232 |
| 129 | 3300005564 | Ga0070664_100407802 | Ga0070664_1004078022 | 232 |
| 130 | 3300005578 | Ga0068854_100045905 | Ga0068854_1000459052 | 232 |
| 131 | 3300005614 | Ga0068856_100000181 | Ga0068856_1000001814 | 232 |
| 132 | 3300005616 | Ga0068852_100102756 | Ga0068852_1001027562 | 232 |
| 133 | 3300005617 | Ga0068859_100020248 | Ga0068859_1000202484 | 232 |
| 134 | 3300005617 | Ga0068859_100432758 | Ga0068859_1004327581 | 232 |
| 135 | 3300005618 | Ga0068864_100010007 | Ga0068864_1000100072 | 232 |
| 136 | 3300005719 | Ga0068861_100222406 | Ga0068861_1002224062 | 232 |
| 137 | 3300005834 | Ga0068851_10033082 | Ga0068851_100330823 | 232 |
| 138 | 3300005840 | Ga0068870_10031964 | Ga0068870_100319643 | 232 |
| 139 | 3300005842 | Ga0068858_100019450 | Ga0068858_1000194507 | 232 |
| 140 | 3300005843 | Ga0068860_100134569 | Ga0068860_1001345692 | 232 |
| 141 | 3300006844 | Ga0075428_100008854 | Ga0075428_1000088549 | 232 |
| 142 | 3300006846 | Ga0075430_100064131 | Ga0075430_1000641312 | 232 |
| 143 | 3300006881 | Ga0068865_100148732 | Ga0068865_1001487323 | 232 |
| 144 | 3300006931 | Ga0097620_100020248 | Ga0097620_1000202486 | 232 |
| 145 | 3300006931 | Ga0097620_100432740 | Ga0097620_1004327403 | 232 |
| 146 | 3300009094 | Ga0111539_10165559 | Ga0111539_101655593 | 232 |
| 147 | 3300009174 | Ga0105241_10432856 | Ga0105241_104328562 | 232 |
| 148 | 3300009545 | Ga0105237_10162351 | Ga0105237_101623512 | 232 |
| 149 | 3300013100 | Ga0157373_10050969 | Ga0157373_100509692 | 232 |
| 150 | 3300013102 | Ga0157371_10036801 | Ga0157371_100368014 | 232 |
| 151 | 3300013105 | Ga0157369_10011852 | Ga0157369_100118523 | 232 |
| 152 | 3300013296 | Ga0157374_10052046 | Ga0157374_100520464 | 232 |
| 153 | 3300013296 | Ga0157374_10854038 | Ga0157374_108540382 | 232 |
| 154 | 3300013297 | Ga0157378_10223429 | Ga0157378_102234291 | 232 |
| 155 | 3300013307 | Ga0157372_10000481 | Ga0157372_1000048135 | 232 |
| 156 | 3300013307 | Ga0157372_10157395 | Ga0157372_101573953 | 232 |
| 157 | 3300013308 | Ga0157375_10124906 | Ga0157375_101249062 | 232 |
| 158 | 3300014325 | Ga0163163_10002938 | Ga0163163_100029385 | 232 |
| 159 | 3300014325 | Ga0163163_10069714 | Ga0163163_100697143 | 232 |
| 160 | 3300014326 | Ga0157380_10048236 | Ga0157380_100482362 | 232 |
| 161 | 3300014745 | Ga0157377_10002681 | Ga0157377_100026814 | 232 |
| 162 | 3300014968 | Ga0157379_10056462 | Ga0157379_100564623 | 232 |
| 163 | 3300014968 | Ga0157379_10062051 | Ga0157379_100620514 | 232 |
| 164 | 3300014969 | Ga0157376_10431472 | Ga0157376_104314721 | 232 |
| 165 | 3300025315 | Ga0207697_10002035 | Ga0207697_100020357 | 232 |
| 166 | 3300025893 | Ga0207682_10008838 | Ga0207682_100088383 | 232 |
| 167 | 3300025901 | Ga0207688_10003028 | Ga0207688_100030287 | 232 |
| 168 | 3300025903 | Ga0207680_10010024 | Ga0207680_100100242 | 232 |
| 169 | 3300025907 | Ga0207645_10004453 | Ga0207645_100044532 | 232 |
| 170 | 3300025907 | Ga0207645_10122646 | Ga0207645_101226462 | 232 |
| 171 | 3300025908 | Ga0207643_10011553 | Ga0207643_100115532 | 232 |
| 172 | 3300025912 | Ga0207707_10208067 | Ga0207707_102080672 | 232 |
| 173 | 3300025914 | Ga0207671_10128332 | Ga0207671_101283322 | 232 |
| 174 | 3300025918 | Ga0207662_10013247 | Ga0207662_100132474 | 232 |
| 175 | 3300025919 | Ga0207657_10020569 | Ga0207657_100205696 | 232 |
| 176 | 3300025919 | Ga0207657_10052623 | Ga0207657_100526232 | 232 |
| 177 | 3300025919 | Ga0207657_10177349 | Ga0207657_101773492 | 232 |
| 178 | 3300025920 | Ga0207649_10007766 | Ga0207649_100077664 | 232 |
| 179 | 3300025921 | Ga0207652_10339136 | Ga0207652_103391361 | 232 |
| 180 | 3300025922 | Ga0207646_10412921 | Ga0207646_104129212 | 232 |
| 181 | 3300025923 | Ga0207681_10067033 | Ga0207681_100670332 | 232 |
| 182 | 3300025925 | Ga0207650_10002733 | Ga0207650_100027331 | 232 |
| 183 | 3300025926 | Ga0207659_10038350 | Ga0207659_100383503 | 232 |
| 184 | 3300025926 | Ga0207659_10124352 | Ga0207659_101243523 | 232 |
| 185 | 3300025931 | Ga0207644_10095849 | Ga0207644_100958493 | 232 |
| 186 | 3300025931 | Ga0207644_10171599 | Ga0207644_101715992 | 232 |
| 187 | 3300025932 | Ga0207690_10002028 | Ga0207690_100020281 | 232 |
| 188 | 3300025933 | Ga0207706_10000074 | Ga0207706_100000745 | 232 |
| 189 | 3300025933 | Ga0207706_10013695 | Ga0207706_100136958 | 232 |
| 190 | 3300025936 | Ga0207670_10010089 | Ga0207670_100100895 | 232 |
| 191 | 3300025940 | Ga0207691_10033608 | Ga0207691_100336084 | 232 |
| 192 | 3300025940 | Ga0207691_10234037 | Ga0207691_102340371 | 232 |
| 193 | 3300025941 | Ga0207711_10068327 | Ga0207711_100683272 | 232 |
| 194 | 3300025942 | Ga0207689_10001435 | Ga0207689_100014357 | 232 |
| 195 | 3300025944 | Ga0207661_10040127 | Ga0207661_100401274 | 232 |
| 196 | 3300025945 | Ga0207679_10023599 | Ga0207679_100235994 | 232 |
| 197 | 3300025945 | Ga0207679_10362461 | Ga0207679_103624611 | 232 |
| 198 | 3300025949 | Ga0207667_10013194 | Ga0207667_100131947 | 232 |
| 199 | 3300025960 | Ga0207651_10407190 | Ga0207651_104071901 | 232 |
| 200 | 3300025961 | Ga0207712_10052763 | Ga0207712_100527632 | 232 |
| 201 | 3300025981 | Ga0207640_10087955 | Ga0207640_100879551 | 232 |
| 202 | 3300025981 | Ga0207640_10204010 | Ga0207640_102040102 | 232 |
| 203 | 3300025986 | Ga0207658_10038153 | Ga0207658_100381532 | 232 |
| 204 | 3300026035 | Ga0207703_10027963 | Ga0207703_100279635 | 232 |
| 205 | 3300026041 | Ga0207639_10001107 | Ga0207639_100011073 | 232 |
| 206 | 3300026067 | Ga0207678_10006227 | Ga0207678_100062278 | 232 |
| 207 | 3300026067 | Ga0207678_10031774 | Ga0207678_100317746 | 232 |
| 208 | 3300026075 | Ga0207708_10049053 | Ga0207708_100490532 | 232 |
| 209 | 3300026078 | Ga0207702_10001390 | Ga0207702_100013904 | 232 |
| 210 | 3300026088 | Ga0207641_10036623 | Ga0207641_100366232 | 232 |
| 211 | 3300026095 | Ga0207676_10001646 | Ga0207676_1000164610 | 232 |
| 212 | 3300026116 | Ga0207674_10000461 | Ga0207674_1000046121 | 232 |
| 213 | 3300026116 | Ga0207674_10336079 | Ga0207674_103360792 | 232 |
| 214 | 3300026142 | Ga0207698_10412173 | Ga0207698_104121732 | 232 |
| 215 | 3300026142 | Ga0207698_10869110 | Ga0207698_108691101 | 232 |
| 216 | 3300027665 | Ga0209983_1005879 | Ga0209983_10058792 | 232 |
| 217 | 3300027671 | Ga0209588_1004244 | Ga0209588_10042447 | 232 |
| 218 | 3300027682 | Ga0209971_1008028 | Ga0209971_10080284 | 232 |
| 219 | 3300027717 | Ga0209998_10008078 | Ga0209998_100080782 | 232 |
| 220 | 3300027876 | Ga0209974_10000467 | Ga0209974_100004674 | 232 |
| 221 | 3300028380 | Ga0268265_10165657 | Ga0268265_101656571 | 232 |
| 222 | 3300028381 | Ga0268264_10153153 | Ga0268264_101531532 | 232 |
| 223 | 3300031548 | Ga0307408_100079604 | Ga0307408_1000796042 | 232 |
| 224 | 3300031616 | Ga0307508_10056909 | Ga0307508_100569094 | 232 |
| 225 | 3300031731 | Ga0307405_10022142 | Ga0307405_100221424 | 232 |
| 226 | 3300031824 | Ga0307413_10004939 | Ga0307413_100049392 | 232 |
| 227 | 3300031852 | Ga0307410_10025025 | Ga0307410_100250253 | 232 |
| 228 | 3300031901 | Ga0307406_10005075 | Ga0307406_100050754 | 232 |
| 229 | 3300031911 | Ga0307412_10011189 | Ga0307412_100111894 | 232 |
| 230 | 3300031995 | Ga0307409_100008454 | Ga0307409_1000084545 | 232 |
| 231 | 3300032002 | Ga0307416_100059194 | Ga0307416_1000591943 | 232 |
| 232 | 3300032005 | Ga0307411_10014724 | Ga0307411_100147244 | 232 |
| 233 | 3300032005 | Ga0307411_10238200 | Ga0307411_102382002 | 232 |
| 234 | 3300032126 | Ga0307415_100008439 | Ga0307415_1000084395 | 232 |
| 235 | 3300035086 | Ga0373934_0000731 | Ga0373934_0000731_3125_3823 | 232 |
| 236 | 3300035111 | Ga0373923_0000489 | Ga0373923_0000489_7541_8239 | 232 |
| 237 | 3300035113 | Ga0373936_0002939 | Ga0373936_0002939_5403_6101 | 232 |
| 238 | 3300035117 | Ga0373953_0138669 | Ga0373953_0138669_23_721 | 232 |
| 239 | 3300035118 | Ga0373954_0000665 | Ga0373954_0000665_962_1660 | 232 |
| 240 | 3300035118 | Ga0373954_0012185 | Ga0373954_0012185_2978_3676 | 232 |
| 241 | 3300035119 | Ga0373956_0006545 | Ga0373956_0006545_571_1269 | 232 |
| 242 | 3300035120 | Ga0373957_0012049 | Ga0373957_0012049_915_1613 | 232 |
| 243 | 3300035170 | Ga0373943_0242081 | Ga0373943_0242081_155_853 | 232 |
| 244 | 3300035171 | Ga0373946_0010964 | Ga0373946_0010964_476_1174 | 232 |
| 245 | 3300035410 | Ga0373924_0023342 | Ga0373924_0023342_1623_2321 | 232 |
| 246 | 3300035692 | Ga0373935_0226082 | Ga0373935_0226082_571_1269 | 232 |
| 247 | 3300035695 | Ga0373927_0020223 | Ga0373927_0020223_3191_3889 | 232 |
| 248 | 3300035695 | Ga0373927_0100850 | Ga0373927_0100850_948_1646 | 232 |
| 249 | 3300035724 | Ga0373933_0013442 | Ga0373933_0013442_393_1091 | 232 |
| 250 | 3300037068 | Ga0373925_0016379 | Ga0373925_0016379_200_898 | 232 |
| 251 | 3300037068 | Ga0373925_0035075 | Ga0373925_0035075_699_1406 | 232 |
| 252 | 3300046454 | Ga0495592_0021952 | Ga0495592_0021952_1355_2053 | 232 |
| 253 | 3300046454 | Ga0495592_0213636 | Ga0495592_0213636_568_1266 | 232 |
| 254 | 3300046461 | Ga0495641_0045813 | Ga0495641_0045813_908_1606 | 232 |
| 255 | 3300046462 | Ga0495651_0034753 | Ga0495651_0034753_974_1672 | 232 |
| 256 | 3300046472 | Ga0495580_0027507 | Ga0495580_0027507_3211_3909 | 232 |
| 257 | 3300046472 | Ga0495580_0103538 | Ga0495580_0103538_694_1392 | 232 |
| 258 | 3300046473 | Ga0495582_0000534 | Ga0495582_0000534_14075_14773 | 232 |
| 259 | 3300046473 | Ga0495582_0194237 | Ga0495582_0194237_228_926 | 232 |
| 260 | 3300046475 | Ga0495639_0006735 | Ga0495639_0006735_1227_1925 | 232 |
| 261 | 3300046477 | Ga0495664_0009228 | Ga0495664_0009228_3854_4552 | 232 |
| 262 | 3300046499 | Ga0495594_0013300 | Ga0495594_0013300_1548_2246 | 232 |
| 263 | 3300046499 | Ga0495594_0078827 | Ga0495594_0078827_346_1044 | 232 |
| 264 | 3300046516 | Ga0495628_0020369 | Ga0495628_0020369_431_1129 | 232 |
| 265 | 3300046517 | Ga0495630_0122796 | Ga0495630_0122796_1257_1955 | 232 |
| 266 | 3300046526 | Ga0495666_0012947 | Ga0495666_0012947_135_833 | 232 |
| 267 | 3300046526 | Ga0495666_0041319 | Ga0495666_0041319_1303_2001 | 232 |
| 268 | 3300046529 | Ga0495652_0041160 | Ga0495652_0041160_17_715 | 232 |
| 269 | 3300046529 | Ga0495652_0057079 | Ga0495652_0057079_633_1331 | 232 |
| 270 | 3300046531 | Ga0495665_0004851 | Ga0495665_0004851_168_866 | 232 |
| 271 | 3300046535 | Ga0495586_0015570 | Ga0495586_0015570_450_1148 | 232 |
| 272 | 3300046536 | Ga0495587_0006076 | Ga0495587_0006076_1639_2337 | 232 |
| 273 | 3300046539 | Ga0495621_0013697 | Ga0495621_0013697_1317_2024 | 232 |
| 274 | 3300046557 | Ga0495622_0257012 | Ga0495622_0257012_22_720 | 232 |
| 275 | 3300046559 | Ga0495667_0006636 | Ga0495667_0006636_1406_2104 | 232 |
| 276 | 3300046559 | Ga0495667_0119177 | Ga0495667_0119177_518_1216 | 232 |
| 277 | 3300046642 | Ga0495634_0004975 | Ga0495634_0004975_3335_4033 | 232 |
| 278 | 3300046642 | Ga0495634_0043743 | Ga0495634_0043743_1175_1873 | 232 |
| 279 | 3300046663 | Ga0495635_0054081 | Ga0495635_0054081_1078_1776 | 232 |
| 280 | 3300046675 | Ga0495657_0003112 | Ga0495657_0003112_5150_5848 | 232 |
| 281 | 3300046678 | Ga0495599_0023512 | Ga0495599_0023512_2990_3688 | 232 |
| 282 | 3300046679 | Ga0495623_0002113 | Ga0495623_0002113_4344_5042 | 232 |
| 283 | 3300046681 | Ga0495647_0010219 | Ga0495647_0010219_392_1090 | 232 |
| 284 | 3300046681 | Ga0495647_0051592 | Ga0495647_0051592_39_746 | 232 |
| 285 | 3300046689 | Ga0495613_0129512 | Ga0495613_0129512_1077_1775 | 232 |
| 286 | 3300046690 | Ga0495624_0147194 | Ga0495624_0147194_33_731 | 232 |
| 287 | 3300046809 | Ga0495600_0036797 | Ga0495600_0036797_1721_2419 | 232 |
| 288 | 3300047315 | Ga0495581_0484655 | Ga0495581_0484655_10_708 | 232 |
| 289 | 3300047317 | Ga0495604_0012212 | Ga0495604_0012212_3909_4607 | 232 |
| 290 | 3300047319 | Ga0495674_0002348 | Ga0495674_0002348_6004_6702 | 232 |
| 291 | 3300047322 | Ga0495680_0030498 | Ga0495680_0030498_2115_2813 | 232 |
| 292 | 3300047322 | Ga0495680_0066852 | Ga0495680_0066852_975_1673 | 232 |
| 293 | 3300047444 | Ga0495675_0045135 | Ga0495675_0045135_108_806 | 232 |
| 294 | 3300047444 | Ga0495675_0047688 | Ga0495675_0047688_859_1557 | 232 |
| 295 | 3300047444 | Ga0495675_0049677 | Ga0495675_0049677_692_1390 | 232 |
| 296 | 3300047471 | Ga0495684_0012196 | Ga0495684_0012196_3713_4411 | 232 |
| 297 | 3300048089 | Ga0495614_0114515 | Ga0495614_0114515_183_881 | 232 |
| 298 | 3300048903 | Ga0496100_0016595 | Ga0496100_0016595_1240_1947 | 232 |
| 299 | 3300048904 | Ga0496101_0362652 | Ga0496101_0362652_338_1045 | 232 |
| 300 | 3300048905 | Ga0496102_0009564 | Ga0496102_0009564_5723_6421 | 232 |
| 301 | 3300048905 | Ga0496102_0112183 | Ga0496102_0112183_1145_1852 | 232 |
| 302 | 3300048907 | Ga0496104_0003929 | Ga0496104_0003929_8193_8900 | 232 |
| 303 | 3300048908 | Ga0496105_0008045 | Ga0496105_0008045_5053_5760 | 232 |
| 304 | 3300048909 | Ga0496106_0007041 | Ga0496106_0007041_3514_4212 | 232 |
| 305 | 3300048909 | Ga0496106_0217353 | Ga0496106_0217353_803_1510 | 232 |
| 306 | 3300048910 | Ga0496107_0104454 | Ga0496107_0104454_1139_1837 | 232 |
| 307 | 3300048910 | Ga0496107_0466811 | Ga0496107_0466811_209_916 | 232 |
| 308 | 3300048911 | Ga0496108_0001996 | Ga0496108_0001996_10101_10808 | 232 |
| 309 | 3300048912 | Ga0496109_0003539 | Ga0496109_0003539_4410_5117 | 232 |
| 310 | 3300048913 | Ga0496110_0144508 | Ga0496110_0144508_962_1660 | 232 |
| 311 | 3300048913 | Ga0496110_0256538 | Ga0496110_0256538_173_874 | 232 |
| 312 | 3300048913 | Ga0496110_0842252 | Ga0496110_0842252_67_774 | 232 |
| 313 | 3300049570 | Ga0501033_0274418 | Ga0501033_0274418_374_1072 | 232 |
| 314 | 3300049574 | Ga0501038_0372146 | Ga0501038_0372146_209_907 | 232 |
| 315 | 3300050507 | nmdc:mga05p37_812439_c1 | nmdc:mga05p37_812439_c1_89_799 | 232 |
| 316 | 3300050510 | nmdc:mga06r32_26525_c1 | nmdc:mga06r32_26525_c1_3472_4170 | 232 |
| 317 | 3300050511 | nmdc:mga08y16_38519_c1 | nmdc:mga08y16_38519_c1_1482_2189 | 232 |
| 318 | 3300053084 | Ga0495595_0005439 | Ga0495595_0005439_3595_4293 | 232 |
| 319 | 3300053085 | Ga0495619_0007281 | Ga0495619_0007281_1406_2104 | 232 |
| 320 | 3300003308 | Ga0006777J48905_1134701 | Ga0006777J48905_11347011 | 233 |
| 321 | 3300003544 | Ga0007417J51691_1028844 | Ga0007417J51691_10288441 | 233 |
| 322 | 3300003574 | Ga0007410J51695_1043264 | Ga0007410J51695_10432641 | 233 |
| 323 | 3300004625 | Ga0055543_1008850 | Ga0055543_10088503 | 233 |
| 324 | 3300005262 | Ga0065165_1000156 | Ga0065165_100015691 | 233 |
| 325 | 3300005262 | Ga0065165_1001173 | Ga0065165_100117314 | 233 |
| 326 | 3300005543 | Ga0070672_100044821 | Ga0070672_1000448211 | 233 |
| 327 | 3300005841 | Ga0068863_100123501 | Ga0068863_1001235012 | 233 |
| 328 | 3300006237 | Ga0097621_100177020 | Ga0097621_1001770202 | 233 |
| 329 | 3300006358 | Ga0068871_100454979 | Ga0068871_1004549791 | 233 |
| 330 | 3300009094 | Ga0111539_10247938 | Ga0111539_102479381 | 233 |
| 331 | 3300013307 | Ga0157372_10225302 | Ga0157372_102253023 | 233 |
| 332 | 3300025254 | Ga0209148_1000280 | Ga0209148_100028040 | 233 |
| 333 | 3300025284 | Ga0209130_1000268 | Ga0209130_100026840 | 233 |
| 334 | 3300025302 | Ga0207426_1007139 | Ga0207426_10071392 | 233 |
| 335 | 3300025898 | Ga0207692_10147638 | Ga0207692_101476381 | 233 |
| 336 | 3300025940 | Ga0207691_10076932 | Ga0207691_100769321 | 233 |
| 337 | 3300025960 | Ga0207651_10032167 | Ga0207651_100321674 | 233 |
| 338 | 3300026088 | Ga0207641_10090036 | Ga0207641_100900361 | 233 |
| 339 | 3300035120 | Ga0373957_0108248 | Ga0373957_0108248_301_1002 | 233 |
| 340 | 3300036401 | Ga0373937_0128403 | Ga0373937_0128403_247_948 | 233 |
| 341 | 3300037312 | Ga0395899_0150009 | Ga0395899_0150009_520_1221 | 233 |
| 342 | 3300037418 | Ga0395900_0000297 | Ga0395900_0000297_24722_25468 | 233 |
| 343 | 3300037418 | Ga0395900_0080416 | Ga0395900_0080416_2379_3080 | 233 |
| 344 | 3300037471 | Ga0395905_0127754 | Ga0395905_0127754_51_752 | 233 |
| 345 | 3300037471 | Ga0395905_0563293 | Ga0395905_0563293_150_851 | 233 |
| 346 | 3300046452 | Ga0495617_000039 | Ga0495617_000039_40389_41090 | 233 |
| 347 | 3300046453 | Ga0495627_000303 | Ga0495627_000303_24629_25330 | 233 |
| 348 | 3300046453 | Ga0495627_004164 | Ga0495627_004164_892_1593 | 233 |
| 349 | 3300046453 | Ga0495627_101361 | Ga0495627_101361_58_759 | 233 |
| 350 | 3300046457 | Ga0495590_0000018 | Ga0495590_0000018_29729_30430 | 233 |
| 351 | 3300046457 | Ga0495590_0014881 | Ga0495590_0014881_1500_2201 | 233 |
| 352 | 3300046458 | Ga0495591_000134 | Ga0495591_000134_27001_27702 | 233 |
| 353 | 3300046460 | Ga0495638_0014015 | Ga0495638_0014015_666_1367 | 233 |
| 354 | 3300046460 | Ga0495638_0078208 | Ga0495638_0078208_157_858 | 233 |
| 355 | 3300046463 | Ga0495653_0079220 | Ga0495653_0079220_251_1078 | 233 |
| 356 | 3300046471 | Ga0495650_0111221 | Ga0495650_0111221_148_849 | 233 |
| 357 | 3300046473 | Ga0495582_0033767 | Ga0495582_0033767_1825_2526 | 233 |
| 358 | 3300046474 | Ga0495605_0001258 | Ga0495605_0001258_2394_3095 | 233 |
| 359 | 3300046474 | Ga0495605_0001847 | Ga0495605_0001847_9247_9948 | 233 |
| 360 | 3300046474 | Ga0495605_0014011 | Ga0495605_0014011_2088_2789 | 233 |
| 361 | 3300046474 | Ga0495605_0032164 | Ga0495605_0032164_1672_2373 | 233 |
| 362 | 3300046491 | Ga0495584_0000243 | Ga0495584_0000243_29186_29887 | 233 |
| 363 | 3300046491 | Ga0495584_0004813 | Ga0495584_0004813_243_944 | 233 |
| 364 | 3300046491 | Ga0495584_0012074 | Ga0495584_0012074_633_1334 | 233 |
| 365 | 3300046491 | Ga0495584_0025191 | Ga0495584_0025191_680_1381 | 233 |
| 366 | 3300046491 | Ga0495584_0084103 | Ga0495584_0084103_716_1417 | 233 |
| 367 | 3300046491 | Ga0495584_0204916 | Ga0495584_0204916_27_728 | 233 |
| 368 | 3300046492 | Ga0495585_0004757 | Ga0495585_0004757_6963_7664 | 233 |
| 369 | 3300046492 | Ga0495585_0034364 | Ga0495585_0034364_990_1691 | 233 |
| 370 | 3300046492 | Ga0495585_0038865 | Ga0495585_0038865_1808_2509 | 233 |
| 371 | 3300046492 | Ga0495585_0049092 | Ga0495585_0049092_994_1695 | 233 |
| 372 | 3300046492 | Ga0495585_0055116 | Ga0495585_0055116_828_1529 | 233 |
| 373 | 3300046499 | Ga0495594_0004358 | Ga0495594_0004358_5699_6400 | 233 |
| 374 | 3300046499 | Ga0495594_0028902 | Ga0495594_0028902_1648_2349 | 233 |
| 375 | 3300046499 | Ga0495594_0085781 | Ga0495594_0085781_936_1658 | 233 |
| 376 | 3300046500 | Ga0495596_0015492 | Ga0495596_0015492_81_782 | 233 |
| 377 | 3300046500 | Ga0495596_0021676 | Ga0495596_0021676_1681_2382 | 233 |
| 378 | 3300046500 | Ga0495596_0022501 | Ga0495596_0022501_1196_1897 | 233 |
| 379 | 3300046500 | Ga0495596_0024640 | Ga0495596_0024640_1520_2221 | 233 |
| 380 | 3300046500 | Ga0495596_0028461 | Ga0495596_0028461_1345_2046 | 233 |
| 381 | 3300046500 | Ga0495596_0033331 | Ga0495596_0033331_459_1160 | 233 |
| 382 | 3300046500 | Ga0495596_0099100 | Ga0495596_0099100_383_1084 | 233 |
| 383 | 3300046501 | Ga0495607_0001206 | Ga0495607_0001206_12743_13444 | 233 |
| 384 | 3300046501 | Ga0495607_0001465 | Ga0495607_0001465_10007_10708 | 233 |
| 385 | 3300046501 | Ga0495607_0047107 | Ga0495607_0047107_1343_2044 | 233 |
| 386 | 3300046501 | Ga0495607_0050603 | Ga0495607_0050603_833_1534 | 233 |
| 387 | 3300046501 | Ga0495607_0052716 | Ga0495607_0052716_660_1361 | 233 |
| 388 | 3300046501 | Ga0495607_0171275 | Ga0495607_0171275_261_962 | 233 |
| 389 | 3300046506 | Ga0495583_0000377 | Ga0495583_0000377_9305_10006 | 233 |
| 390 | 3300046506 | Ga0495583_0001102 | Ga0495583_0001102_10918_11619 | 233 |
| 391 | 3300046506 | Ga0495583_0013112 | Ga0495583_0013112_93_794 | 233 |
| 392 | 3300046506 | Ga0495583_0029758 | Ga0495583_0029758_1578_2279 | 233 |
| 393 | 3300046506 | Ga0495583_0041668 | Ga0495583_0041668_1388_2089 | 233 |
| 394 | 3300046506 | Ga0495583_0044111 | Ga0495583_0044111_304_1122 | 233 |
| 395 | 3300046507 | Ga0495606_0020046 | Ga0495606_0020046_359_1060 | 233 |
| 396 | 3300046507 | Ga0495606_0101758 | Ga0495606_0101758_110_811 | 233 |
| 397 | 3300046507 | Ga0495606_0108041 | Ga0495606_0108041_288_989 | 233 |
| 398 | 3300046512 | Ga0495610_0000147 | Ga0495610_0000147_33733_34434 | 233 |
| 399 | 3300046513 | Ga0495616_0000175 | Ga0495616_0000175_32186_32989 | 233 |
| 400 | 3300046513 | Ga0495616_0004688 | Ga0495616_0004688_7841_8542 | 233 |
| 401 | 3300046513 | Ga0495616_0005403 | Ga0495616_0005403_6769_7515 | 233 |
| 402 | 3300046513 | Ga0495616_0016092 | Ga0495616_0016092_1469_2170 | 233 |
| 403 | 3300046513 | Ga0495616_0045377 | Ga0495616_0045377_1475_2176 | 233 |
| 404 | 3300046513 | Ga0495616_0048260 | Ga0495616_0048260_1308_2009 | 233 |
| 405 | 3300046513 | Ga0495616_0053522 | Ga0495616_0053522_276_1127 | 233 |
| 406 | 3300046518 | Ga0495631_0000028 | Ga0495631_0000028_62095_62796 | 233 |
| 407 | 3300046518 | Ga0495631_0001122 | Ga0495631_0001122_11407_12108 | 233 |
| 408 | 3300046518 | Ga0495631_0008662 | Ga0495631_0008662_2825_3526 | 233 |
| 409 | 3300046518 | Ga0495631_0009878 | Ga0495631_0009878_2436_3239 | 233 |
| 410 | 3300046518 | Ga0495631_0014639 | Ga0495631_0014639_1508_2209 | 233 |
| 411 | 3300046518 | Ga0495631_0017486 | Ga0495631_0017486_1661_2362 | 233 |
| 412 | 3300046518 | Ga0495631_0022437 | Ga0495631_0022437_2090_2791 | 233 |
| 413 | 3300046518 | Ga0495631_0074151 | Ga0495631_0074151_417_1118 | 233 |
| 414 | 3300046519 | Ga0495632_0000267 | Ga0495632_0000267_23393_24094 | 233 |
| 415 | 3300046519 | Ga0495632_0000684 | Ga0495632_0000684_5138_5839 | 233 |
| 416 | 3300046519 | Ga0495632_0003767 | Ga0495632_0003767_407_1153 | 233 |
| 417 | 3300046519 | Ga0495632_0006115 | Ga0495632_0006115_1149_1850 | 233 |
| 418 | 3300046519 | Ga0495632_0015831 | Ga0495632_0015831_1642_2343 | 233 |
| 419 | 3300046519 | Ga0495632_0018018 | Ga0495632_0018018_2954_3658 | 233 |
| 420 | 3300046519 | Ga0495632_0018226 | Ga0495632_0018226_1978_2679 | 233 |
| 421 | 3300046519 | Ga0495632_0041634 | Ga0495632_0041634_31_732 | 233 |
| 422 | 3300046520 | Ga0495637_0000004 | Ga0495637_0000004_424131_424832 | 233 |
| 423 | 3300046522 | Ga0495643_0001557 | Ga0495643_0001557_7811_8557 | 233 |
| 424 | 3300046522 | Ga0495643_0014626 | Ga0495643_0014626_1112_1813 | 233 |
| 425 | 3300046522 | Ga0495643_0069576 | Ga0495643_0069576_624_1325 | 233 |
| 426 | 3300046523 | Ga0495644_0001291 | Ga0495644_0001291_7524_8225 | 233 |
| 427 | 3300046523 | Ga0495644_0002623 | Ga0495644_0002623_2228_2929 | 233 |
| 428 | 3300046523 | Ga0495644_0008124 | Ga0495644_0008124_1108_1809 | 233 |
| 429 | 3300046523 | Ga0495644_0015220 | Ga0495644_0015220_780_1481 | 233 |
| 430 | 3300046523 | Ga0495644_0023219 | Ga0495644_0023219_292_993 | 233 |
| 431 | 3300046524 | Ga0495648_0011379 | Ga0495648_0011379_2753_3454 | 233 |
| 432 | 3300046524 | Ga0495648_0014105 | Ga0495648_0014105_1672_2373 | 233 |
| 433 | 3300046524 | Ga0495648_0026581 | Ga0495648_0026581_1000_1701 | 233 |
| 434 | 3300046524 | Ga0495648_0070625 | Ga0495648_0070625_937_1638 | 233 |
| 435 | 3300046526 | Ga0495666_0007773 | Ga0495666_0007773_2333_3034 | 233 |
| 436 | 3300046528 | Ga0495642_0000081 | Ga0495642_0000081_41635_42336 | 233 |
| 437 | 3300046528 | Ga0495642_0001200 | Ga0495642_0001200_9380_10081 | 233 |
| 438 | 3300046528 | Ga0495642_0014072 | Ga0495642_0014072_730_1431 | 233 |
| 439 | 3300046528 | Ga0495642_0040548 | Ga0495642_0040548_443_1144 | 233 |
| 440 | 3300046528 | Ga0495642_0042669 | Ga0495642_0042669_1051_1752 | 233 |
| 441 | 3300046530 | Ga0495654_0007829 | Ga0495654_0007829_4838_5539 | 233 |
| 442 | 3300046530 | Ga0495654_0053124 | Ga0495654_0053124_415_1116 | 233 |
| 443 | 3300046533 | Ga0495640_0379882 | Ga0495640_0379882_153_854 | 233 |
| 444 | 3300046538 | Ga0495609_0006889 | Ga0495609_0006889_1744_2445 | 233 |
| 445 | 3300046538 | Ga0495609_0008883 | Ga0495609_0008883_4040_4741 | 233 |
| 446 | 3300046538 | Ga0495609_0015800 | Ga0495609_0015800_1009_1860 | 233 |
| 447 | 3300046538 | Ga0495609_0016598 | Ga0495609_0016598_269_970 | 233 |
| 448 | 3300046538 | Ga0495609_0031754 | Ga0495609_0031754_1686_2387 | 233 |
| 449 | 3300046538 | Ga0495609_0093622 | Ga0495609_0093622_289_990 | 233 |
| 450 | 3300046538 | Ga0495609_0128119 | Ga0495609_0128119_151_852 | 233 |
| 451 | 3300046542 | Ga0495597_0000187 | Ga0495597_0000187_42648_43349 | 233 |
| 452 | 3300046542 | Ga0495597_0000404 | Ga0495597_0000404_23392_24195 | 233 |
| 453 | 3300046542 | Ga0495597_0002432 | Ga0495597_0002432_2864_3565 | 233 |
| 454 | 3300046542 | Ga0495597_0028870 | Ga0495597_0028870_691_1509 | 233 |
| 455 | 3300046542 | Ga0495597_0031584 | Ga0495597_0031584_1037_1738 | 233 |
| 456 | 3300046542 | Ga0495597_0044231 | Ga0495597_0044231_322_1023 | 233 |
| 457 | 3300046542 | Ga0495597_0092019 | Ga0495597_0092019_421_1122 | 233 |
| 458 | 3300046557 | Ga0495622_0049992 | Ga0495622_0049992_256_957 | 233 |
| 459 | 3300046558 | Ga0495633_0001359 | Ga0495633_0001359_13269_13970 | 233 |
| 460 | 3300046558 | Ga0495633_0009075 | Ga0495633_0009075_3215_3928 | 233 |
| 461 | 3300046558 | Ga0495633_0019652 | Ga0495633_0019652_1759_2460 | 233 |
| 462 | 3300046558 | Ga0495633_0051380 | Ga0495633_0051380_25_726 | 233 |
| 463 | 3300046615 | Ga0495656_0040782 | Ga0495656_0040782_946_1647 | 233 |
| 464 | 3300046615 | Ga0495656_0117989 | Ga0495656_0117989_106_807 | 233 |
| 465 | 3300046615 | Ga0495656_0138753 | Ga0495656_0138753_53_754 | 233 |
| 466 | 3300046616 | Ga0495668_0000603 | Ga0495668_0000603_3326_4027 | 233 |
| 467 | 3300046616 | Ga0495668_0001327 | Ga0495668_0001327_22045_22746 | 233 |
| 468 | 3300046616 | Ga0495668_0003472 | Ga0495668_0003472_2394_3095 | 233 |
| 469 | 3300046616 | Ga0495668_0008015 | Ga0495668_0008015_661_1362 | 233 |
| 470 | 3300046616 | Ga0495668_0023093 | Ga0495668_0023093_1266_1967 | 233 |
| 471 | 3300046616 | Ga0495668_0025211 | Ga0495668_0025211_2030_2731 | 233 |
| 472 | 3300046616 | Ga0495668_0025226 | Ga0495668_0025226_1144_1845 | 233 |
| 473 | 3300046616 | Ga0495668_0049134 | Ga0495668_0049134_967_1668 | 233 |
| 474 | 3300046616 | Ga0495668_0107029 | Ga0495668_0107029_361_1062 | 233 |
| 475 | 3300046616 | Ga0495668_0110488 | Ga0495668_0110488_567_1268 | 233 |
| 476 | 3300046616 | Ga0495668_0165995 | Ga0495668_0165995_304_1005 | 233 |
| 477 | 3300046648 | Ga0495611_0001261 | Ga0495611_0001261_6288_6989 | 233 |
| 478 | 3300046648 | Ga0495611_0002381 | Ga0495611_0002381_4934_5635 | 233 |
| 479 | 3300046648 | Ga0495611_0032033 | Ga0495611_0032033_28_729 | 233 |
| 480 | 3300046660 | Ga0495625_0019644 | Ga0495625_0019644_1686_2387 | 233 |
| 481 | 3300046660 | Ga0495625_0063631 | Ga0495625_0063631_770_1471 | 233 |
| 482 | 3300046660 | Ga0495625_0096352 | Ga0495625_0096352_1303_2004 | 233 |
| 483 | 3300046660 | Ga0495625_0141008 | Ga0495625_0141008_178_1029 | 233 |
| 484 | 3300046663 | Ga0495635_0081969 | Ga0495635_0081969_214_1041 | 233 |
| 485 | 3300046665 | Ga0495661_0003069 | Ga0495661_0003069_7208_7954 | 233 |
| 486 | 3300046665 | Ga0495661_0003405 | Ga0495661_0003405_3026_3727 | 233 |
| 487 | 3300046665 | Ga0495661_0007004 | Ga0495661_0007004_5582_6295 | 233 |
| 488 | 3300046665 | Ga0495661_0019568 | Ga0495661_0019568_1864_2565 | 233 |
| 489 | 3300046665 | Ga0495661_0034655 | Ga0495661_0034655_1393_2094 | 233 |
| 490 | 3300046665 | Ga0495661_0066800 | Ga0495661_0066800_255_956 | 233 |
| 491 | 3300046674 | Ga0495588_0004759 | Ga0495588_0004759_4384_5085 | 233 |
| 492 | 3300046674 | Ga0495588_0005321 | Ga0495588_0005321_3022_3723 | 233 |
| 493 | 3300046674 | Ga0495588_0022699 | Ga0495588_0022699_940_1641 | 233 |
| 494 | 3300046674 | Ga0495588_0143479 | Ga0495588_0143479_471_1172 | 233 |
| 495 | 3300046684 | Ga0495669_0000174 | Ga0495669_0000174_12786_13487 | 233 |
| 496 | 3300046684 | Ga0495669_0002474 | Ga0495669_0002474_3435_4136 | 233 |
| 497 | 3300046684 | Ga0495669_0004825 | Ga0495669_0004825_1537_2238 | 233 |
| 498 | 3300046684 | Ga0495669_0007519 | Ga0495669_0007519_2324_3025 | 233 |
| 499 | 3300046684 | Ga0495669_0017305 | Ga0495669_0017305_1032_1733 | 233 |
| 500 | 3300046684 | Ga0495669_0025169 | Ga0495669_0025169_28_729 | 233 |
| 501 | 3300046684 | Ga0495669_0056497 | Ga0495669_0056497_912_1613 | 233 |
| 502 | 3300046691 | Ga0495670_0001204 | Ga0495670_0001204_6492_7205 | 233 |
| 503 | 3300046691 | Ga0495670_0017542 | Ga0495670_0017542_526_1227 | 233 |
| 504 | 3300046691 | Ga0495670_0058698 | Ga0495670_0058698_1114_1815 | 233 |
| 505 | 3300046692 | Ga0495671_0000338 | Ga0495671_0000338_15944_16645 | 233 |
| 506 | 3300046692 | Ga0495671_0000846 | Ga0495671_0000846_16195_16896 | 233 |
| 507 | 3300046692 | Ga0495671_0016291 | Ga0495671_0016291_2218_2919 | 233 |
| 508 | 3300046692 | Ga0495671_0240164 | Ga0495671_0240164_116_817 | 233 |
| 509 | 3300046694 | Ga0495649_0000355 | Ga0495649_0000355_6503_7204 | 233 |
| 510 | 3300046694 | Ga0495649_0003389 | Ga0495649_0003389_6181_6882 | 233 |
| 511 | 3300046694 | Ga0495649_0022143 | Ga0495649_0022143_2034_2735 | 233 |
| 512 | 3300046694 | Ga0495649_0068786 | Ga0495649_0068786_600_1301 | 233 |
| 513 | 3300046694 | Ga0495649_0143406 | Ga0495649_0143406_84_785 | 233 |
| 514 | 3300046794 | Ga0495589_0000441 | Ga0495589_0000441_5493_6194 | 233 |
| 515 | 3300046794 | Ga0495589_0000813 | Ga0495589_0000813_10156_10857 | 233 |
| 516 | 3300046794 | Ga0495589_0002969 | Ga0495589_0002969_5049_5750 | 233 |
| 517 | 3300046794 | Ga0495589_0009670 | Ga0495589_0009670_2068_2919 | 233 |
| 518 | 3300046794 | Ga0495589_0015895 | Ga0495589_0015895_2823_3524 | 233 |
| 519 | 3300046794 | Ga0495589_0017623 | Ga0495589_0017623_1864_2565 | 233 |
| 520 | 3300046810 | Ga0495660_0001242 | Ga0495660_0001242_10403_11104 | 233 |
| 521 | 3300046810 | Ga0495660_0054162 | Ga0495660_0054162_1032_1733 | 233 |
| 522 | 3300046810 | Ga0495660_0056767 | Ga0495660_0056767_336_1037 | 233 |
| 523 | 3300046810 | Ga0495660_0089629 | Ga0495660_0089629_77_778 | 233 |
| 524 | 3300047315 | Ga0495581_0392117 | Ga0495581_0392117_28_783 | 233 |
| 525 | 3300047317 | Ga0495604_0108536 | Ga0495604_0108536_157_858 | 233 |
| 526 | 3300047318 | Ga0495636_0010339 | Ga0495636_0010339_2973_3674 | 233 |
| 527 | 3300047320 | Ga0495672_0000126 | Ga0495672_0000126_68509_69210 | 233 |
| 528 | 3300047320 | Ga0495672_0056639 | Ga0495672_0056639_1370_2221 | 233 |
| 529 | 3300047321 | Ga0495676_0000047 | Ga0495676_0000047_78541_79242 | 233 |
| 530 | 3300047322 | Ga0495680_0007593 | Ga0495680_0007593_233_1060 | 233 |
| 531 | 3300047323 | Ga0495683_0000214 | Ga0495683_0000214_21570_22271 | 233 |
| 532 | 3300047323 | Ga0495683_0044543 | Ga0495683_0044543_276_977 | 233 |
| 533 | 3300047323 | Ga0495683_0162185 | Ga0495683_0162185_119_820 | 233 |
| 534 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_1024725_1025426 | 233 |
| 535 | 3300047443 | Ga0495687_000017 | Ga0495687_000017_26698_27399 | 233 |
| 536 | 3300047443 | Ga0495687_007764 | Ga0495687_007764_2393_3094 | 233 |
| 537 | 3300047444 | Ga0495675_0010331 | Ga0495675_0010331_3828_4655 | 233 |
| 538 | 3300047445 | Ga0495677_0000292 | Ga0495677_0000292_13812_14591 | 233 |
| 539 | 3300047445 | Ga0495677_0000887 | Ga0495677_0000887_9037_9738 | 233 |
| 540 | 3300047445 | Ga0495677_0001264 | Ga0495677_0001264_2475_3221 | 233 |
| 541 | 3300047445 | Ga0495677_0004012 | Ga0495677_0004012_2682_3383 | 233 |
| 542 | 3300047445 | Ga0495677_0004242 | Ga0495677_0004242_1461_2162 | 233 |
| 543 | 3300047446 | Ga0495679_008925 | Ga0495679_008925_2615_3316 | 233 |
| 544 | 3300047446 | Ga0495679_011252 | Ga0495679_011252_541_1242 | 233 |
| 545 | 3300047446 | Ga0495679_024830 | Ga0495679_024830_1131_1832 | 233 |
| 546 | 3300047447 | Ga0495685_035140 | Ga0495685_035140_975_1676 | 233 |
| 547 | 3300047447 | Ga0495685_073093 | Ga0495685_073093_325_1026 | 233 |
| 548 | 3300047470 | Ga0495681_0000213 | Ga0495681_0000213_11344_12045 | 233 |
| 549 | 3300047470 | Ga0495681_0000629 | Ga0495681_0000629_2912_3613 | 233 |
| 550 | 3300047470 | Ga0495681_0004133 | Ga0495681_0004133_3607_4308 | 233 |
| 551 | 3300047470 | Ga0495681_0017002 | Ga0495681_0017002_1864_2565 | 233 |
| 552 | 3300047470 | Ga0495681_0028671 | Ga0495681_0028671_691_1392 | 233 |
| 553 | 3300047470 | Ga0495681_0037654 | Ga0495681_0037654_280_981 | 233 |
| 554 | 3300047472 | Ga0495686_0000248 | Ga0495686_0000248_38854_39555 | 233 |
| 555 | 3300047472 | Ga0495686_0000350 | Ga0495686_0000350_2431_3132 | 233 |
| 556 | 3300047472 | Ga0495686_0035961 | Ga0495686_0035961_1546_2247 | 233 |
| 557 | 3300048091 | Ga0495626_0010864 | Ga0495626_0010864_447_1148 | 233 |
| 558 | 3300048091 | Ga0495626_0012884 | Ga0495626_0012884_3382_4128 | 233 |
| 559 | 3300048091 | Ga0495626_0014087 | Ga0495626_0014087_1469_2170 | 233 |
| 560 | 3300048091 | Ga0495626_0020798 | Ga0495626_0020798_977_1678 | 233 |
| 561 | 3300048091 | Ga0495626_0024969 | Ga0495626_0024969_2161_2862 | 233 |
| 562 | 3300048091 | Ga0495626_0031890 | Ga0495626_0031890_1379_2080 | 233 |
| 563 | 3300048091 | Ga0495626_0068054 | Ga0495626_0068054_703_1404 | 233 |
| 564 | 3300048091 | Ga0495626_0080376 | Ga0495626_0080376_271_972 | 233 |
| 565 | 3300048905 | Ga0496102_0000306 | Ga0496102_0000306_36033_36734 | 233 |
| 566 | 3300048905 | Ga0496102_0300928 | Ga0496102_0300928_565_1266 | 233 |
| 567 | 3300048913 | Ga0496110_0000031 | Ga0496110_0000031_61201_61902 | 233 |
| 568 | 3300048914 | Ga0496111_0034738 | Ga0496111_0034738_1072_1773 | 233 |
| 569 | 3300048917 | Ga0496114_0276929 | Ga0496114_0276929_187_894 | 233 |
| 570 | 3300048918 | Ga0496115_0280358 | Ga0496115_0280358_514_1215 | 233 |
| 571 | 3300048927 | Ga0496124_0023019 | Ga0496124_0023019_4114_4875 | 233 |
| 572 | 3300048927 | Ga0496124_0227281 | Ga0496124_0227281_522_1223 | 233 |
| 573 | 3300049128 | Ga0501308_008319 | Ga0501308_008319_334_1035 | 233 |
| 574 | 3300049459 | Ga0495678_000121 | Ga0495678_000121_88815_89516 | 233 |
| 575 | 3300049459 | Ga0495678_000371 | Ga0495678_000371_22179_22880 | 233 |
| 576 | 3300049459 | Ga0495678_000722 | Ga0495678_000722_27720_28421 | 233 |
| 577 | 3300049459 | Ga0495678_001149 | Ga0495678_001149_3291_3992 | 233 |
| 578 | 3300049459 | Ga0495678_015016 | Ga0495678_015016_1356_2057 | 233 |
| 579 | 3300049460 | Ga0495682_0000155 | Ga0495682_0000155_27997_28698 | 233 |
| 580 | 3300049460 | Ga0495682_0008564 | Ga0495682_0008564_1624_2325 | 233 |
| 581 | 3300049460 | Ga0495682_0026482 | Ga0495682_0026482_1273_1974 | 233 |
| 582 | 3300049460 | Ga0495682_0043757 | Ga0495682_0043757_868_1569 | 233 |
| 583 | 3300049531 | Ga0501315_011342 | Ga0501315_011342_42_743 | 233 |
| 584 | 3300049531 | Ga0501315_012996 | Ga0501315_012996_69_770 | 233 |
| 585 | 3300049575 | Ga0501039_0317920 | Ga0501039_0317920_46_747 | 233 |
| 586 | 3300049584 | Ga0501068_0026702 | Ga0501068_0026702_2061_2762 | 233 |
| 587 | 3300049585 | Ga0501069_0025868 | Ga0501069_0025868_1473_2174 | 233 |
| 588 | 3300049587 | Ga0501071_0021131 | Ga0501071_0021131_1316_2017 | 233 |
| 589 | 3300049588 | Ga0501072_0131932 | Ga0501072_0131932_1061_1762 | 233 |
| 590 | 3300049589 | Ga0501073_0004140 | Ga0501073_0004140_1698_2399 | 233 |
| 591 | 3300049590 | Ga0501074_0147996 | Ga0501074_0147996_888_1589 | 233 |
| 592 | 3300049592 | Ga0501076_0078551 | Ga0501076_0078551_190_891 | 233 |
| 593 | 3300049593 | Ga0501077_0000288 | Ga0501077_0000288_4336_5037 | 233 |
| 594 | 3300049706 | Ga0501229_008742 | Ga0501229_008742_303_1004 | 233 |
| 595 | 3300049741 | Ga0501079_0121060 | Ga0501079_0121060_1315_2016 | 233 |
| 596 | 3300049742 | Ga0501080_0001913 | Ga0501080_0001913_16888_17589 | 233 |
| 597 | 3300049744 | Ga0501083_0025178 | Ga0501083_0025178_178_879 | 233 |
| 598 | 3300049766 | Ga0501269_013608 | Ga0501269_013608_213_914 | 233 |
| 599 | 3300050491 | nmdc:mga00v17_208130_c1 | nmdc:mga00v17_208130_c1_386_1087 | 233 |
| 600 | 3300050511 | nmdc:mga08y16_195630_c1 | nmdc:mga08y16_195630_c1_956_1666 | 233 |
| 601 | 3300054114 | Ga0501084_0005439 | Ga0501084_0005439_4287_4988 | 233 |
| 602 | 3300060353 | Ga0501082_0077873 | Ga0501082_0077873_1153_1854 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9713 | 1 | 231 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9667 | 1 | 231 |
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9549 | 1 | 231 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9544 | 1 | 231 |
| 2b8m-assembly1.cif.gz_A-2 | crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution | 0.841 | 34 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9707 | 11 | 134 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9696 | 13 | 130 | 2.60.120.10 |
| af_P46852_133_231_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9668 | 142 | 231 | 2.60.120.10 |
| 1tq5A01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9666 | 141 | 231 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9628 | 11 | 134 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A7HDG4-F1-model_v4 | Pirin domain protein | 0.9904 | 1 | 230 |
|
| AF-A0A0K3A9X6-F1-model_v4 | Quercetin 2,3-dioxygenase | 0.9896 | 63 | 232 |
|
| AF-A0A2H1PM95-F1-model_v4 | deleted | 0.9886 | 1 | 182 |
|
| AF-A0A353HYM2-F1-model_v4 | Quercetin 2,3-dioxygenase | 0.9882 | 1 | 207 |
GO:0046872
GO:0051213 |
| AF-A0A2N2S029-F1-model_v4 | Quercetin 2,3-dioxygenase | 0.987 | 1 | 231 |
GO:0046872
GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar