F468205

General Info

Members Datasets Scaffolds Average Seq Length
602 311 598 234

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0053522|Ga0495616_0053522_276_1127
Length 283
Sequence LAASYCARFIGQALQNLIEFFDHRPQNYSFFLPSPSRYTGLHRENNKERIMLEVRKSEERGQAHHGWLQSQHSFSFADYYDPRHVGYGPLRVINEDRVAPGGGFGTHGHRDMEIISYVLDGALEHKDSMGTGSVLHYGDVQRMSAGSGVRHSEFNGSKTDPVHFLQIWIQPNQQGIAPSYEEKHFPLEDKQGKLRLIASGDGREGSVLIHQDASLYAAILDGDDGAEHTLGAGRLGYVHVIRGQVEVNGVALKGGDAVKIEEEDHVRFTGAKAVELLLFDLPQ

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
206 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
279 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
280 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
298 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.16
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 3.49
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006777J48905_1134701 3300003308 Bacteria 800
2 rootL2_10005622 3300003322 Bacteria 27902
3 Ga0007417J51691_1028844 3300003544 Bacteria 839
4 Ga0007410J51695_1043264 3300003574 Bacteria 828
5 Ga0055543_1008850 3300004625 Bacteria 2201
6 Ga0065165_1000156 3300005262 Bacteria 119261
7 Ga0065165_1001173 3300005262 Bacteria 30458
8 Ga0065715_10118230 3300005293 Bacteria 2322
9 Ga0070658_10283787 3300005327 Bacteria 1410
10 Ga0070658_10755037 3300005327 Bacteria 845
11 Ga0070676_10013004 3300005328 Bacteria 4560
12 Ga0070676_10013531 3300005328 Bacteria 4472
13 Ga0070683_100061288 3300005329 Bacteria 3498
14 Ga0070677_10008560 3300005333 Bacteria 3447
15 Ga0070666_10277634 3300005335 Bacteria 1190
16 Ga0070660_100007080 3300005339 Bacteria 7793
17 Ga0070660_100200778 3300005339 Bacteria 1617
18 Ga0070660_100227357 3300005339 Bacteria 1517
19 Ga0070689_100001052 3300005340 Bacteria 17337
20 Ga0070687_100045158 3300005343 Bacteria 2248
21 Ga0070661_100003142 3300005344 Bacteria 11359
22 Ga0070661_100005513 3300005344 Bacteria 8723
23 Ga0070661_100375385 3300005344 Bacteria 1120
24 Ga0070692_10189394 3300005345 Bacteria 1197
25 Ga0070668_100084928 3300005347 Bacteria 2487
26 Ga0070669_100004842 3300005353 Bacteria 9715
27 Ga0070669_100132044 3300005353 Bacteria 1917
28 Ga0070675_100275506 3300005354 Bacteria 1477
29 Ga0070671_100127427 3300005355 Bacteria 2143
30 Ga0070671_100191106 3300005355 Bacteria 1735
31 Ga0070674_100033150 3300005356 Bacteria 3436
32 Ga0070674_100045586 3300005356 Bacteria 2996
33 Ga0070673_100064782 3300005364 Bacteria 2912
34 Ga0070688_100059715 3300005365 Bacteria 2406
35 Ga0070659_100014092 3300005366 Bacteria 5967
36 Ga0070659_100038200 3300005366 Bacteria 3744
37 Ga0070659_100140829 3300005366 Bacteria 1964
38 Ga0070694_100176390 3300005444 Bacteria 1578
39 Ga0070663_100054860 3300005455 Bacteria 2850
40 Ga0070663_100091278 3300005455 Bacteria 2257
41 Ga0070662_100001925 3300005457 Bacteria 12756
42 Ga0070662_100515639 3300005457 Bacteria 998
43 Ga0070681_10154428 3300005458 Bacteria 2221
44 Ga0068867_100001711 3300005459 Bacteria 15285
45 Ga0068867_100567231 3300005459 Bacteria 985
46 Ga0070685_10003882 3300005466 Bacteria 7559
47 Ga0070707_100235396 3300005468 Bacteria 1782
48 Ga0070707_100294762 3300005468 Bacteria 1576
49 Ga0068853_100014010 3300005539 Bacteria 6561
50 Ga0068853_100015987 3300005539 Bacteria 6170
51 Ga0068853_100090053 3300005539 Bacteria 2696
52 Ga0068853_100468826 3300005539 Bacteria 1186
53 Ga0070672_100044821 3300005543 Bacteria 3418
54 Ga0070672_100132850 3300005543 Bacteria 2047
55 Ga0070672_100209194 3300005543 Bacteria 1633
56 Ga0070672_100209195 3300005543 Bacteria 1633
57 Ga0070672_100613505 3300005543 Bacteria 948
58 Ga0070686_100042258 3300005544 Bacteria 2854
59 Ga0070695_100018431 3300005545 Bacteria 4240
60 Ga0070696_100252591 3300005546 Bacteria 1334
61 Ga0070665_100016480 3300005548 Bacteria 7410
62 Ga0070704_100081732 3300005549 Bacteria 2381
63 Ga0068855_100000068 3300005563 Bacteria 124575
64 Ga0068855_100008552 3300005563 Bacteria 12372
65 Ga0068855_100023030 3300005563 Bacteria 7465
66 Ga0068855_100346632 3300005563 Bacteria 1637
67 Ga0070664_100028732 3300005564 Bacteria 4629
68 Ga0070664_100131783 3300005564 Bacteria 2196
69 Ga0070664_100407802 3300005564 Bacteria 1243
70 Ga0068854_100045905 3300005578 Bacteria 3108
71 Ga0068856_100000181 3300005614 Bacteria 65631
72 Ga0068852_100102756 3300005616 Bacteria 2583
73 Ga0068859_100020248 3300005617 Bacteria 6678
74 Ga0068859_100432758 3300005617 Bacteria 1412
75 Ga0068864_100010007 3300005618 Bacteria 7826
76 Ga0068866_10057609 3300005718 Bacteria 2003
77 Ga0068861_100004408 3300005719 Bacteria 9432
78 Ga0068861_100222406 3300005719 Bacteria 1596
79 Ga0068851_10033082 3300005834 Bacteria 2575
80 Ga0068870_10014284 3300005840 Bacteria 3750
81 Ga0068870_10031964 3300005840 Bacteria 2670
82 Ga0068863_100123501 3300005841 Bacteria 2470
83 Ga0068858_100019450 3300005842 Bacteria 6351
84 Ga0068860_100134569 3300005843 Bacteria 2373
85 Ga0068860_100501551 3300005843 Bacteria 1212
86 Ga0068862_100008611 3300005844 Bacteria 8440
87 Ga0070716_100233933 3300006173 Bacteria 1242
88 Ga0075367_10130353 3300006178 Bacteria 1554
89 Ga0097621_100177020 3300006237 Bacteria 1841
90 Ga0068871_100454979 3300006358 Bacteria 1148
91 Ga0075428_100008854 3300006844 Bacteria 11165
92 Ga0075430_100033965 3300006846 Bacteria 4328
93 Ga0075430_100064131 3300006846 Bacteria 3086
94 Ga0075430_100089951 3300006846 Bacteria 2568
95 Ga0075429_100080541 3300006880 Bacteria 2839
96 Ga0068865_100015443 3300006881 Bacteria 4870
97 Ga0068865_100148732 3300006881 Bacteria 1774
98 Ga0097620_100020248 3300006931 Bacteria 6678
99 Ga0097620_100432740 3300006931 Bacteria 1412
100 Ga0111539_10063522 3300009094 Bacteria 4369
101 Ga0111539_10165559 3300009094 Bacteria 2585
102 Ga0111539_10247938 3300009094 Bacteria 2074
103 Ga0105241_10432856 3300009174 Bacteria 1160
104 Ga0105237_10162351 3300009545 Bacteria 2233
105 Ga0157373_10050969 3300013100 Bacteria 2947
106 Ga0157373_10157378 3300013100 Bacteria 1598
107 Ga0157371_10036801 3300013102 Bacteria 3505
108 Ga0157370_10035249 3300013104 Bacteria 4866
109 Ga0157370_10406970 3300013104 Bacteria 1252
110 Ga0157369_10011852 3300013105 Bacteria 9902
111 Ga0157369_10315825 3300013105 Bacteria 1624
112 Ga0157369_10497438 3300013105 Bacteria 1261
113 Ga0157374_10052046 3300013296 Bacteria 3812
114 Ga0157374_10854038 3300013296 Bacteria 927
115 Ga0157378_10223429 3300013297 Bacteria 1791
116 Ga0157372_10000481 3300013307 Bacteria 44095
117 Ga0157372_10080705 3300013307 Bacteria 3681
118 Ga0157372_10157395 3300013307 Bacteria 2625
119 Ga0157372_10225302 3300013307 Bacteria 2173
120 Ga0157375_10124906 3300013308 Bacteria 2687
121 Ga0163163_10002938 3300014325 Bacteria 14431
122 Ga0163163_10069714 3300014325 Bacteria 3501
123 Ga0157380_10025234 3300014326 Bacteria 4506
124 Ga0157380_10048236 3300014326 Bacteria 3353
125 Ga0157377_10002681 3300014745 Bacteria 7901
126 Ga0157379_10056462 3300014968 Bacteria 3508
127 Ga0157379_10062051 3300014968 Bacteria 3343
128 Ga0157376_10431472 3300014969 Bacteria 1281
129 Ga0209148_1000280 3300025254 Bacteria 78989
130 Ga0209130_1000268 3300025284 Bacteria 65115
131 Ga0207426_1007139 3300025302 Bacteria 4717
132 Ga0207697_10002035 3300025315 Bacteria 10675
133 Ga0207682_10008838 3300025893 Bacteria 3985
134 Ga0207692_10147638 3300025898 Bacteria 1344
135 Ga0207642_10006785 3300025899 Bacteria 3829
136 Ga0207688_10003028 3300025901 Bacteria 9157
137 Ga0207680_10010024 3300025903 Bacteria 4723
138 Ga0207645_10004453 3300025907 Bacteria 10373
139 Ga0207645_10122646 3300025907 Bacteria 1688
140 Ga0207643_10011553 3300025908 Bacteria 4770
141 Ga0207707_10208067 3300025912 Bacteria 1705
142 Ga0207671_10128332 3300025914 Bacteria 1944
143 Ga0207662_10013247 3300025918 Bacteria 4610
144 Ga0207657_10006281 3300025919 Bacteria 12350
145 Ga0207657_10020569 3300025919 Bacteria 6232
146 Ga0207657_10052623 3300025919 Bacteria 3532
147 Ga0207657_10177349 3300025919 Bacteria 1724
148 Ga0207649_10007766 3300025920 Bacteria 5834
149 Ga0207652_10339136 3300025921 Bacteria 1357
150 Ga0207646_10113148 3300025922 Bacteria 2436
151 Ga0207646_10412921 3300025922 Bacteria 1219
152 Ga0207681_10002320 3300025923 Bacteria 12099
153 Ga0207681_10067033 3300025923 Bacteria 2487
154 Ga0207650_10002733 3300025925 Bacteria 12179
155 Ga0207659_10038350 3300025926 Bacteria 3332
156 Ga0207659_10124352 3300025926 Bacteria 1981
157 Ga0207644_10095849 3300025931 Bacteria 2219
158 Ga0207644_10171599 3300025931 Bacteria 1693
159 Ga0207690_10002028 3300025932 Bacteria 12417
160 Ga0207706_10000074 3300025933 Bacteria 103144
161 Ga0207706_10013695 3300025933 Bacteria 7360
162 Ga0207670_10010089 3300025936 Bacteria 5423
163 Ga0207669_10018487 3300025937 Bacteria 3605
164 Ga0207704_10010144 3300025938 Bacteria 4578
165 Ga0207665_10416579 3300025939 Bacteria 1025
166 Ga0207691_10033608 3300025940 Bacteria 4775
167 Ga0207691_10076932 3300025940 Bacteria 3007
168 Ga0207691_10234037 3300025940 Bacteria 1590
169 Ga0207711_10068327 3300025941 Bacteria 3077
170 Ga0207689_10001435 3300025942 Bacteria 22775
171 Ga0207661_10040127 3300025944 Bacteria 3678
172 Ga0207679_10023599 3300025945 Bacteria 4208
173 Ga0207679_10362461 3300025945 Bacteria 1266
174 Ga0207667_10000057 3300025949 Bacteria 202301
175 Ga0207667_10013194 3300025949 Bacteria 9472
176 Ga0207667_10069904 3300025949 Bacteria 3655
177 Ga0207651_10032167 3300025960 Bacteria 3366
178 Ga0207651_10407190 3300025960 Bacteria 1158
179 Ga0207712_10014645 3300025961 Bacteria 5049
180 Ga0207712_10052763 3300025961 Bacteria 2849
181 Ga0207668_10005071 3300025972 Bacteria 7754
182 Ga0207640_10087955 3300025981 Bacteria 2143
183 Ga0207640_10204010 3300025981 Bacteria 1501
184 Ga0207658_10038153 3300025986 Bacteria 3458
185 Ga0207703_10027963 3300026035 Bacteria 4440
186 Ga0207639_10001107 3300026041 Bacteria 18300
187 Ga0207678_10006227 3300026067 Bacteria 10598
188 Ga0207678_10031774 3300026067 Bacteria 4603
189 Ga0207708_10008607 3300026075 Bacteria 7550
190 Ga0207708_10049053 3300026075 Bacteria 3215
191 Ga0207702_10001390 3300026078 Bacteria 24132
192 Ga0207641_10036623 3300026088 Bacteria 4095
193 Ga0207641_10090036 3300026088 Bacteria 2682
194 Ga0207648_10002472 3300026089 Bacteria 19861
195 Ga0207676_10001646 3300026095 Bacteria 16449
196 Ga0207674_10000461 3300026116 Bacteria 53251
197 Ga0207674_10336079 3300026116 Bacteria 1460
198 Ga0207675_100011252 3300026118 Bacteria 8379
199 Ga0207698_10412173 3300026142 Bacteria 1294
200 Ga0207698_10869110 3300026142 Bacteria 908
201 Ga0209996_1009199 3300027395 Bacteria 1301
202 Ga0209983_1005879 3300027665 Bacteria 2533
203 Ga0209588_1004244 3300027671 Bacteria 4030
204 Ga0209971_1008028 3300027682 Bacteria 2507
205 Ga0209998_10008078 3300027717 Bacteria 2184
206 Ga0209974_10000467 3300027876 Bacteria 13434
207 Ga0268265_10001364 3300028380 Bacteria 20788
208 Ga0268265_10165657 3300028380 Bacteria 1883
209 Ga0268264_10153153 3300028381 Bacteria 2069
210 Ga0311001_1059652 3300029277 Bacteria 726
211 Ga0307509_10000044 3300031507 Bacteria 176718
212 Ga0307408_100079604 3300031548 Bacteria 2445
213 Ga0307508_10056909 3300031616 Bacteria 3461
214 Ga0307405_10022142 3300031731 Bacteria 3588
215 Ga0307413_10004939 3300031824 Bacteria 5876
216 Ga0307413_10238149 3300031824 Bacteria 1342
217 Ga0307410_10025025 3300031852 Bacteria 3738
218 Ga0307406_10005075 3300031901 Bacteria 7182
219 Ga0307412_10011189 3300031911 Bacteria 5192
220 Ga0307409_100008454 3300031995 Bacteria 6250
221 Ga0307416_100059194 3300032002 Bacteria 3111
222 Ga0307416_100156662 3300032002 Bacteria 2098
223 Ga0307411_10014724 3300032005 Bacteria 4364
224 Ga0307411_10238200 3300032005 Bacteria 1423
225 Ga0307415_100008439 3300032126 Bacteria 5710
226 Ga0307507_10234248 3300033179 Bacteria 1212
227 Ga0373934_0000731 3300035086 Bacteria 11743
228 Ga0373923_0000489 3300035111 Bacteria 9511
229 Ga0373936_0002939 3300035113 Bacteria 6370
230 Ga0373941_0015192 3300035115 Bacteria 2070
231 Ga0373953_0138669 3300035117 Bacteria 1039
232 Ga0373954_0000665 3300035118 Bacteria 13169
233 Ga0373954_0012185 3300035118 Bacteria 3823
234 Ga0373956_0006545 3300035119 Bacteria 4667
235 Ga0373957_0012049 3300035120 Bacteria 2901
236 Ga0373957_0108248 3300035120 Bacteria 1118
237 Ga0373943_0242081 3300035170 Bacteria 1011
238 Ga0373946_0010964 3300035171 Bacteria 3370
239 Ga0316574_0494583 3300035398 Bacteria 763
240 Ga0373924_0023342 3300035410 Bacteria 2425
241 Ga0373935_0226082 3300035692 Bacteria 1301
242 Ga0373927_0020223 3300035695 Bacteria 4365
243 Ga0373927_0100850 3300035695 Bacteria 1877
244 Ga0373933_0013442 3300035724 Bacteria 4537
245 Ga0373937_0128403 3300036401 Bacteria 2366
246 Ga0373925_0016379 3300037068 Bacteria 5369
247 Ga0373925_0035075 3300037068 Bacteria 3700
248 Ga0395899_0075913 3300037312 Bacteria 2454
249 Ga0395899_0150009 3300037312 Bacteria 1653
250 Ga0395900_0000297 3300037418 Bacteria 74817
251 Ga0395900_0080416 3300037418 Bacteria 3349
252 Ga0395900_0244365 3300037418 Bacteria 1799
253 Ga0395898_0074976 3300037466 Bacteria 3268
254 Ga0395905_0127754 3300037471 Bacteria 2390
255 Ga0395905_0563293 3300037471 Bacteria 1041
256 Ga0395901_0086487 3300038443 Bacteria 3278
257 Ga0400483_057805 3300039062 Bacteria 1611
258 Ga0400483_268566 3300039062 Bacteria 1999
259 Ga0495617_000039 3300046452 Bacteria 128069
260 Ga0495627_000303 3300046453 Bacteria 48679
261 Ga0495627_004164 3300046453 Bacteria 6132
262 Ga0495627_101361 3300046453 Bacteria 821
263 Ga0495592_0021952 3300046454 Bacteria 4857
264 Ga0495592_0213636 3300046454 Bacteria 1294
265 Ga0495590_0000018 3300046457 Bacteria 216375
266 Ga0495590_0014881 3300046457 Bacteria 2834
267 Ga0495591_000134 3300046458 Bacteria 80820
268 Ga0495638_0014015 3300046460 Bacteria 5434
269 Ga0495638_0078208 3300046460 Bacteria 2013
270 Ga0495641_0045813 3300046461 Bacteria 2012
271 Ga0495651_0034753 3300046462 Bacteria 3928
272 Ga0495653_0079220 3300046463 Bacteria 2433
273 Ga0495650_0000048 3300046471 Bacteria 334427
274 Ga0495650_0111221 3300046471 Bacteria 1017
275 Ga0495580_0027507 3300046472 Bacteria 4137
276 Ga0495580_0103538 3300046472 Bacteria 1978
277 Ga0495582_0000534 3300046473 Bacteria 21025
278 Ga0495582_0033767 3300046473 Bacteria 2813
279 Ga0495582_0194237 3300046473 Bacteria 1158
280 Ga0495605_0001258 3300046474 Bacteria 16801
281 Ga0495605_0001847 3300046474 Bacteria 13542
282 Ga0495605_0014011 3300046474 Bacteria 4399
283 Ga0495605_0032164 3300046474 Bacteria 2673
284 Ga0495639_0006735 3300046475 Bacteria 4941
285 Ga0495664_0009228 3300046477 Bacteria 5514
286 Ga0495584_0000243 3300046491 Bacteria 39445
287 Ga0495584_0004813 3300046491 Bacteria 7212
288 Ga0495584_0012074 3300046491 Bacteria 4416
289 Ga0495584_0025191 3300046491 Bacteria 3015
290 Ga0495584_0084103 3300046491 Bacteria 1602
291 Ga0495584_0204916 3300046491 Bacteria 1002
292 Ga0495585_0004757 3300046492 Bacteria 8739
293 Ga0495585_0034364 3300046492 Bacteria 2865
294 Ga0495585_0038865 3300046492 Bacteria 2677
295 Ga0495585_0049092 3300046492 Bacteria 2344
296 Ga0495585_0055116 3300046492 Bacteria 2197
297 Ga0495594_0004358 3300046499 Bacteria 7283
298 Ga0495594_0013300 3300046499 Bacteria 4293
299 Ga0495594_0028902 3300046499 Bacteria 2993
300 Ga0495594_0078827 3300046499 Bacteria 1838
301 Ga0495594_0085781 3300046499 Bacteria 1761
302 Ga0495596_0015492 3300046500 Bacteria 3190
303 Ga0495596_0021676 3300046500 Bacteria 2620
304 Ga0495596_0022501 3300046500 Bacteria 2565
305 Ga0495596_0024640 3300046500 Bacteria 2435
306 Ga0495596_0028461 3300046500 Bacteria 2243
307 Ga0495596_0033331 3300046500 Bacteria 2049
308 Ga0495596_0099100 3300046500 Bacteria 1131
309 Ga0495607_0001206 3300046501 Bacteria 23354
310 Ga0495607_0001465 3300046501 Bacteria 21024
311 Ga0495607_0047107 3300046501 Bacteria 2527
312 Ga0495607_0050603 3300046501 Bacteria 2417
313 Ga0495607_0052716 3300046501 Bacteria 2354
314 Ga0495607_0171275 3300046501 Bacteria 1096
315 Ga0495583_0000377 3300046506 Bacteria 69237
316 Ga0495583_0001102 3300046506 Bacteria 29889
317 Ga0495583_0013112 3300046506 Bacteria 4644
318 Ga0495583_0029758 3300046506 Bacteria 2668
319 Ga0495583_0041668 3300046506 Bacteria 2149
320 Ga0495583_0044111 3300046506 Bacteria 2072
321 Ga0495606_0020046 3300046507 Bacteria 4945
322 Ga0495606_0101758 3300046507 Bacteria 1748
323 Ga0495606_0108041 3300046507 Bacteria 1682
324 Ga0495610_0000147 3300046512 Bacteria 77304
325 Ga0495616_0000175 3300046513 Bacteria 54795
326 Ga0495616_0004688 3300046513 Bacteria 8575
327 Ga0495616_0005403 3300046513 Bacteria 7870
328 Ga0495616_0016092 3300046513 Bacteria 4144
329 Ga0495616_0045377 3300046513 Bacteria 2224
330 Ga0495616_0048260 3300046513 Bacteria 2140
331 Ga0495616_0053522 3300046513 Bacteria 2005
332 Ga0495628_0020369 3300046516 Bacteria 5472
333 Ga0495630_0122796 3300046517 Bacteria 1970
334 Ga0495631_0000028 3300046518 Bacteria 87180
335 Ga0495631_0001122 3300046518 Bacteria 16601
336 Ga0495631_0008662 3300046518 Bacteria 5118
337 Ga0495631_0009878 3300046518 Bacteria 4747
338 Ga0495631_0014639 3300046518 Bacteria 3779
339 Ga0495631_0017486 3300046518 Bacteria 3391
340 Ga0495631_0022437 3300046518 Bacteria 2935
341 Ga0495631_0074151 3300046518 Bacteria 1469
342 Ga0495632_0000267 3300046519 Bacteria 52020
343 Ga0495632_0000684 3300046519 Bacteria 30931
344 Ga0495632_0003767 3300046519 Bacteria 10600
345 Ga0495632_0006115 3300046519 Bacteria 7804
346 Ga0495632_0015831 3300046519 Bacteria 4214
347 Ga0495632_0018018 3300046519 Bacteria 3882
348 Ga0495632_0018226 3300046519 Bacteria 3856
349 Ga0495632_0041634 3300046519 Bacteria 2307
350 Ga0495637_0000004 3300046520 Bacteria 589740
351 Ga0495643_0001557 3300046522 Bacteria 20441
352 Ga0495643_0014626 3300046522 Bacteria 4663
353 Ga0495643_0069576 3300046522 Bacteria 1849
354 Ga0495644_0001291 3300046523 Bacteria 10283
355 Ga0495644_0002623 3300046523 Bacteria 7154
356 Ga0495644_0008124 3300046523 Bacteria 4038
357 Ga0495644_0015220 3300046523 Bacteria 2945
358 Ga0495644_0023219 3300046523 Bacteria 2361
359 Ga0495648_0011379 3300046524 Bacteria 6706
360 Ga0495648_0014105 3300046524 Bacteria 5870
361 Ga0495648_0026581 3300046524 Bacteria 3893
362 Ga0495648_0070625 3300046524 Bacteria 2028
363 Ga0495666_0007773 3300046526 Bacteria 5367
364 Ga0495666_0012947 3300046526 Bacteria 4156
365 Ga0495666_0041319 3300046526 Bacteria 2233
366 Ga0495642_0000081 3300046528 Bacteria 55669
367 Ga0495642_0001200 3300046528 Bacteria 11930
368 Ga0495642_0014072 3300046528 Bacteria 3101
369 Ga0495642_0040548 3300046528 Bacteria 1891
370 Ga0495642_0042669 3300046528 Bacteria 1848
371 Ga0495652_0041160 3300046529 Bacteria 3990
372 Ga0495652_0057079 3300046529 Bacteria 3313
373 Ga0495654_0007829 3300046530 Bacteria 5940
374 Ga0495654_0053124 3300046530 Bacteria 1970
375 Ga0495665_0004851 3300046531 Bacteria 7254
376 Ga0495640_0110622 3300046533 Bacteria 1796
377 Ga0495640_0379882 3300046533 Bacteria 869
378 Ga0495586_0015570 3300046535 Bacteria 4046
379 Ga0495587_0006076 3300046536 Bacteria 7879
380 Ga0495609_0006889 3300046538 Bacteria 5739
381 Ga0495609_0008883 3300046538 Bacteria 4890
382 Ga0495609_0015800 3300046538 Bacteria 3528
383 Ga0495609_0016598 3300046538 Bacteria 3429
384 Ga0495609_0031754 3300046538 Bacteria 2399
385 Ga0495609_0093622 3300046538 Bacteria 1305
386 Ga0495609_0128119 3300046538 Bacteria 1088
387 Ga0495621_0013697 3300046539 Bacteria 2553
388 Ga0495597_0000187 3300046542 Bacteria 55956
389 Ga0495597_0000404 3300046542 Bacteria 37304
390 Ga0495597_0002432 3300046542 Bacteria 11812
391 Ga0495597_0028870 3300046542 Bacteria 2535
392 Ga0495597_0031584 3300046542 Bacteria 2408
393 Ga0495597_0044231 3300046542 Bacteria 1981
394 Ga0495597_0092019 3300046542 Bacteria 1286
395 Ga0495622_0049992 3300046557 Bacteria 1940
396 Ga0495622_0257012 3300046557 Bacteria 767
397 Ga0495633_0001359 3300046558 Bacteria 19163
398 Ga0495633_0009075 3300046558 Bacteria 5529
399 Ga0495633_0019652 3300046558 Bacteria 3413
400 Ga0495633_0051380 3300046558 Bacteria 1942
401 Ga0495667_0006636 3300046559 Bacteria 7855
402 Ga0495667_0119177 3300046559 Bacteria 1704
403 Ga0495656_0040782 3300046615 Bacteria 1936
404 Ga0495656_0117989 3300046615 Bacteria 1249
405 Ga0495656_0138753 3300046615 Bacteria 1164
406 Ga0495668_0000603 3300046616 Bacteria 43532
407 Ga0495668_0001327 3300046616 Bacteria 24338
408 Ga0495668_0003472 3300046616 Bacteria 11763
409 Ga0495668_0008015 3300046616 Bacteria 6654
410 Ga0495668_0023093 3300046616 Bacteria 3550
411 Ga0495668_0025211 3300046616 Bacteria 3380
412 Ga0495668_0025226 3300046616 Bacteria 3379
413 Ga0495668_0049134 3300046616 Bacteria 2339
414 Ga0495668_0107029 3300046616 Bacteria 1529
415 Ga0495668_0110488 3300046616 Bacteria 1503
416 Ga0495668_0165995 3300046616 Bacteria 1209
417 Ga0495668_0254734 3300046616 Bacteria 961
418 Ga0495634_0004975 3300046642 Bacteria 10266
419 Ga0495634_0043743 3300046642 Bacteria 3034
420 Ga0495611_0001261 3300046648 Bacteria 13033
421 Ga0495611_0002381 3300046648 Bacteria 8656
422 Ga0495611_0032033 3300046648 Bacteria 2316
423 Ga0495625_0019644 3300046660 Bacteria 5233
424 Ga0495625_0063631 3300046660 Bacteria 2604
425 Ga0495625_0096352 3300046660 Bacteria 2038
426 Ga0495625_0141008 3300046660 Bacteria 1626
427 Ga0495635_0054081 3300046663 Bacteria 2765
428 Ga0495635_0081969 3300046663 Bacteria 2207
429 Ga0495661_0003069 3300046665 Bacteria 12562
430 Ga0495661_0003405 3300046665 Bacteria 11761
431 Ga0495661_0007004 3300046665 Bacteria 7885
432 Ga0495661_0019568 3300046665 Bacteria 4434
433 Ga0495661_0034655 3300046665 Bacteria 3174
434 Ga0495661_0066800 3300046665 Bacteria 2115
435 Ga0495588_0004759 3300046674 Bacteria 6000
436 Ga0495588_0005321 3300046674 Bacteria 5725
437 Ga0495588_0022699 3300046674 Bacteria 3102
438 Ga0495588_0143479 3300046674 Bacteria 1261
439 Ga0495657_0003112 3300046675 Bacteria 13695
440 Ga0495599_0023512 3300046678 Bacteria 3853
441 Ga0495623_0002113 3300046679 Bacteria 13287
442 Ga0495647_0010219 3300046681 Bacteria 3193
443 Ga0495647_0051592 3300046681 Bacteria 1599
444 Ga0495669_0000174 3300046684 Bacteria 40779
445 Ga0495669_0002474 3300046684 Bacteria 7536
446 Ga0495669_0004825 3300046684 Bacteria 5594
447 Ga0495669_0007519 3300046684 Bacteria 4572
448 Ga0495669_0017305 3300046684 Bacteria 3092
449 Ga0495669_0025169 3300046684 Bacteria 2594
450 Ga0495669_0056497 3300046684 Bacteria 1769
451 Ga0495669_0078458 3300046684 Bacteria 1513
452 Ga0495613_0129512 3300046689 Bacteria 1807
453 Ga0495624_0147194 3300046690 Bacteria 1441
454 Ga0495670_0001204 3300046691 Bacteria 12575
455 Ga0495670_0017542 3300046691 Bacteria 3523
456 Ga0495670_0058698 3300046691 Bacteria 1931
457 Ga0495671_0000338 3300046692 Bacteria 39056
458 Ga0495671_0000846 3300046692 Bacteria 21877
459 Ga0495671_0016291 3300046692 Bacteria 3972
460 Ga0495671_0240164 3300046692 Bacteria 875
461 Ga0495649_0000355 3300046694 Bacteria 39453
462 Ga0495649_0003389 3300046694 Bacteria 10775
463 Ga0495649_0022143 3300046694 Bacteria 3556
464 Ga0495649_0068786 3300046694 Bacteria 1899
465 Ga0495649_0143406 3300046694 Bacteria 1256
466 Ga0495589_0000441 3300046794 Bacteria 30525
467 Ga0495589_0000813 3300046794 Bacteria 19744
468 Ga0495589_0002969 3300046794 Bacteria 9344
469 Ga0495589_0009670 3300046794 Bacteria 5011
470 Ga0495589_0015895 3300046794 Bacteria 3869
471 Ga0495589_0017623 3300046794 Bacteria 3664
472 Ga0495600_0036797 3300046809 Bacteria 3181
473 Ga0495660_0001242 3300046810 Bacteria 17743
474 Ga0495660_0054162 3300046810 Bacteria 2174
475 Ga0495660_0056767 3300046810 Bacteria 2114
476 Ga0495660_0089629 3300046810 Bacteria 1601
477 Ga0495581_0392117 3300047315 Bacteria 810
478 Ga0495581_0484655 3300047315 Bacteria 719
479 Ga0495604_0012212 3300047317 Bacteria 6826
480 Ga0495604_0108536 3300047317 Bacteria 2027
481 Ga0495636_0010339 3300047318 Bacteria 3684
482 Ga0495636_0049678 3300047318 Bacteria 1754
483 Ga0495674_0002348 3300047319 Bacteria 18570
484 Ga0495672_0000126 3300047320 Bacteria 117782
485 Ga0495672_0056639 3300047320 Bacteria 2279
486 Ga0495676_0000047 3300047321 Bacteria 100683
487 Ga0495680_0007593 3300047322 Bacteria 9911
488 Ga0495680_0030498 3300047322 Bacteria 4403
489 Ga0495680_0066852 3300047322 Bacteria 2749
490 Ga0495683_0000214 3300047323 Bacteria 54728
491 Ga0495683_0044543 3300047323 Bacteria 2231
492 Ga0495683_0162185 3300047323 Bacteria 1033
493 Ga0495687_000002 3300047443 Bacteria 1085770
494 Ga0495687_000017 3300047443 Bacteria 350429
495 Ga0495687_007764 3300047443 Bacteria 6247
496 Ga0495675_0010331 3300047444 Bacteria 5837
497 Ga0495675_0045135 3300047444 Bacteria 2806
498 Ga0495675_0047688 3300047444 Bacteria 2725
499 Ga0495675_0049677 3300047444 Bacteria 2665
500 Ga0495677_0000292 3300047445 Bacteria 21858
501 Ga0495677_0000887 3300047445 Bacteria 12070
502 Ga0495677_0001264 3300047445 Bacteria 10128
503 Ga0495677_0004012 3300047445 Bacteria 5683
504 Ga0495677_0004242 3300047445 Bacteria 5521
505 Ga0495679_008925 3300047446 Bacteria 4043
506 Ga0495679_011252 3300047446 Bacteria 3465
507 Ga0495679_024830 3300047446 Bacteria 2013
508 Ga0495685_035140 3300047447 Bacteria 1722
509 Ga0495685_073093 3300047447 Bacteria 1147
510 Ga0495681_0000213 3300047470 Bacteria 48410
511 Ga0495681_0000629 3300047470 Bacteria 26892
512 Ga0495681_0004133 3300047470 Bacteria 9969
513 Ga0495681_0017002 3300047470 Bacteria 4054
514 Ga0495681_0028671 3300047470 Bacteria 2860
515 Ga0495681_0037654 3300047470 Bacteria 2380
516 Ga0495684_0012196 3300047471 Bacteria 6630
517 Ga0495686_0000248 3300047472 Bacteria 97017
518 Ga0495686_0000350 3300047472 Bacteria 75596
519 Ga0495686_0035961 3300047472 Bacteria 3180
520 Ga0495614_0114515 3300048089 Bacteria 1185
521 Ga0495626_0010864 3300048091 Bacteria 4835
522 Ga0495626_0012884 3300048091 Bacteria 4363
523 Ga0495626_0014087 3300048091 Bacteria 4135
524 Ga0495626_0020798 3300048091 Bacteria 3265
525 Ga0495626_0024969 3300048091 Bacteria 2925
526 Ga0495626_0031890 3300048091 Bacteria 2533
527 Ga0495626_0068054 3300048091 Bacteria 1607
528 Ga0495626_0080376 3300048091 Bacteria 1449
529 Ga0496100_0016595 3300048903 Bacteria 4328
530 Ga0496101_0362652 3300048904 Bacteria 1139
531 Ga0496102_0000306 3300048905 Bacteria 62296
532 Ga0496102_0009564 3300048905 Bacteria 8337
533 Ga0496102_0112183 3300048905 Bacteria 2543
534 Ga0496102_0300928 3300048905 Bacteria 1512
535 Ga0496104_0003929 3300048907 Bacteria 12868
536 Ga0496105_0008045 3300048908 Bacteria 8195
537 Ga0496106_0007041 3300048909 Bacteria 8306
538 Ga0496106_0217353 3300048909 Bacteria 1523
539 Ga0496107_0104454 3300048910 Bacteria 2079
540 Ga0496107_0466811 3300048910 Bacteria 937
541 Ga0496108_0001996 3300048911 Bacteria 16344
542 Ga0496109_0003539 3300048912 Bacteria 13034
543 Ga0496110_0000031 3300048913 Bacteria 67672
544 Ga0496110_0144508 3300048913 Bacteria 2151
545 Ga0496110_0256538 3300048913 Bacteria 1592
546 Ga0496110_0842252 3300048913 Bacteria 822
547 Ga0496111_0034738 3300048914 Bacteria 3601
548 Ga0496114_0276929 3300048917 Bacteria 1479
549 Ga0496115_0280358 3300048918 Bacteria 1368
550 Ga0496124_0023019 3300048927 Bacteria 5699
551 Ga0496124_0227281 3300048927 Bacteria 1398
552 Ga0501308_008319 3300049128 Bacteria 1108
553 Ga0495678_000121 3300049459 Bacteria 91388
554 Ga0495678_000371 3300049459 Bacteria 45956
555 Ga0495678_000722 3300049459 Bacteria 30006
556 Ga0495678_001149 3300049459 Bacteria 21969
557 Ga0495678_015016 3300049459 Bacteria 3580
558 Ga0495682_0000155 3300049460 Bacteria 58368
559 Ga0495682_0008564 3300049460 Bacteria 4024
560 Ga0495682_0026482 3300049460 Bacteria 2152
561 Ga0495682_0043757 3300049460 Bacteria 1639
562 Ga0501315_011342 3300049531 Bacteria 1086
563 Ga0501315_012996 3300049531 Bacteria 1037
564 Ga0501033_0274418 3300049570 Bacteria 1191
565 Ga0501036_0256229 3300049572 Bacteria 1466
566 Ga0501038_0372146 3300049574 Bacteria 1109
567 Ga0501039_0317920 3300049575 Bacteria 1224
568 Ga0501039_0419070 3300049575 Bacteria 1052
569 Ga0501068_0026702 3300049584 Bacteria 3404
570 Ga0501069_0025868 3300049585 Bacteria 3211
571 Ga0501071_0021131 3300049587 Bacteria 4533
572 Ga0501071_0085617 3300049587 Bacteria 2311
573 Ga0501072_0131932 3300049588 Bacteria 1991
574 Ga0501073_0004140 3300049589 Bacteria 10881
575 Ga0501074_0147996 3300049590 Bacteria 1679
576 Ga0501076_0078551 3300049592 Bacteria 2648
577 Ga0501077_0000288 3300049593 Bacteria 29818
578 Ga0501229_008742 3300049706 Bacteria 1268
579 Ga0501079_0121060 3300049741 Bacteria 2035
580 Ga0501080_0001913 3300049742 Bacteria 17955
581 Ga0501083_0025178 3300049744 Bacteria 4120
582 Ga0501269_013608 3300049766 Bacteria 997
583 Ga0501283_019817 3300049779 Bacteria 1067
584 nmdc:mga00v17_208130_c1 3300050491 Bacteria 1265
585 nmdc:mga05p37_812439_c1 3300050507 Bacteria 1021
586 nmdc:mga09592_255090_c1 3300050508 Bacteria 1520
587 nmdc:mga0qj67_74741_c1 3300050509 Bacteria 2708
588 nmdc:mga06r32_26525_c1 3300050510 Bacteria 5403
589 nmdc:mga08y16_192886_c1 3300050511 Bacteria 2113
590 nmdc:mga08y16_195630_c1 3300050511 Bacteria 2096
591 nmdc:mga08y16_38519_c1 3300050511 Bacteria 5020
592 Ga0495595_0005439 3300053084 Bacteria 5155
593 Ga0495619_0007281 3300053085 Bacteria 7007
594 Ga0500652_270818 3300053131 Bacteria 666
595 Ga0500589_050561 3300053147 Bacteria 1929
596 Ga0501084_0005439 3300054114 Bacteria 10446
597 Ga0501084_0906055 3300054114 Bacteria 742
598 Ga0501082_0077873 3300060353 Bacteria 2859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_268566 Ga0400483_268566_40_633 188
2 3300053131 Ga0500652_270818 Ga0500652_270818_19_612 197
3 3300029277 Ga0311001_1059652 Ga0311001_10596522 198
4 3300046471 Ga0495650_0000048 Ga0495650_0000048_65924_66664 220
5 3300053147 Ga0500589_050561 Ga0500589_050561_1192_1914 220
6 3300006178 Ga0075367_10130353 Ga0075367_101303532 229
7 3300039062 Ga0400483_057805 Ga0400483_057805_288_1019 229
8 3300049572 Ga0501036_0256229 Ga0501036_0256229_258_977 229
9 3300049587 Ga0501071_0085617 Ga0501071_0085617_1050_1769 229
10 iso_pu_bacteria 2643221556 2643802216 229
11 iso_pu_bacteria 2643221645 2644254254 229
12 iso_pu_bacteria 2643221684 2644475724 229
13 iso_pu_bacteria 8047673197 8047673926 229
14 3300005328 Ga0070676_10013531 Ga0070676_100135313 230
15 3300005345 Ga0070692_10189394 Ga0070692_101893941 230
16 3300005353 Ga0070669_100004842 Ga0070669_1000048425 230
17 3300005356 Ga0070674_100033150 Ga0070674_1000331503 230
18 3300005444 Ga0070694_100176390 Ga0070694_1001763902 230
19 3300005459 Ga0068867_100001711 Ga0068867_10000171110 230
20 3300005545 Ga0070695_100018431 Ga0070695_1000184312 230
21 3300005546 Ga0070696_100252591 Ga0070696_1002525911 230
22 3300005718 Ga0068866_10057609 Ga0068866_100576093 230
23 3300005719 Ga0068861_100004408 Ga0068861_1000044086 230
24 3300005840 Ga0068870_10014284 Ga0068870_100142842 230
25 3300005843 Ga0068860_100501551 Ga0068860_1005015512 230
26 3300005844 Ga0068862_100008611 Ga0068862_1000086114 230
27 3300006846 Ga0075430_100089951 Ga0075430_1000899513 230
28 3300006880 Ga0075429_100080541 Ga0075429_1000805412 230
29 3300006881 Ga0068865_100015443 Ga0068865_1000154436 230
30 3300009094 Ga0111539_10063522 Ga0111539_100635224 230
31 3300014326 Ga0157380_10025234 Ga0157380_100252343 230
32 3300025899 Ga0207642_10006785 Ga0207642_100067852 230
33 3300025923 Ga0207681_10002320 Ga0207681_100023209 230
34 3300025937 Ga0207669_10018487 Ga0207669_100184874 230
35 3300025938 Ga0207704_10010144 Ga0207704_100101446 230
36 3300025961 Ga0207712_10014645 Ga0207712_100146456 230
37 3300025972 Ga0207668_10005071 Ga0207668_100050715 230
38 3300026075 Ga0207708_10008607 Ga0207708_100086076 230
39 3300026089 Ga0207648_10002472 Ga0207648_100024729 230
40 3300026118 Ga0207675_100011252 Ga0207675_1000112526 230
41 3300027395 Ga0209996_1009199 Ga0209996_10091992 230
42 3300028380 Ga0268265_10001364 Ga0268265_100013646 230
43 3300031824 Ga0307413_10238149 Ga0307413_102381492 230
44 3300032002 Ga0307416_100156662 Ga0307416_1001566623 230
45 3300035115 Ga0373941_0015192 Ga0373941_0015192_830_1522 230
46 3300035398 Ga0316574_0494583 Ga0316574_0494583_25_720 230
47 3300046533 Ga0495640_0110622 Ga0495640_0110622_698_1390 230
48 3300046684 Ga0495669_0078458 Ga0495669_0078458_725_1417 230
49 3300050508 nmdc:mga09592_255090_c1 nmdc:mga09592_255090_c1_213_905 230
50 3300050511 nmdc:mga08y16_192886_c1 nmdc:mga08y16_192886_c1_41_733 230
51 3300005339 Ga0070660_100227357 Ga0070660_1002273572 231
52 3300005468 Ga0070707_100235396 Ga0070707_1002353963 231
53 3300005539 Ga0068853_100468826 Ga0068853_1004688262 231
54 3300005563 Ga0068855_100000068 Ga0068855_10000006812 231
55 3300005563 Ga0068855_100023030 Ga0068855_1000230303 231
56 3300006173 Ga0070716_100233933 Ga0070716_1002339332 231
57 3300006846 Ga0075430_100033965 Ga0075430_1000339653 231
58 3300013100 Ga0157373_10157378 Ga0157373_101573783 231
59 3300013104 Ga0157370_10035249 Ga0157370_100352494 231
60 3300013104 Ga0157370_10406970 Ga0157370_104069701 231
61 3300013105 Ga0157369_10315825 Ga0157369_103158252 231
62 3300013105 Ga0157369_10497438 Ga0157369_104974382 231
63 3300013307 Ga0157372_10080705 Ga0157372_100807053 231
64 3300025919 Ga0207657_10006281 Ga0207657_1000628112 231
65 3300025922 Ga0207646_10113148 Ga0207646_101131484 231
66 3300025939 Ga0207665_10416579 Ga0207665_104165792 231
67 3300025949 Ga0207667_10000057 Ga0207667_1000005716 231
68 3300025949 Ga0207667_10069904 Ga0207667_100699043 231
69 3300031507 Ga0307509_10000044 Ga0307509_1000004479 231
70 3300033179 Ga0307507_10234248 Ga0307507_102342481 231
71 3300037312 Ga0395899_0075913 Ga0395899_0075913_926_1633 231
72 3300037418 Ga0395900_0244365 Ga0395900_0244365_773_1480 231
73 3300037466 Ga0395898_0074976 Ga0395898_0074976_694_1401 231
74 3300038443 Ga0395901_0086487 Ga0395901_0086487_694_1401 231
75 3300046616 Ga0495668_0254734 Ga0495668_0254734_141_836 231
76 3300047318 Ga0495636_0049678 Ga0495636_0049678_644_1339 231
77 3300049575 Ga0501039_0419070 Ga0501039_0419070_176_871 231
78 3300049779 Ga0501283_019817 Ga0501283_019817_196_891 231
79 3300050509 nmdc:mga0qj67_74741_c1 nmdc:mga0qj67_74741_c1_1545_2243 231
80 3300054114 Ga0501084_0906055 Ga0501084_0906055_27_722 231
81 3300003322 rootL2_10005622 rootL2_1000562216 232
82 3300005293 Ga0065715_10118230 Ga0065715_101182302 232
83 3300005327 Ga0070658_10283787 Ga0070658_102837872 232
84 3300005327 Ga0070658_10755037 Ga0070658_107550371 232
85 3300005328 Ga0070676_10013004 Ga0070676_100130043 232
86 3300005329 Ga0070683_100061288 Ga0070683_1000612884 232
87 3300005333 Ga0070677_10008560 Ga0070677_100085603 232
88 3300005335 Ga0070666_10277634 Ga0070666_102776341 232
89 3300005339 Ga0070660_100007080 Ga0070660_1000070804 232
90 3300005339 Ga0070660_100200778 Ga0070660_1002007781 232
91 3300005340 Ga0070689_100001052 Ga0070689_1000010528 232
92 3300005343 Ga0070687_100045158 Ga0070687_1000451582 232
93 3300005344 Ga0070661_100003142 Ga0070661_10000314211 232
94 3300005344 Ga0070661_100005513 Ga0070661_1000055134 232
95 3300005344 Ga0070661_100375385 Ga0070661_1003753852 232
96 3300005347 Ga0070668_100084928 Ga0070668_1000849282 232
97 3300005353 Ga0070669_100132044 Ga0070669_1001320443 232
98 3300005354 Ga0070675_100275506 Ga0070675_1002755061 232
99 3300005355 Ga0070671_100127427 Ga0070671_1001274273 232
100 3300005355 Ga0070671_100191106 Ga0070671_1001911062 232
101 3300005356 Ga0070674_100045586 Ga0070674_1000455862 232
102 3300005364 Ga0070673_100064782 Ga0070673_1000647822 232
103 3300005365 Ga0070688_100059715 Ga0070688_1000597152 232
104 3300005366 Ga0070659_100014092 Ga0070659_1000140923 232
105 3300005366 Ga0070659_100038200 Ga0070659_1000382001 232
106 3300005366 Ga0070659_100140829 Ga0070659_1001408292 232
107 3300005455 Ga0070663_100054860 Ga0070663_1000548602 232
108 3300005455 Ga0070663_100091278 Ga0070663_1000912783 232
109 3300005457 Ga0070662_100001925 Ga0070662_1000019253 232
110 3300005457 Ga0070662_100515639 Ga0070662_1005156392 232
111 3300005458 Ga0070681_10154428 Ga0070681_101544282 232
112 3300005459 Ga0068867_100567231 Ga0068867_1005672311 232
113 3300005466 Ga0070685_10003882 Ga0070685_100038826 232
114 3300005468 Ga0070707_100294762 Ga0070707_1002947622 232
115 3300005539 Ga0068853_100014010 Ga0068853_1000140105 232
116 3300005539 Ga0068853_100015987 Ga0068853_1000159872 232
117 3300005539 Ga0068853_100090053 Ga0068853_1000900532 232
118 3300005543 Ga0070672_100132850 Ga0070672_1001328503 232
119 3300005543 Ga0070672_100209194 Ga0070672_1002091943 232
120 3300005543 Ga0070672_100209195 Ga0070672_1002091953 232
121 3300005543 Ga0070672_100613505 Ga0070672_1006135052 232
122 3300005544 Ga0070686_100042258 Ga0070686_1000422583 232
123 3300005548 Ga0070665_100016480 Ga0070665_1000164802 232
124 3300005549 Ga0070704_100081732 Ga0070704_1000817323 232
125 3300005563 Ga0068855_100008552 Ga0068855_1000085524 232
126 3300005563 Ga0068855_100346632 Ga0068855_1003466322 232
127 3300005564 Ga0070664_100028732 Ga0070664_1000287322 232
128 3300005564 Ga0070664_100131783 Ga0070664_1001317833 232
129 3300005564 Ga0070664_100407802 Ga0070664_1004078022 232
130 3300005578 Ga0068854_100045905 Ga0068854_1000459052 232
131 3300005614 Ga0068856_100000181 Ga0068856_1000001814 232
132 3300005616 Ga0068852_100102756 Ga0068852_1001027562 232
133 3300005617 Ga0068859_100020248 Ga0068859_1000202484 232
134 3300005617 Ga0068859_100432758 Ga0068859_1004327581 232
135 3300005618 Ga0068864_100010007 Ga0068864_1000100072 232
136 3300005719 Ga0068861_100222406 Ga0068861_1002224062 232
137 3300005834 Ga0068851_10033082 Ga0068851_100330823 232
138 3300005840 Ga0068870_10031964 Ga0068870_100319643 232
139 3300005842 Ga0068858_100019450 Ga0068858_1000194507 232
140 3300005843 Ga0068860_100134569 Ga0068860_1001345692 232
141 3300006844 Ga0075428_100008854 Ga0075428_1000088549 232
142 3300006846 Ga0075430_100064131 Ga0075430_1000641312 232
143 3300006881 Ga0068865_100148732 Ga0068865_1001487323 232
144 3300006931 Ga0097620_100020248 Ga0097620_1000202486 232
145 3300006931 Ga0097620_100432740 Ga0097620_1004327403 232
146 3300009094 Ga0111539_10165559 Ga0111539_101655593 232
147 3300009174 Ga0105241_10432856 Ga0105241_104328562 232
148 3300009545 Ga0105237_10162351 Ga0105237_101623512 232
149 3300013100 Ga0157373_10050969 Ga0157373_100509692 232
150 3300013102 Ga0157371_10036801 Ga0157371_100368014 232
151 3300013105 Ga0157369_10011852 Ga0157369_100118523 232
152 3300013296 Ga0157374_10052046 Ga0157374_100520464 232
153 3300013296 Ga0157374_10854038 Ga0157374_108540382 232
154 3300013297 Ga0157378_10223429 Ga0157378_102234291 232
155 3300013307 Ga0157372_10000481 Ga0157372_1000048135 232
156 3300013307 Ga0157372_10157395 Ga0157372_101573953 232
157 3300013308 Ga0157375_10124906 Ga0157375_101249062 232
158 3300014325 Ga0163163_10002938 Ga0163163_100029385 232
159 3300014325 Ga0163163_10069714 Ga0163163_100697143 232
160 3300014326 Ga0157380_10048236 Ga0157380_100482362 232
161 3300014745 Ga0157377_10002681 Ga0157377_100026814 232
162 3300014968 Ga0157379_10056462 Ga0157379_100564623 232
163 3300014968 Ga0157379_10062051 Ga0157379_100620514 232
164 3300014969 Ga0157376_10431472 Ga0157376_104314721 232
165 3300025315 Ga0207697_10002035 Ga0207697_100020357 232
166 3300025893 Ga0207682_10008838 Ga0207682_100088383 232
167 3300025901 Ga0207688_10003028 Ga0207688_100030287 232
168 3300025903 Ga0207680_10010024 Ga0207680_100100242 232
169 3300025907 Ga0207645_10004453 Ga0207645_100044532 232
170 3300025907 Ga0207645_10122646 Ga0207645_101226462 232
171 3300025908 Ga0207643_10011553 Ga0207643_100115532 232
172 3300025912 Ga0207707_10208067 Ga0207707_102080672 232
173 3300025914 Ga0207671_10128332 Ga0207671_101283322 232
174 3300025918 Ga0207662_10013247 Ga0207662_100132474 232
175 3300025919 Ga0207657_10020569 Ga0207657_100205696 232
176 3300025919 Ga0207657_10052623 Ga0207657_100526232 232
177 3300025919 Ga0207657_10177349 Ga0207657_101773492 232
178 3300025920 Ga0207649_10007766 Ga0207649_100077664 232
179 3300025921 Ga0207652_10339136 Ga0207652_103391361 232
180 3300025922 Ga0207646_10412921 Ga0207646_104129212 232
181 3300025923 Ga0207681_10067033 Ga0207681_100670332 232
182 3300025925 Ga0207650_10002733 Ga0207650_100027331 232
183 3300025926 Ga0207659_10038350 Ga0207659_100383503 232
184 3300025926 Ga0207659_10124352 Ga0207659_101243523 232
185 3300025931 Ga0207644_10095849 Ga0207644_100958493 232
186 3300025931 Ga0207644_10171599 Ga0207644_101715992 232
187 3300025932 Ga0207690_10002028 Ga0207690_100020281 232
188 3300025933 Ga0207706_10000074 Ga0207706_100000745 232
189 3300025933 Ga0207706_10013695 Ga0207706_100136958 232
190 3300025936 Ga0207670_10010089 Ga0207670_100100895 232
191 3300025940 Ga0207691_10033608 Ga0207691_100336084 232
192 3300025940 Ga0207691_10234037 Ga0207691_102340371 232
193 3300025941 Ga0207711_10068327 Ga0207711_100683272 232
194 3300025942 Ga0207689_10001435 Ga0207689_100014357 232
195 3300025944 Ga0207661_10040127 Ga0207661_100401274 232
196 3300025945 Ga0207679_10023599 Ga0207679_100235994 232
197 3300025945 Ga0207679_10362461 Ga0207679_103624611 232
198 3300025949 Ga0207667_10013194 Ga0207667_100131947 232
199 3300025960 Ga0207651_10407190 Ga0207651_104071901 232
200 3300025961 Ga0207712_10052763 Ga0207712_100527632 232
201 3300025981 Ga0207640_10087955 Ga0207640_100879551 232
202 3300025981 Ga0207640_10204010 Ga0207640_102040102 232
203 3300025986 Ga0207658_10038153 Ga0207658_100381532 232
204 3300026035 Ga0207703_10027963 Ga0207703_100279635 232
205 3300026041 Ga0207639_10001107 Ga0207639_100011073 232
206 3300026067 Ga0207678_10006227 Ga0207678_100062278 232
207 3300026067 Ga0207678_10031774 Ga0207678_100317746 232
208 3300026075 Ga0207708_10049053 Ga0207708_100490532 232
209 3300026078 Ga0207702_10001390 Ga0207702_100013904 232
210 3300026088 Ga0207641_10036623 Ga0207641_100366232 232
211 3300026095 Ga0207676_10001646 Ga0207676_1000164610 232
212 3300026116 Ga0207674_10000461 Ga0207674_1000046121 232
213 3300026116 Ga0207674_10336079 Ga0207674_103360792 232
214 3300026142 Ga0207698_10412173 Ga0207698_104121732 232
215 3300026142 Ga0207698_10869110 Ga0207698_108691101 232
216 3300027665 Ga0209983_1005879 Ga0209983_10058792 232
217 3300027671 Ga0209588_1004244 Ga0209588_10042447 232
218 3300027682 Ga0209971_1008028 Ga0209971_10080284 232
219 3300027717 Ga0209998_10008078 Ga0209998_100080782 232
220 3300027876 Ga0209974_10000467 Ga0209974_100004674 232
221 3300028380 Ga0268265_10165657 Ga0268265_101656571 232
222 3300028381 Ga0268264_10153153 Ga0268264_101531532 232
223 3300031548 Ga0307408_100079604 Ga0307408_1000796042 232
224 3300031616 Ga0307508_10056909 Ga0307508_100569094 232
225 3300031731 Ga0307405_10022142 Ga0307405_100221424 232
226 3300031824 Ga0307413_10004939 Ga0307413_100049392 232
227 3300031852 Ga0307410_10025025 Ga0307410_100250253 232
228 3300031901 Ga0307406_10005075 Ga0307406_100050754 232
229 3300031911 Ga0307412_10011189 Ga0307412_100111894 232
230 3300031995 Ga0307409_100008454 Ga0307409_1000084545 232
231 3300032002 Ga0307416_100059194 Ga0307416_1000591943 232
232 3300032005 Ga0307411_10014724 Ga0307411_100147244 232
233 3300032005 Ga0307411_10238200 Ga0307411_102382002 232
234 3300032126 Ga0307415_100008439 Ga0307415_1000084395 232
235 3300035086 Ga0373934_0000731 Ga0373934_0000731_3125_3823 232
236 3300035111 Ga0373923_0000489 Ga0373923_0000489_7541_8239 232
237 3300035113 Ga0373936_0002939 Ga0373936_0002939_5403_6101 232
238 3300035117 Ga0373953_0138669 Ga0373953_0138669_23_721 232
239 3300035118 Ga0373954_0000665 Ga0373954_0000665_962_1660 232
240 3300035118 Ga0373954_0012185 Ga0373954_0012185_2978_3676 232
241 3300035119 Ga0373956_0006545 Ga0373956_0006545_571_1269 232
242 3300035120 Ga0373957_0012049 Ga0373957_0012049_915_1613 232
243 3300035170 Ga0373943_0242081 Ga0373943_0242081_155_853 232
244 3300035171 Ga0373946_0010964 Ga0373946_0010964_476_1174 232
245 3300035410 Ga0373924_0023342 Ga0373924_0023342_1623_2321 232
246 3300035692 Ga0373935_0226082 Ga0373935_0226082_571_1269 232
247 3300035695 Ga0373927_0020223 Ga0373927_0020223_3191_3889 232
248 3300035695 Ga0373927_0100850 Ga0373927_0100850_948_1646 232
249 3300035724 Ga0373933_0013442 Ga0373933_0013442_393_1091 232
250 3300037068 Ga0373925_0016379 Ga0373925_0016379_200_898 232
251 3300037068 Ga0373925_0035075 Ga0373925_0035075_699_1406 232
252 3300046454 Ga0495592_0021952 Ga0495592_0021952_1355_2053 232
253 3300046454 Ga0495592_0213636 Ga0495592_0213636_568_1266 232
254 3300046461 Ga0495641_0045813 Ga0495641_0045813_908_1606 232
255 3300046462 Ga0495651_0034753 Ga0495651_0034753_974_1672 232
256 3300046472 Ga0495580_0027507 Ga0495580_0027507_3211_3909 232
257 3300046472 Ga0495580_0103538 Ga0495580_0103538_694_1392 232
258 3300046473 Ga0495582_0000534 Ga0495582_0000534_14075_14773 232
259 3300046473 Ga0495582_0194237 Ga0495582_0194237_228_926 232
260 3300046475 Ga0495639_0006735 Ga0495639_0006735_1227_1925 232
261 3300046477 Ga0495664_0009228 Ga0495664_0009228_3854_4552 232
262 3300046499 Ga0495594_0013300 Ga0495594_0013300_1548_2246 232
263 3300046499 Ga0495594_0078827 Ga0495594_0078827_346_1044 232
264 3300046516 Ga0495628_0020369 Ga0495628_0020369_431_1129 232
265 3300046517 Ga0495630_0122796 Ga0495630_0122796_1257_1955 232
266 3300046526 Ga0495666_0012947 Ga0495666_0012947_135_833 232
267 3300046526 Ga0495666_0041319 Ga0495666_0041319_1303_2001 232
268 3300046529 Ga0495652_0041160 Ga0495652_0041160_17_715 232
269 3300046529 Ga0495652_0057079 Ga0495652_0057079_633_1331 232
270 3300046531 Ga0495665_0004851 Ga0495665_0004851_168_866 232
271 3300046535 Ga0495586_0015570 Ga0495586_0015570_450_1148 232
272 3300046536 Ga0495587_0006076 Ga0495587_0006076_1639_2337 232
273 3300046539 Ga0495621_0013697 Ga0495621_0013697_1317_2024 232
274 3300046557 Ga0495622_0257012 Ga0495622_0257012_22_720 232
275 3300046559 Ga0495667_0006636 Ga0495667_0006636_1406_2104 232
276 3300046559 Ga0495667_0119177 Ga0495667_0119177_518_1216 232
277 3300046642 Ga0495634_0004975 Ga0495634_0004975_3335_4033 232
278 3300046642 Ga0495634_0043743 Ga0495634_0043743_1175_1873 232
279 3300046663 Ga0495635_0054081 Ga0495635_0054081_1078_1776 232
280 3300046675 Ga0495657_0003112 Ga0495657_0003112_5150_5848 232
281 3300046678 Ga0495599_0023512 Ga0495599_0023512_2990_3688 232
282 3300046679 Ga0495623_0002113 Ga0495623_0002113_4344_5042 232
283 3300046681 Ga0495647_0010219 Ga0495647_0010219_392_1090 232
284 3300046681 Ga0495647_0051592 Ga0495647_0051592_39_746 232
285 3300046689 Ga0495613_0129512 Ga0495613_0129512_1077_1775 232
286 3300046690 Ga0495624_0147194 Ga0495624_0147194_33_731 232
287 3300046809 Ga0495600_0036797 Ga0495600_0036797_1721_2419 232
288 3300047315 Ga0495581_0484655 Ga0495581_0484655_10_708 232
289 3300047317 Ga0495604_0012212 Ga0495604_0012212_3909_4607 232
290 3300047319 Ga0495674_0002348 Ga0495674_0002348_6004_6702 232
291 3300047322 Ga0495680_0030498 Ga0495680_0030498_2115_2813 232
292 3300047322 Ga0495680_0066852 Ga0495680_0066852_975_1673 232
293 3300047444 Ga0495675_0045135 Ga0495675_0045135_108_806 232
294 3300047444 Ga0495675_0047688 Ga0495675_0047688_859_1557 232
295 3300047444 Ga0495675_0049677 Ga0495675_0049677_692_1390 232
296 3300047471 Ga0495684_0012196 Ga0495684_0012196_3713_4411 232
297 3300048089 Ga0495614_0114515 Ga0495614_0114515_183_881 232
298 3300048903 Ga0496100_0016595 Ga0496100_0016595_1240_1947 232
299 3300048904 Ga0496101_0362652 Ga0496101_0362652_338_1045 232
300 3300048905 Ga0496102_0009564 Ga0496102_0009564_5723_6421 232
301 3300048905 Ga0496102_0112183 Ga0496102_0112183_1145_1852 232
302 3300048907 Ga0496104_0003929 Ga0496104_0003929_8193_8900 232
303 3300048908 Ga0496105_0008045 Ga0496105_0008045_5053_5760 232
304 3300048909 Ga0496106_0007041 Ga0496106_0007041_3514_4212 232
305 3300048909 Ga0496106_0217353 Ga0496106_0217353_803_1510 232
306 3300048910 Ga0496107_0104454 Ga0496107_0104454_1139_1837 232
307 3300048910 Ga0496107_0466811 Ga0496107_0466811_209_916 232
308 3300048911 Ga0496108_0001996 Ga0496108_0001996_10101_10808 232
309 3300048912 Ga0496109_0003539 Ga0496109_0003539_4410_5117 232
310 3300048913 Ga0496110_0144508 Ga0496110_0144508_962_1660 232
311 3300048913 Ga0496110_0256538 Ga0496110_0256538_173_874 232
312 3300048913 Ga0496110_0842252 Ga0496110_0842252_67_774 232
313 3300049570 Ga0501033_0274418 Ga0501033_0274418_374_1072 232
314 3300049574 Ga0501038_0372146 Ga0501038_0372146_209_907 232
315 3300050507 nmdc:mga05p37_812439_c1 nmdc:mga05p37_812439_c1_89_799 232
316 3300050510 nmdc:mga06r32_26525_c1 nmdc:mga06r32_26525_c1_3472_4170 232
317 3300050511 nmdc:mga08y16_38519_c1 nmdc:mga08y16_38519_c1_1482_2189 232
318 3300053084 Ga0495595_0005439 Ga0495595_0005439_3595_4293 232
319 3300053085 Ga0495619_0007281 Ga0495619_0007281_1406_2104 232
320 3300003308 Ga0006777J48905_1134701 Ga0006777J48905_11347011 233
321 3300003544 Ga0007417J51691_1028844 Ga0007417J51691_10288441 233
322 3300003574 Ga0007410J51695_1043264 Ga0007410J51695_10432641 233
323 3300004625 Ga0055543_1008850 Ga0055543_10088503 233
324 3300005262 Ga0065165_1000156 Ga0065165_100015691 233
325 3300005262 Ga0065165_1001173 Ga0065165_100117314 233
326 3300005543 Ga0070672_100044821 Ga0070672_1000448211 233
327 3300005841 Ga0068863_100123501 Ga0068863_1001235012 233
328 3300006237 Ga0097621_100177020 Ga0097621_1001770202 233
329 3300006358 Ga0068871_100454979 Ga0068871_1004549791 233
330 3300009094 Ga0111539_10247938 Ga0111539_102479381 233
331 3300013307 Ga0157372_10225302 Ga0157372_102253023 233
332 3300025254 Ga0209148_1000280 Ga0209148_100028040 233
333 3300025284 Ga0209130_1000268 Ga0209130_100026840 233
334 3300025302 Ga0207426_1007139 Ga0207426_10071392 233
335 3300025898 Ga0207692_10147638 Ga0207692_101476381 233
336 3300025940 Ga0207691_10076932 Ga0207691_100769321 233
337 3300025960 Ga0207651_10032167 Ga0207651_100321674 233
338 3300026088 Ga0207641_10090036 Ga0207641_100900361 233
339 3300035120 Ga0373957_0108248 Ga0373957_0108248_301_1002 233
340 3300036401 Ga0373937_0128403 Ga0373937_0128403_247_948 233
341 3300037312 Ga0395899_0150009 Ga0395899_0150009_520_1221 233
342 3300037418 Ga0395900_0000297 Ga0395900_0000297_24722_25468 233
343 3300037418 Ga0395900_0080416 Ga0395900_0080416_2379_3080 233
344 3300037471 Ga0395905_0127754 Ga0395905_0127754_51_752 233
345 3300037471 Ga0395905_0563293 Ga0395905_0563293_150_851 233
346 3300046452 Ga0495617_000039 Ga0495617_000039_40389_41090 233
347 3300046453 Ga0495627_000303 Ga0495627_000303_24629_25330 233
348 3300046453 Ga0495627_004164 Ga0495627_004164_892_1593 233
349 3300046453 Ga0495627_101361 Ga0495627_101361_58_759 233
350 3300046457 Ga0495590_0000018 Ga0495590_0000018_29729_30430 233
351 3300046457 Ga0495590_0014881 Ga0495590_0014881_1500_2201 233
352 3300046458 Ga0495591_000134 Ga0495591_000134_27001_27702 233
353 3300046460 Ga0495638_0014015 Ga0495638_0014015_666_1367 233
354 3300046460 Ga0495638_0078208 Ga0495638_0078208_157_858 233
355 3300046463 Ga0495653_0079220 Ga0495653_0079220_251_1078 233
356 3300046471 Ga0495650_0111221 Ga0495650_0111221_148_849 233
357 3300046473 Ga0495582_0033767 Ga0495582_0033767_1825_2526 233
358 3300046474 Ga0495605_0001258 Ga0495605_0001258_2394_3095 233
359 3300046474 Ga0495605_0001847 Ga0495605_0001847_9247_9948 233
360 3300046474 Ga0495605_0014011 Ga0495605_0014011_2088_2789 233
361 3300046474 Ga0495605_0032164 Ga0495605_0032164_1672_2373 233
362 3300046491 Ga0495584_0000243 Ga0495584_0000243_29186_29887 233
363 3300046491 Ga0495584_0004813 Ga0495584_0004813_243_944 233
364 3300046491 Ga0495584_0012074 Ga0495584_0012074_633_1334 233
365 3300046491 Ga0495584_0025191 Ga0495584_0025191_680_1381 233
366 3300046491 Ga0495584_0084103 Ga0495584_0084103_716_1417 233
367 3300046491 Ga0495584_0204916 Ga0495584_0204916_27_728 233
368 3300046492 Ga0495585_0004757 Ga0495585_0004757_6963_7664 233
369 3300046492 Ga0495585_0034364 Ga0495585_0034364_990_1691 233
370 3300046492 Ga0495585_0038865 Ga0495585_0038865_1808_2509 233
371 3300046492 Ga0495585_0049092 Ga0495585_0049092_994_1695 233
372 3300046492 Ga0495585_0055116 Ga0495585_0055116_828_1529 233
373 3300046499 Ga0495594_0004358 Ga0495594_0004358_5699_6400 233
374 3300046499 Ga0495594_0028902 Ga0495594_0028902_1648_2349 233
375 3300046499 Ga0495594_0085781 Ga0495594_0085781_936_1658 233
376 3300046500 Ga0495596_0015492 Ga0495596_0015492_81_782 233
377 3300046500 Ga0495596_0021676 Ga0495596_0021676_1681_2382 233
378 3300046500 Ga0495596_0022501 Ga0495596_0022501_1196_1897 233
379 3300046500 Ga0495596_0024640 Ga0495596_0024640_1520_2221 233
380 3300046500 Ga0495596_0028461 Ga0495596_0028461_1345_2046 233
381 3300046500 Ga0495596_0033331 Ga0495596_0033331_459_1160 233
382 3300046500 Ga0495596_0099100 Ga0495596_0099100_383_1084 233
383 3300046501 Ga0495607_0001206 Ga0495607_0001206_12743_13444 233
384 3300046501 Ga0495607_0001465 Ga0495607_0001465_10007_10708 233
385 3300046501 Ga0495607_0047107 Ga0495607_0047107_1343_2044 233
386 3300046501 Ga0495607_0050603 Ga0495607_0050603_833_1534 233
387 3300046501 Ga0495607_0052716 Ga0495607_0052716_660_1361 233
388 3300046501 Ga0495607_0171275 Ga0495607_0171275_261_962 233
389 3300046506 Ga0495583_0000377 Ga0495583_0000377_9305_10006 233
390 3300046506 Ga0495583_0001102 Ga0495583_0001102_10918_11619 233
391 3300046506 Ga0495583_0013112 Ga0495583_0013112_93_794 233
392 3300046506 Ga0495583_0029758 Ga0495583_0029758_1578_2279 233
393 3300046506 Ga0495583_0041668 Ga0495583_0041668_1388_2089 233
394 3300046506 Ga0495583_0044111 Ga0495583_0044111_304_1122 233
395 3300046507 Ga0495606_0020046 Ga0495606_0020046_359_1060 233
396 3300046507 Ga0495606_0101758 Ga0495606_0101758_110_811 233
397 3300046507 Ga0495606_0108041 Ga0495606_0108041_288_989 233
398 3300046512 Ga0495610_0000147 Ga0495610_0000147_33733_34434 233
399 3300046513 Ga0495616_0000175 Ga0495616_0000175_32186_32989 233
400 3300046513 Ga0495616_0004688 Ga0495616_0004688_7841_8542 233
401 3300046513 Ga0495616_0005403 Ga0495616_0005403_6769_7515 233
402 3300046513 Ga0495616_0016092 Ga0495616_0016092_1469_2170 233
403 3300046513 Ga0495616_0045377 Ga0495616_0045377_1475_2176 233
404 3300046513 Ga0495616_0048260 Ga0495616_0048260_1308_2009 233
405 3300046513 Ga0495616_0053522 Ga0495616_0053522_276_1127 233
406 3300046518 Ga0495631_0000028 Ga0495631_0000028_62095_62796 233
407 3300046518 Ga0495631_0001122 Ga0495631_0001122_11407_12108 233
408 3300046518 Ga0495631_0008662 Ga0495631_0008662_2825_3526 233
409 3300046518 Ga0495631_0009878 Ga0495631_0009878_2436_3239 233
410 3300046518 Ga0495631_0014639 Ga0495631_0014639_1508_2209 233
411 3300046518 Ga0495631_0017486 Ga0495631_0017486_1661_2362 233
412 3300046518 Ga0495631_0022437 Ga0495631_0022437_2090_2791 233
413 3300046518 Ga0495631_0074151 Ga0495631_0074151_417_1118 233
414 3300046519 Ga0495632_0000267 Ga0495632_0000267_23393_24094 233
415 3300046519 Ga0495632_0000684 Ga0495632_0000684_5138_5839 233
416 3300046519 Ga0495632_0003767 Ga0495632_0003767_407_1153 233
417 3300046519 Ga0495632_0006115 Ga0495632_0006115_1149_1850 233
418 3300046519 Ga0495632_0015831 Ga0495632_0015831_1642_2343 233
419 3300046519 Ga0495632_0018018 Ga0495632_0018018_2954_3658 233
420 3300046519 Ga0495632_0018226 Ga0495632_0018226_1978_2679 233
421 3300046519 Ga0495632_0041634 Ga0495632_0041634_31_732 233
422 3300046520 Ga0495637_0000004 Ga0495637_0000004_424131_424832 233
423 3300046522 Ga0495643_0001557 Ga0495643_0001557_7811_8557 233
424 3300046522 Ga0495643_0014626 Ga0495643_0014626_1112_1813 233
425 3300046522 Ga0495643_0069576 Ga0495643_0069576_624_1325 233
426 3300046523 Ga0495644_0001291 Ga0495644_0001291_7524_8225 233
427 3300046523 Ga0495644_0002623 Ga0495644_0002623_2228_2929 233
428 3300046523 Ga0495644_0008124 Ga0495644_0008124_1108_1809 233
429 3300046523 Ga0495644_0015220 Ga0495644_0015220_780_1481 233
430 3300046523 Ga0495644_0023219 Ga0495644_0023219_292_993 233
431 3300046524 Ga0495648_0011379 Ga0495648_0011379_2753_3454 233
432 3300046524 Ga0495648_0014105 Ga0495648_0014105_1672_2373 233
433 3300046524 Ga0495648_0026581 Ga0495648_0026581_1000_1701 233
434 3300046524 Ga0495648_0070625 Ga0495648_0070625_937_1638 233
435 3300046526 Ga0495666_0007773 Ga0495666_0007773_2333_3034 233
436 3300046528 Ga0495642_0000081 Ga0495642_0000081_41635_42336 233
437 3300046528 Ga0495642_0001200 Ga0495642_0001200_9380_10081 233
438 3300046528 Ga0495642_0014072 Ga0495642_0014072_730_1431 233
439 3300046528 Ga0495642_0040548 Ga0495642_0040548_443_1144 233
440 3300046528 Ga0495642_0042669 Ga0495642_0042669_1051_1752 233
441 3300046530 Ga0495654_0007829 Ga0495654_0007829_4838_5539 233
442 3300046530 Ga0495654_0053124 Ga0495654_0053124_415_1116 233
443 3300046533 Ga0495640_0379882 Ga0495640_0379882_153_854 233
444 3300046538 Ga0495609_0006889 Ga0495609_0006889_1744_2445 233
445 3300046538 Ga0495609_0008883 Ga0495609_0008883_4040_4741 233
446 3300046538 Ga0495609_0015800 Ga0495609_0015800_1009_1860 233
447 3300046538 Ga0495609_0016598 Ga0495609_0016598_269_970 233
448 3300046538 Ga0495609_0031754 Ga0495609_0031754_1686_2387 233
449 3300046538 Ga0495609_0093622 Ga0495609_0093622_289_990 233
450 3300046538 Ga0495609_0128119 Ga0495609_0128119_151_852 233
451 3300046542 Ga0495597_0000187 Ga0495597_0000187_42648_43349 233
452 3300046542 Ga0495597_0000404 Ga0495597_0000404_23392_24195 233
453 3300046542 Ga0495597_0002432 Ga0495597_0002432_2864_3565 233
454 3300046542 Ga0495597_0028870 Ga0495597_0028870_691_1509 233
455 3300046542 Ga0495597_0031584 Ga0495597_0031584_1037_1738 233
456 3300046542 Ga0495597_0044231 Ga0495597_0044231_322_1023 233
457 3300046542 Ga0495597_0092019 Ga0495597_0092019_421_1122 233
458 3300046557 Ga0495622_0049992 Ga0495622_0049992_256_957 233
459 3300046558 Ga0495633_0001359 Ga0495633_0001359_13269_13970 233
460 3300046558 Ga0495633_0009075 Ga0495633_0009075_3215_3928 233
461 3300046558 Ga0495633_0019652 Ga0495633_0019652_1759_2460 233
462 3300046558 Ga0495633_0051380 Ga0495633_0051380_25_726 233
463 3300046615 Ga0495656_0040782 Ga0495656_0040782_946_1647 233
464 3300046615 Ga0495656_0117989 Ga0495656_0117989_106_807 233
465 3300046615 Ga0495656_0138753 Ga0495656_0138753_53_754 233
466 3300046616 Ga0495668_0000603 Ga0495668_0000603_3326_4027 233
467 3300046616 Ga0495668_0001327 Ga0495668_0001327_22045_22746 233
468 3300046616 Ga0495668_0003472 Ga0495668_0003472_2394_3095 233
469 3300046616 Ga0495668_0008015 Ga0495668_0008015_661_1362 233
470 3300046616 Ga0495668_0023093 Ga0495668_0023093_1266_1967 233
471 3300046616 Ga0495668_0025211 Ga0495668_0025211_2030_2731 233
472 3300046616 Ga0495668_0025226 Ga0495668_0025226_1144_1845 233
473 3300046616 Ga0495668_0049134 Ga0495668_0049134_967_1668 233
474 3300046616 Ga0495668_0107029 Ga0495668_0107029_361_1062 233
475 3300046616 Ga0495668_0110488 Ga0495668_0110488_567_1268 233
476 3300046616 Ga0495668_0165995 Ga0495668_0165995_304_1005 233
477 3300046648 Ga0495611_0001261 Ga0495611_0001261_6288_6989 233
478 3300046648 Ga0495611_0002381 Ga0495611_0002381_4934_5635 233
479 3300046648 Ga0495611_0032033 Ga0495611_0032033_28_729 233
480 3300046660 Ga0495625_0019644 Ga0495625_0019644_1686_2387 233
481 3300046660 Ga0495625_0063631 Ga0495625_0063631_770_1471 233
482 3300046660 Ga0495625_0096352 Ga0495625_0096352_1303_2004 233
483 3300046660 Ga0495625_0141008 Ga0495625_0141008_178_1029 233
484 3300046663 Ga0495635_0081969 Ga0495635_0081969_214_1041 233
485 3300046665 Ga0495661_0003069 Ga0495661_0003069_7208_7954 233
486 3300046665 Ga0495661_0003405 Ga0495661_0003405_3026_3727 233
487 3300046665 Ga0495661_0007004 Ga0495661_0007004_5582_6295 233
488 3300046665 Ga0495661_0019568 Ga0495661_0019568_1864_2565 233
489 3300046665 Ga0495661_0034655 Ga0495661_0034655_1393_2094 233
490 3300046665 Ga0495661_0066800 Ga0495661_0066800_255_956 233
491 3300046674 Ga0495588_0004759 Ga0495588_0004759_4384_5085 233
492 3300046674 Ga0495588_0005321 Ga0495588_0005321_3022_3723 233
493 3300046674 Ga0495588_0022699 Ga0495588_0022699_940_1641 233
494 3300046674 Ga0495588_0143479 Ga0495588_0143479_471_1172 233
495 3300046684 Ga0495669_0000174 Ga0495669_0000174_12786_13487 233
496 3300046684 Ga0495669_0002474 Ga0495669_0002474_3435_4136 233
497 3300046684 Ga0495669_0004825 Ga0495669_0004825_1537_2238 233
498 3300046684 Ga0495669_0007519 Ga0495669_0007519_2324_3025 233
499 3300046684 Ga0495669_0017305 Ga0495669_0017305_1032_1733 233
500 3300046684 Ga0495669_0025169 Ga0495669_0025169_28_729 233
501 3300046684 Ga0495669_0056497 Ga0495669_0056497_912_1613 233
502 3300046691 Ga0495670_0001204 Ga0495670_0001204_6492_7205 233
503 3300046691 Ga0495670_0017542 Ga0495670_0017542_526_1227 233
504 3300046691 Ga0495670_0058698 Ga0495670_0058698_1114_1815 233
505 3300046692 Ga0495671_0000338 Ga0495671_0000338_15944_16645 233
506 3300046692 Ga0495671_0000846 Ga0495671_0000846_16195_16896 233
507 3300046692 Ga0495671_0016291 Ga0495671_0016291_2218_2919 233
508 3300046692 Ga0495671_0240164 Ga0495671_0240164_116_817 233
509 3300046694 Ga0495649_0000355 Ga0495649_0000355_6503_7204 233
510 3300046694 Ga0495649_0003389 Ga0495649_0003389_6181_6882 233
511 3300046694 Ga0495649_0022143 Ga0495649_0022143_2034_2735 233
512 3300046694 Ga0495649_0068786 Ga0495649_0068786_600_1301 233
513 3300046694 Ga0495649_0143406 Ga0495649_0143406_84_785 233
514 3300046794 Ga0495589_0000441 Ga0495589_0000441_5493_6194 233
515 3300046794 Ga0495589_0000813 Ga0495589_0000813_10156_10857 233
516 3300046794 Ga0495589_0002969 Ga0495589_0002969_5049_5750 233
517 3300046794 Ga0495589_0009670 Ga0495589_0009670_2068_2919 233
518 3300046794 Ga0495589_0015895 Ga0495589_0015895_2823_3524 233
519 3300046794 Ga0495589_0017623 Ga0495589_0017623_1864_2565 233
520 3300046810 Ga0495660_0001242 Ga0495660_0001242_10403_11104 233
521 3300046810 Ga0495660_0054162 Ga0495660_0054162_1032_1733 233
522 3300046810 Ga0495660_0056767 Ga0495660_0056767_336_1037 233
523 3300046810 Ga0495660_0089629 Ga0495660_0089629_77_778 233
524 3300047315 Ga0495581_0392117 Ga0495581_0392117_28_783 233
525 3300047317 Ga0495604_0108536 Ga0495604_0108536_157_858 233
526 3300047318 Ga0495636_0010339 Ga0495636_0010339_2973_3674 233
527 3300047320 Ga0495672_0000126 Ga0495672_0000126_68509_69210 233
528 3300047320 Ga0495672_0056639 Ga0495672_0056639_1370_2221 233
529 3300047321 Ga0495676_0000047 Ga0495676_0000047_78541_79242 233
530 3300047322 Ga0495680_0007593 Ga0495680_0007593_233_1060 233
531 3300047323 Ga0495683_0000214 Ga0495683_0000214_21570_22271 233
532 3300047323 Ga0495683_0044543 Ga0495683_0044543_276_977 233
533 3300047323 Ga0495683_0162185 Ga0495683_0162185_119_820 233
534 3300047443 Ga0495687_000002 Ga0495687_000002_1024725_1025426 233
535 3300047443 Ga0495687_000017 Ga0495687_000017_26698_27399 233
536 3300047443 Ga0495687_007764 Ga0495687_007764_2393_3094 233
537 3300047444 Ga0495675_0010331 Ga0495675_0010331_3828_4655 233
538 3300047445 Ga0495677_0000292 Ga0495677_0000292_13812_14591 233
539 3300047445 Ga0495677_0000887 Ga0495677_0000887_9037_9738 233
540 3300047445 Ga0495677_0001264 Ga0495677_0001264_2475_3221 233
541 3300047445 Ga0495677_0004012 Ga0495677_0004012_2682_3383 233
542 3300047445 Ga0495677_0004242 Ga0495677_0004242_1461_2162 233
543 3300047446 Ga0495679_008925 Ga0495679_008925_2615_3316 233
544 3300047446 Ga0495679_011252 Ga0495679_011252_541_1242 233
545 3300047446 Ga0495679_024830 Ga0495679_024830_1131_1832 233
546 3300047447 Ga0495685_035140 Ga0495685_035140_975_1676 233
547 3300047447 Ga0495685_073093 Ga0495685_073093_325_1026 233
548 3300047470 Ga0495681_0000213 Ga0495681_0000213_11344_12045 233
549 3300047470 Ga0495681_0000629 Ga0495681_0000629_2912_3613 233
550 3300047470 Ga0495681_0004133 Ga0495681_0004133_3607_4308 233
551 3300047470 Ga0495681_0017002 Ga0495681_0017002_1864_2565 233
552 3300047470 Ga0495681_0028671 Ga0495681_0028671_691_1392 233
553 3300047470 Ga0495681_0037654 Ga0495681_0037654_280_981 233
554 3300047472 Ga0495686_0000248 Ga0495686_0000248_38854_39555 233
555 3300047472 Ga0495686_0000350 Ga0495686_0000350_2431_3132 233
556 3300047472 Ga0495686_0035961 Ga0495686_0035961_1546_2247 233
557 3300048091 Ga0495626_0010864 Ga0495626_0010864_447_1148 233
558 3300048091 Ga0495626_0012884 Ga0495626_0012884_3382_4128 233
559 3300048091 Ga0495626_0014087 Ga0495626_0014087_1469_2170 233
560 3300048091 Ga0495626_0020798 Ga0495626_0020798_977_1678 233
561 3300048091 Ga0495626_0024969 Ga0495626_0024969_2161_2862 233
562 3300048091 Ga0495626_0031890 Ga0495626_0031890_1379_2080 233
563 3300048091 Ga0495626_0068054 Ga0495626_0068054_703_1404 233
564 3300048091 Ga0495626_0080376 Ga0495626_0080376_271_972 233
565 3300048905 Ga0496102_0000306 Ga0496102_0000306_36033_36734 233
566 3300048905 Ga0496102_0300928 Ga0496102_0300928_565_1266 233
567 3300048913 Ga0496110_0000031 Ga0496110_0000031_61201_61902 233
568 3300048914 Ga0496111_0034738 Ga0496111_0034738_1072_1773 233
569 3300048917 Ga0496114_0276929 Ga0496114_0276929_187_894 233
570 3300048918 Ga0496115_0280358 Ga0496115_0280358_514_1215 233
571 3300048927 Ga0496124_0023019 Ga0496124_0023019_4114_4875 233
572 3300048927 Ga0496124_0227281 Ga0496124_0227281_522_1223 233
573 3300049128 Ga0501308_008319 Ga0501308_008319_334_1035 233
574 3300049459 Ga0495678_000121 Ga0495678_000121_88815_89516 233
575 3300049459 Ga0495678_000371 Ga0495678_000371_22179_22880 233
576 3300049459 Ga0495678_000722 Ga0495678_000722_27720_28421 233
577 3300049459 Ga0495678_001149 Ga0495678_001149_3291_3992 233
578 3300049459 Ga0495678_015016 Ga0495678_015016_1356_2057 233
579 3300049460 Ga0495682_0000155 Ga0495682_0000155_27997_28698 233
580 3300049460 Ga0495682_0008564 Ga0495682_0008564_1624_2325 233
581 3300049460 Ga0495682_0026482 Ga0495682_0026482_1273_1974 233
582 3300049460 Ga0495682_0043757 Ga0495682_0043757_868_1569 233
583 3300049531 Ga0501315_011342 Ga0501315_011342_42_743 233
584 3300049531 Ga0501315_012996 Ga0501315_012996_69_770 233
585 3300049575 Ga0501039_0317920 Ga0501039_0317920_46_747 233
586 3300049584 Ga0501068_0026702 Ga0501068_0026702_2061_2762 233
587 3300049585 Ga0501069_0025868 Ga0501069_0025868_1473_2174 233
588 3300049587 Ga0501071_0021131 Ga0501071_0021131_1316_2017 233
589 3300049588 Ga0501072_0131932 Ga0501072_0131932_1061_1762 233
590 3300049589 Ga0501073_0004140 Ga0501073_0004140_1698_2399 233
591 3300049590 Ga0501074_0147996 Ga0501074_0147996_888_1589 233
592 3300049592 Ga0501076_0078551 Ga0501076_0078551_190_891 233
593 3300049593 Ga0501077_0000288 Ga0501077_0000288_4336_5037 233
594 3300049706 Ga0501229_008742 Ga0501229_008742_303_1004 233
595 3300049741 Ga0501079_0121060 Ga0501079_0121060_1315_2016 233
596 3300049742 Ga0501080_0001913 Ga0501080_0001913_16888_17589 233
597 3300049744 Ga0501083_0025178 Ga0501083_0025178_178_879 233
598 3300049766 Ga0501269_013608 Ga0501269_013608_213_914 233
599 3300050491 nmdc:mga00v17_208130_c1 nmdc:mga00v17_208130_c1_386_1087 233
600 3300050511 nmdc:mga08y16_195630_c1 nmdc:mga08y16_195630_c1_956_1666 233
601 3300054114 Ga0501084_0005439 Ga0501084_0005439_4287_4988 233
602 3300060353 Ga0501082_0077873 Ga0501082_0077873_1153_1854 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

196

281

0.99

PF02678

Pirin

Pirin

53

169

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9713 1 231
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9667 1 231
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9549 1 231
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9544 1 231
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.841 34 119
ID Description Score Start End Superfamily
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9707 11 134 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9696 13 130 2.60.120.10
af_P46852_133_231_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9668 142 231 2.60.120.10
1tq5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9666 141 231 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9628 11 134 2.60.120.10
ID Description Score Start End GO Terms
AF-A7HDG4-F1-model_v4 Pirin domain protein 0.9904 1 230
AF-A0A0K3A9X6-F1-model_v4 Quercetin 2,3-dioxygenase 0.9896 63 232
AF-A0A2H1PM95-F1-model_v4 deleted 0.9886 1 182
AF-A0A353HYM2-F1-model_v4 Quercetin 2,3-dioxygenase 0.9882 1 207 GO:0046872
GO:0051213
AF-A0A2N2S029-F1-model_v4 Quercetin 2,3-dioxygenase 0.987 1 231 GO:0046872
GO:0051213

Feature Viewer

pLDDT pTM Quality
96.01 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map