F468175

General Info

Members Datasets Scaffolds Average Seq Length
602 286 1204 132

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11000515|Ga0163162_110005152
Length 130
Sequence MATDVSATFEVTGWDERPLDETDGAVKWTQSSVTKTFRGDIDGTAALEYLMVYAADGSATFVGLERLQGRVAGRSGTFVLQHVGRFEDGAAKGNLTVATGSGTGDLAGLAGGGTFLADPSGSIDLSVTFD

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
195 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
259 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
260 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
269 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
270 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.99
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 31.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_11000515 3300013306 Bacteria 945
2 MRS1b_contig_4143441 2162886011 Unclassified 822
3 MBSR1b_contig_6132909 2162886012 Bacteria 952
4 Ga0058861_11426154 3300004800 Unclassified 548
5 Ga0065712_10080964 3300005290 Bacteria 3052
6 Ga0065712_10299561 3300005290 Bacteria 862
7 Ga0065715_10125708 3300005293 Unclassified 2124
8 Ga0065715_10159684 3300005293 Bacteria 1642
9 Ga0070683_100299201 3300005329 Unclassified 1531
10 Ga0070690_100318401 3300005330 Bacteria 1120
11 Ga0070680_100057478 3300005336 Bacteria 3180
12 Ga0070680_100366749 3300005336 Bacteria 1225
13 Ga0070680_100433390 3300005336 Unclassified 1122
14 Ga0068868_101863171 3300005338 Unclassified 569
15 Ga0070660_100159195 3300005339 Bacteria 1819
16 Ga0070689_100000341 3300005340 Bacteria 27296
17 Ga0070689_100003170 3300005340 Bacteria 10876
18 Ga0070689_100385453 3300005340 Bacteria 1182
19 Ga0070691_10007472 3300005341 Bacteria 5011
20 Ga0070691_10138167 3300005341 Bacteria 1240
21 Ga0070687_100002284 3300005343 Bacteria 7118
22 Ga0070692_10613117 3300005345 Bacteria 722
23 Ga0070668_100440582 3300005347 Bacteria 1118
24 Ga0070669_101275526 3300005353 Unclassified 636
25 Ga0070675_100005043 3300005354 Bacteria 10079
26 Ga0070675_101150287 3300005354 Bacteria 714
27 Ga0070671_100003681 3300005355 Bacteria 12021
28 Ga0070671_101127598 3300005355 Bacteria 689
29 Ga0070674_100001128 3300005356 Bacteria 14047
30 Ga0070673_100720114 3300005364 Bacteria 917
31 Ga0070688_100000233 3300005365 Bacteria 29111
32 Ga0070688_100000348 3300005365 Bacteria 23526
33 Ga0070688_101803723 3300005365 Unclassified 502
34 Ga0070659_100990269 3300005366 Unclassified 738
35 Ga0070659_101317297 3300005366 Bacteria 641
36 Ga0070703_10015378 3300005406 Bacteria 2188
37 Ga0070703_10203064 3300005406 Bacteria 779
38 Ga0070703_10361689 3300005406 Bacteria 622
39 Ga0070709_10004593 3300005434 Bacteria 7457
40 Ga0070709_10115223 3300005434 Unclassified 1812
41 Ga0070714_100030417 3300005435 Unclassified 4494
42 Ga0070714_101041995 3300005435 Bacteria 797
43 Ga0070714_102368422 3300005435 Unclassified 516
44 Ga0070713_100000229 3300005436 Bacteria 37199
45 Ga0070713_100141182 3300005436 Bacteria 2134
46 Ga0070713_100516152 3300005436 Bacteria 1129
47 Ga0070713_100516542 3300005436 Unclassified 1128
48 Ga0070701_10034972 3300005438 Bacteria 2521
49 Ga0070701_10046204 3300005438 Bacteria 2237
50 Ga0070701_10587992 3300005438 Bacteria 735
51 Ga0070701_10729729 3300005438 Bacteria 669
52 Ga0070711_100000715 3300005439 Bacteria 17365
53 Ga0070705_100019522 3300005440 Bacteria 3568
54 Ga0070705_100969880 3300005440 Viruses 688
55 Ga0070700_100036303 3300005441 Bacteria 2988
56 Ga0070700_100125702 3300005441 Bacteria 1724
57 Ga0070694_100021598 3300005444 Unclassified 4116
58 Ga0070694_100028856 3300005444 Unclassified 3615
59 Ga0070694_100069204 3300005444 Bacteria 2427
60 Ga0070694_100069244 3300005444 Unclassified 2427
61 Ga0070694_100432835 3300005444 Bacteria 1035
62 Ga0070708_100037270 3300005445 Bacteria 4241
63 Ga0070708_100431515 3300005445 Unclassified 1243
64 Ga0070708_100618701 3300005445 Bacteria 1021
65 Ga0070708_100780553 3300005445 Bacteria 898
66 Ga0070708_100930833 3300005445 Unclassified 816
67 Ga0070678_101683221 3300005456 Unclassified 597
68 Ga0070662_100297705 3300005457 Unclassified 1310
69 Ga0070681_10001143 3300005458 Bacteria 22860
70 Ga0070681_10005906 3300005458 Bacteria 11849
71 Ga0070681_10198183 3300005458 Bacteria 1926
72 Ga0070681_10661876 3300005458 Bacteria 959
73 Ga0068867_100943719 3300005459 Bacteria 779
74 Ga0070685_10008535 3300005466 Bacteria 5270
75 Ga0070706_100063119 3300005467 Unclassified 3423
76 Ga0070706_100515582 3300005467 Bacteria 1112
77 Ga0070706_101828403 3300005467 Bacteria 552
78 Ga0070707_100047363 3300005468 Bacteria 4115
79 Ga0070707_100137079 3300005468 Unclassified 2381
80 Ga0070707_101101481 3300005468 Unclassified 760
81 Ga0070707_101351485 3300005468 Bacteria 679
82 Ga0070698_100109596 3300005471 Bacteria 2727
83 Ga0070698_100218360 3300005471 Bacteria 1840
84 Ga0070698_100450224 3300005471 Bacteria 1223
85 Ga0070698_100821104 3300005471 Unclassified 874
86 Ga0070699_100005198 3300005518 Bacteria 11443
87 Ga0070699_100060638 3300005518 Bacteria 3279
88 Ga0070699_100417835 3300005518 Bacteria 1214
89 Ga0070699_100714436 3300005518 Unclassified 916
90 Ga0070679_100051335 3300005530 Bacteria 4108
91 Ga0070679_100109056 3300005530 Bacteria 2755
92 Ga0070679_100679634 3300005530 Bacteria 972
93 Ga0070679_101483994 3300005530 Bacteria 625
94 Ga0070684_100943649 3300005535 Unclassified 809
95 Ga0070684_101198463 3300005535 Bacteria 714
96 Ga0070684_101780125 3300005535 Bacteria 581
97 Ga0070697_100014537 3300005536 Bacteria 6182
98 Ga0070697_100297098 3300005536 Bacteria 1388
99 Ga0070697_100363893 3300005536 Bacteria 1250
100 Ga0070697_101433820 3300005536 Unclassified 617
101 Ga0070672_100283783 3300005543 Bacteria 1401
102 Ga0070672_100357338 3300005543 Bacteria 1246
103 Ga0070672_100789007 3300005543 Bacteria 835
104 Ga0070686_100027697 3300005544 Bacteria 3431
105 Ga0070686_100551242 3300005544 Unclassified 902
106 Ga0070686_100621905 3300005544 Unclassified 853
107 Ga0070695_100001010 3300005545 Bacteria 15324
108 Ga0070695_100012637 3300005545 Bacteria 5068
109 Ga0070695_100074733 3300005545 Unclassified 2227
110 Ga0070695_100107441 3300005545 Bacteria 1888
111 Ga0070695_100662820 3300005545 Bacteria 825
112 Ga0070696_100008270 3300005546 Bacteria 6964
113 Ga0070696_100247336 3300005546 Bacteria 1347
114 Ga0070696_100424944 3300005546 Bacteria 1044
115 Ga0070696_100532914 3300005546 Bacteria 938
116 Ga0070693_101199045 3300005547 Bacteria 583
117 Ga0070704_100136526 3300005549 Bacteria 1909
118 Ga0070704_100238694 3300005549 Bacteria 1486
119 Ga0070704_100619563 3300005549 Bacteria 953
120 Ga0070704_100626958 3300005549 Unclassified 947
121 Ga0070704_100690155 3300005549 Bacteria 904
122 Ga0070704_101370672 3300005549 Unclassified 648
123 Ga0070704_101432817 3300005549 Unclassified 634
124 Ga0068855_100281628 3300005563 Bacteria 1846
125 Ga0070664_100789283 3300005564 Bacteria 887
126 Ga0070664_100977270 3300005564 Unclassified 795
127 Ga0070664_102146932 3300005564 Unclassified 530
128 Ga0068857_100182495 3300005577 Bacteria 1910
129 Ga0068856_100165136 3300005614 Bacteria 2225
130 Ga0068856_101243858 3300005614 Unclassified 760
131 Ga0070702_100191584 3300005615 Bacteria 1346
132 Ga0070702_100202519 3300005615 Unclassified 1315
133 Ga0070702_100651806 3300005615 Bacteria 796
134 Ga0068859_100098470 3300005617 Bacteria 2978
135 Ga0068859_100768455 3300005617 Bacteria 1052
136 Ga0068859_101009484 3300005617 Bacteria 914
137 Ga0068859_101176787 3300005617 Unclassified 844
138 Ga0068864_100004125 3300005618 Bacteria 11926
139 Ga0068866_10746293 3300005718 Archaea 676
140 Ga0068861_100481742 3300005719 Unclassified 1118
141 Ga0068863_100024077 3300005841 Bacteria 5809
142 Ga0068863_100084045 3300005841 Bacteria 3017
143 Ga0068858_100046017 3300005842 Bacteria 4045
144 Ga0068858_100768560 3300005842 Bacteria 939
145 Ga0068858_100853703 3300005842 Bacteria 889
146 Ga0068860_100682814 3300005843 Unclassified 1036
147 Ga0068862_100454126 3300005844 Bacteria 1208
148 Ga0068862_100636578 3300005844 Bacteria 1027
149 Ga0068862_102254572 3300005844 Bacteria 556
150 Ga0070717_10014030 3300006028 Bacteria 6157
151 Ga0070717_10458599 3300006028 Unclassified 1149
152 Ga0070717_10566898 3300006028 Unclassified 1029
153 Ga0070716_100359347 3300006173 Bacteria 1034
154 Ga0070712_100008399 3300006175 Bacteria 6493
155 Ga0070712_100014487 3300006175 Bacteria 5061
156 Ga0070712_100405255 3300006175 Unclassified 1127
157 Ga0070712_101046440 3300006175 Unclassified 707
158 Ga0097621_101018818 3300006237 Bacteria 775
159 Ga0068871_100850652 3300006358 Bacteria 843
160 Ga0075428_100011025 3300006844 Bacteria 10053
161 Ga0075428_100037835 3300006844 Bacteria 5310
162 Ga0075428_100468318 3300006844 Bacteria 1349
163 Ga0075428_100556423 3300006844 Unclassified 1226
164 Ga0075428_100992590 3300006844 Unclassified 889
165 Ga0075428_101541595 3300006844 Unclassified 696
166 Ga0075428_102120030 3300006844 Bacteria 581
167 Ga0075430_100604664 3300006846 Bacteria 905
168 Ga0075431_100292635 3300006847 Bacteria 1647
169 Ga0075431_100437548 3300006847 Unclassified 1305
170 Ga0075431_100512852 3300006847 Unclassified 1189
171 Ga0075431_100642080 3300006847 Viruses 1043
172 Ga0075431_100784731 3300006847 Bacteria 926
173 Ga0075431_100876436 3300006847 Bacteria 868
174 Ga0075431_101616520 3300006847 Unclassified 606
175 Ga0075433_10010933 3300006852 Bacteria 7302
176 Ga0075433_10045910 3300006852 Bacteria 3799
177 Ga0075433_10151746 3300006852 Bacteria 2061
178 Ga0075433_10201625 3300006852 Bacteria 1769
179 Ga0075433_10682638 3300006852 Unclassified 900
180 Ga0075433_10822076 3300006852 Bacteria 811
181 Ga0075434_100000684 3300006871 Bacteria 26399
182 Ga0075434_100007125 3300006871 Bacteria 10331
183 Ga0075434_100017992 3300006871 Bacteria 6820
184 Ga0075434_100349985 3300006871 Bacteria 1498
185 Ga0075434_100450676 3300006871 Bacteria 1308
186 Ga0075434_100563977 3300006871 Unclassified 1158
187 Ga0075434_100939654 3300006871 Unclassified 879
188 Ga0075434_101359197 3300006871 Unclassified 721
189 Ga0075429_100055936 3300006880 Bacteria 3434
190 Ga0075429_100175663 3300006880 Bacteria 1876
191 Ga0075429_100596002 3300006880 Unclassified 968
192 Ga0075429_100852463 3300006880 Unclassified 798
193 Ga0068865_100707057 3300006881 Unclassified 862
194 Ga0075436_100023772 3300006914 Bacteria 4211
195 Ga0075436_100093218 3300006914 Bacteria 2094
196 Ga0075436_100207240 3300006914 Bacteria 1389
197 Ga0075436_100457887 3300006914 Bacteria 929
198 Ga0097620_100098470 3300006931 Bacteria 2978
199 Ga0097620_100768286 3300006931 Bacteria 1052
200 Ga0097620_101009484 3300006931 Bacteria 914
201 Ga0097620_101176758 3300006931 Unclassified 844
202 Ga0075435_100006966 3300007076 Bacteria 8025
203 Ga0075435_100041263 3300007076 Bacteria 3688
204 Ga0075435_100643811 3300007076 Bacteria 920
205 Ga0075435_101328513 3300007076 Unclassified 630
206 Ga0105251_10109471 3300009011 Bacteria 1259
207 Ga0105240_10048661 3300009093 Archaea 5356
208 Ga0105240_10095639 3300009093 Bacteria 3621
209 Ga0111539_10085643 3300009094 Unclassified 3703
210 Ga0111539_10186848 3300009094 Bacteria 2420
211 Ga0111539_10217660 3300009094 Bacteria 2224
212 Ga0111539_10230965 3300009094 Bacteria 2154
213 Ga0111539_10283191 3300009094 Bacteria 1929
214 Ga0111539_11226402 3300009094 Unclassified 871
215 Ga0105245_10007524 3300009098 Bacteria 9542
216 Ga0105245_10013473 3300009098 Bacteria 7120
217 Ga0114129_10338578 3300009147 Unclassified 1996
218 Ga0114129_10530169 3300009147 Bacteria 1534
219 Ga0114129_10776957 3300009147 Unclassified 1224
220 Ga0114129_10843030 3300009147 Unclassified 1166
221 Ga0114129_11080547 3300009147 Bacteria 1006
222 Ga0114129_11384217 3300009147 Unclassified 869
223 Ga0114129_11670765 3300009147 Unclassified 778
224 Ga0105243_12219521 3300009148 Unclassified 586
225 Ga0105241_10261147 3300009174 Bacteria 1472
226 Ga0105241_11229502 3300009174 Unclassified 711
227 Ga0105242_10001494 3300009176 Bacteria 18415
228 Ga0105248_10016518 3300009177 Bacteria 8126
229 Ga0105248_10149871 3300009177 Bacteria 2631
230 Ga0105248_10320743 3300009177 Bacteria 1745
231 Ga0105248_10634794 3300009177 Unclassified 1205
232 Ga0105248_10745225 3300009177 Bacteria 1105
233 Ga0105248_13135691 3300009177 Unclassified 526
234 Ga0105237_10662925 3300009545 Bacteria 1050
235 Ga0105249_10500593 3300009553 Bacteria 1260
236 Ga0105249_12114331 3300009553 Bacteria 636
237 Ga0105246_10384099 3300011119 Bacteria 1161
238 Ga0157370_10007853 3300013104 Bacteria 11562
239 Ga0157370_10023623 3300013104 Archaea 6101
240 Ga0157370_10041537 3300013104 Bacteria 4436
241 Ga0157369_10620279 3300013105 Bacteria 1116
242 Ga0157374_11613168 3300013296 Unclassified 673
243 Ga0157378_12174181 3300013297 Unclassified 606
244 Ga0163162_10179129 3300013306 Bacteria 2245
245 Ga0157372_10053218 3300013307 Bacteria 4511
246 Ga0157372_10071675 3300013307 Archaea 3903
247 Ga0157372_10284421 3300013307 Unclassified 1923
248 Ga0157375_10322061 3300013308 Bacteria 1710
249 Ga0157375_11941874 3300013308 Bacteria 699
250 Ga0163163_10000056 3300014325 Bacteria 125232
251 Ga0163163_10198791 3300014325 Bacteria 2053
252 Ga0163163_12323033 3300014325 Unclassified 595
253 Ga0157380_11120594 3300014326 Unclassified 827
254 Ga0157377_10067711 3300014745 Bacteria 2056
255 Ga0157379_10230795 3300014968 Bacteria 1677
256 Ga0157379_10762344 3300014968 Bacteria 911
257 Ga0157379_11062651 3300014968 Bacteria 774
258 Ga0157376_10127965 3300014969 Bacteria 2262
259 Ga0157376_10855061 3300014969 Bacteria 925
260 Ga0157376_11287801 3300014969 Bacteria 761
261 Ga0157376_11409724 3300014969 Unclassified 728
262 Ga0207653_10004262 3300025885 Bacteria 4494
263 Ga0207680_10112673 3300025903 Bacteria 1767
264 Ga0207680_10890879 3300025903 Bacteria 638
265 Ga0207699_10003559 3300025906 Bacteria 7434
266 Ga0207684_10044587 3300025910 Bacteria 3761
267 Ga0207684_10184282 3300025910 Bacteria 1800
268 Ga0207684_10476900 3300025910 Bacteria 1070
269 Ga0207684_10587515 3300025910 Bacteria 952
270 Ga0207654_11134362 3300025911 Unclassified 570
271 Ga0207707_10030823 3300025912 Bacteria 4691
272 Ga0207707_10062056 3300025912 Bacteria 3252
273 Ga0207707_10086134 3300025912 Archaea 2745
274 Ga0207695_10018908 3300025913 Bacteria 7948
275 Ga0207695_10121273 3300025913 Bacteria 2582
276 Ga0207693_10022168 3300025915 Bacteria 5049
277 Ga0207693_10762813 3300025915 Bacteria 747
278 Ga0207663_10000117 3300025916 Bacteria 38399
279 Ga0207660_10374001 3300025917 Bacteria 1144
280 Ga0207660_10827062 3300025917 Unclassified 756
281 Ga0207662_10066204 3300025918 Bacteria 2177
282 Ga0207657_10174328 3300025919 Bacteria 1741
283 Ga0207657_10974968 3300025919 Bacteria 651
284 Ga0207652_10115849 3300025921 Bacteria 2380
285 Ga0207652_10151964 3300025921 Unclassified 2073
286 Ga0207646_10117170 3300025922 Bacteria 2392
287 Ga0207646_10155502 3300025922 Unclassified 2062
288 Ga0207646_10283678 3300025922 Bacteria 1497
289 Ga0207646_10395280 3300025922 Bacteria 1249
290 Ga0207646_10815534 3300025922 Unclassified 830
291 Ga0207650_10708237 3300025925 Bacteria 851
292 Ga0207659_10002030 3300025926 Bacteria 12007
293 Ga0207687_10084222 3300025927 Bacteria 2304
294 Ga0207700_10001398 3300025928 Bacteria 13698
295 Ga0207700_10433719 3300025928 Bacteria 1156
296 Ga0207700_10564289 3300025928 Unclassified 1011
297 Ga0207700_10859346 3300025928 Unclassified 812
298 Ga0207664_10032815 3300025929 Unclassified 3983
299 Ga0207664_10318011 3300025929 Bacteria 1373
300 Ga0207644_10017022 3300025931 Bacteria 4901
301 Ga0207690_10163667 3300025932 Bacteria 1661
302 Ga0207706_10224432 3300025933 Unclassified 1644
303 Ga0207706_11065004 3300025933 Unclassified 677
304 Ga0207686_10010287 3300025934 Bacteria 5090
305 Ga0207709_11533726 3300025935 Bacteria 553
306 Ga0207670_10000111 3300025936 Bacteria 54695
307 Ga0207669_10004819 3300025937 Bacteria 5990
308 Ga0207704_11708048 3300025938 Unclassified 541
309 Ga0207665_10024340 3300025939 Bacteria 3992
310 Ga0207691_10560366 3300025940 Bacteria 968
311 Ga0207691_10748624 3300025940 Unclassified 823
312 Ga0207711_10052996 3300025941 Bacteria 3478
313 Ga0207711_10070020 3300025941 Bacteria 3042
314 Ga0207711_10282074 3300025941 Bacteria 1530
315 Ga0207711_10612661 3300025941 Bacteria 1016
316 Ga0207661_10448146 3300025944 Bacteria 1175
317 Ga0207661_10861233 3300025944 Bacteria 834
318 Ga0207661_11062653 3300025944 Bacteria 745
319 Ga0207661_11424278 3300025944 Unclassified 636
320 Ga0207679_11210892 3300025945 Bacteria 693
321 Ga0207667_10316234 3300025949 Bacteria 1595
322 Ga0207668_10896547 3300025972 Bacteria 789
323 Ga0207640_10768412 3300025981 Bacteria 832
324 Ga0207703_10137382 3300026035 Bacteria 2117
325 Ga0207708_10101807 3300026075 Bacteria 2224
326 Ga0207708_10231501 3300026075 Unclassified 1484
327 Ga0207702_10131859 3300026078 Bacteria 2250
328 Ga0207641_10032309 3300026088 Bacteria 4345
329 Ga0207641_10228354 3300026088 Unclassified 1729
330 Ga0207641_11511692 3300026088 Unclassified 673
331 Ga0207641_12110539 3300026088 Unclassified 564
332 Ga0207648_11120520 3300026089 Bacteria 738
333 Ga0207676_10025843 3300026095 Bacteria 4360
334 Ga0207674_10060272 3300026116 Bacteria 3838
335 Ga0207683_11142022 3300026121 Unclassified 722
336 Ga0209969_1009726 3300027360 Bacteria 1371
337 Ga0209969_1034915 3300027360 Bacteria 774
338 Ga0209967_1002415 3300027364 Bacteria 2422
339 Ga0210000_1005294 3300027462 Bacteria 1871
340 Ga0209995_1000388 3300027471 Bacteria 6867
341 Ga0209968_1001587 3300027526 Bacteria 3440
342 Ga0209999_1004681 3300027543 Bacteria 2456
343 Ga0209982_1031444 3300027552 Unclassified 835
344 Ga0209970_1000718 3300027614 Bacteria 5748
345 Ga0210002_1030689 3300027617 Unclassified 893
346 Ga0209983_1003862 3300027665 Bacteria 3171
347 Ga0209971_1000317 3300027682 Bacteria 13417
348 Ga0209966_1006707 3300027695 Bacteria 2003
349 Ga0209998_10004085 3300027717 Bacteria 3117
350 Ga0209998_10005143 3300027717 Bacteria 2747
351 Ga0209974_10000287 3300027876 Bacteria 16478
352 Ga0209974_10046322 3300027876 Bacteria 1454
353 Ga0209974_10212485 3300027876 Unclassified 718
354 Ga0207428_10004265 3300027907 Bacteria 13689
355 Ga0207428_10149064 3300027907 Bacteria 1781
356 Ga0207428_10204081 3300027907 Unclassified 1487
357 Ga0207428_10238413 3300027907 Bacteria 1359
358 Ga0268265_10625106 3300028380 Bacteria 1032
359 Ga0268265_11677479 3300028380 Bacteria 641
360 Ga0268264_10653265 3300028381 Bacteria 1041
361 Ga0265332_10077350 3300031238 Bacteria 1413
362 Ga0265329_10113999 3300031242 Unclassified 865
363 Ga0265339_10089660 3300031249 Bacteria 1614
364 Ga0307408_100076476 3300031548 Bacteria 2490
365 Ga0307408_100283901 3300031548 Bacteria 1380
366 Ga0307408_101348892 3300031548 Unclassified 670
367 Ga0307405_10119084 3300031731 Unclassified 1803
368 Ga0307405_11396995 3300031731 Unclassified 612
369 Ga0307413_10059694 3300031824 Bacteria 2344
370 Ga0307413_10363697 3300031824 Bacteria 1121
371 Ga0307413_11236110 3300031824 Bacteria 651
372 Ga0307410_10039995 3300031852 Bacteria 3083
373 Ga0307410_10352986 3300031852 Bacteria 1176
374 Ga0307410_11522726 3300031852 Bacteria 589
375 Ga0307406_10147454 3300031901 Bacteria 1674
376 Ga0307406_10184767 3300031901 Unclassified 1521
377 Ga0307412_10183619 3300031911 Bacteria 1575
378 Ga0307412_10608894 3300031911 Bacteria 926
379 Ga0307412_11055261 3300031911 Bacteria 721
380 Ga0307409_100067187 3300031995 Bacteria 2830
381 Ga0307409_101152589 3300031995 Bacteria 797
382 Ga0307416_100004508 3300032002 Bacteria 8409
383 Ga0307416_100090101 3300032002 Unclassified 2628
384 Ga0307416_100132033 3300032002 Bacteria 2250
385 Ga0307416_100274900 3300032002 Unclassified 1657
386 Ga0307416_101220521 3300032002 Bacteria 858
387 Ga0307414_10001614 3300032004 Bacteria 11722
388 Ga0307414_10632055 3300032004 Bacteria 963
389 Ga0307414_10789383 3300032004 Bacteria 865
390 Ga0307415_100000691 3300032126 Bacteria 14992
391 Ga0307415_102162651 3300032126 Unclassified 544
392 Ga0373958_0139513 3300034819 Unclassified 599
393 Ga0373934_0003001 3300035086 Bacteria 6162
394 Ga0373934_0065294 3300035086 Unclassified 1453
395 Ga0373923_0020906 3300035111 Bacteria 2549
396 Ga0373954_0028635 3300035118 Bacteria 2562
397 Ga0373954_0095280 3300035118 Bacteria 1433
398 Ga0373956_0003431 3300035119 Bacteria 6379
399 Ga0373957_0015754 3300035120 Bacteria 2607
400 Ga0373960_0117381 3300035121 Bacteria 880
401 Ga0373955_0004817 3300035172 Bacteria 6011
402 Ga0373931_0207330 3300035691 Unclassified 1174
403 Ga0373935_0349388 3300035692 Bacteria 1054
404 Ga0373935_0785167 3300035692 Unclassified 703
405 Ga0373927_0093464 3300035695 Unclassified 1954
406 Ga0373933_0002014 3300035724 Bacteria 11721
407 Ga0373947_0107644 3300035725 Unclassified 1758
408 Ga0373937_0000510 3300036401 Bacteria 35064
409 Ga0373937_0054103 3300036401 Bacteria 3682
410 Ga0373937_0062391 3300036401 Unclassified 3427
411 Ga0373937_0242926 3300036401 Bacteria 1697
412 Ga0373937_0676194 3300036401 Unclassified 978
413 Ga0316582_0586844 3300036647 Unclassified 767
414 Ga0373925_0116425 3300037068 Unclassified 2070
415 Ga0395898_0835407 3300037466 Unclassified 861
416 Ga0395905_0139744 3300037471 Bacteria 2279
417 Ga0242419_020287 3300038698 Unclassified 554
418 Ga0242420_010838 3300038996 Unclassified 1521
419 Ga0242420_017594 3300038996 Unclassified 1252
420 Ga0439448_0120128 3300042005 Bacteria 902
421 Ga0439455_0033584 3300042012 Unclassified 1287
422 Ga0439455_0114058 3300042012 Bacteria 753
423 Ga0439435_0166855 3300042436 Unclassified 713
424 Ga0439459_0181825 3300042438 Unclassified 565
425 Ga0451577_0173841 3300042876 Unclassified 1941
426 Ga0451577_0295217 3300042876 Bacteria 1469
427 Ga0451577_1444933 3300042876 Bacteria 609
428 Ga0453683_0001801 3300044673 Bacteria 17693
429 Ga0453683_0005690 3300044673 Bacteria 8656
430 Ga0453683_0134943 3300044673 Bacteria 1556
431 Ga0466966_0207693 3300044684 Unclassified 1184
432 Ga0466959_0212060 3300045049 Bacteria 1345
433 Ga0451576_0007537 3300045051 Bacteria 12969
434 Ga0451576_0008735 3300045051 Bacteria 11857
435 Ga0451576_0056700 3300045051 Bacteria 4096
436 Ga0451576_0082311 3300045051 Bacteria 3347
437 Ga0451576_0137550 3300045051 Bacteria 2548
438 Ga0451576_0160944 3300045051 Bacteria 2343
439 Ga0451576_0423154 3300045051 Unclassified 1397
440 Ga0451576_1186041 3300045051 Bacteria 797
441 Ga0451576_1708969 3300045051 Unclassified 652
442 Ga0451576_1840698 3300045051 Unclassified 625
443 Ga0466967_0096809 3300045976 Unclassified 2693
444 Ga0466967_0289470 3300045976 Bacteria 1573
445 Ga0466967_0390265 3300045976 Bacteria 1353
446 Ga0495592_0018841 3300046454 Bacteria 5256
447 Ga0495592_0180984 3300046454 Unclassified 1436
448 Ga0495629_0070891 3300046459 Bacteria 2432
449 Ga0495651_0012186 3300046462 Bacteria 6620
450 Ga0495651_0210156 3300046462 Unclassified 1355
451 Ga0495653_0001660 3300046463 Bacteria 17478
452 Ga0495639_0005907 3300046475 Bacteria 5266
453 Ga0495662_0210771 3300046476 Bacteria 958
454 Ga0495664_0125526 3300046477 Bacteria 1552
455 Ga0495594_0360670 3300046499 Unclassified 827
456 Ga0495608_0007312 3300046511 Bacteria 7804
457 Ga0495608_0057868 3300046511 Bacteria 2557
458 Ga0495608_0087416 3300046511 Bacteria 2019
459 Ga0495618_0018977 3300046514 Bacteria 4226
460 Ga0495628_0002595 3300046516 Bacteria 16238
461 Ga0495628_0665915 3300046516 Unclassified 738
462 Ga0495630_0002790 3300046517 Bacteria 12122
463 Ga0495630_0061922 3300046517 Bacteria 2811
464 Ga0495630_1089558 3300046517 Unclassified 606
465 Ga0495666_0125873 3300046526 Bacteria 1198
466 Ga0495652_0001667 3300046529 Bacteria 24099
467 Ga0495665_0002516 3300046531 Bacteria 9900
468 Ga0495665_0030773 3300046531 Bacteria 2872
469 Ga0495640_0317068 3300046533 Unclassified 966
470 Ga0495586_0071324 3300046535 Unclassified 1898
471 Ga0495586_0283721 3300046535 Unclassified 948
472 Ga0495587_0000305 3300046536 Bacteria 34971
473 Ga0495598_0409640 3300046537 Unclassified 531
474 Ga0495645_0000169 3300046543 Bacteria 45526
475 Ga0495645_0020602 3300046543 Bacteria 4762
476 Ga0495645_0604586 3300046543 Unclassified 674
477 Ga0495622_0315380 3300046557 Bacteria 680
478 Ga0495667_0001098 3300046559 Bacteria 17570
479 Ga0495667_0001439 3300046559 Bacteria 15678
480 Ga0495667_0341941 3300046559 Bacteria 946
481 Ga0495634_0761760 3300046642 Unclassified 554
482 Ga0495635_0000227 3300046663 Bacteria 35707
483 Ga0495635_0661176 3300046663 Unclassified 679
484 Ga0495657_0001254 3300046675 Bacteria 22115
485 Ga0495657_0141008 3300046675 Unclassified 1502
486 Ga0495599_0006680 3300046678 Bacteria 6963
487 Ga0495599_0026475 3300046678 Bacteria 3635
488 Ga0495599_0065325 3300046678 Bacteria 2273
489 Ga0495623_0000029 3300046679 Bacteria 85797
490 Ga0495623_0229646 3300046679 Unclassified 1053
491 Ga0495646_0019795 3300046680 Bacteria 4256
492 Ga0495613_0229844 3300046689 Unclassified 1300
493 Ga0495613_0921711 3300046689 Bacteria 564
494 Ga0495600_0000902 3300046809 Bacteria 15919
495 Ga0495600_0132513 3300046809 Unclassified 1620
496 Ga0495581_0053395 3300047315 Unclassified 2334
497 Ga0495604_0000404 3300047317 Bacteria 38952
498 Ga0495674_0041206 3300047319 Unclassified 4127
499 Ga0495674_0052489 3300047319 Bacteria 3587
500 Ga0495676_0578680 3300047321 Bacteria 732
501 Ga0495680_0007163 3300047322 Bacteria 10276
502 Ga0495680_0483959 3300047322 Unclassified 842
503 Ga0495675_0013327 3300047444 Bacteria 5189
504 Ga0495684_0001464 3300047471 Bacteria 18894
505 Ga0495684_0017384 3300047471 Bacteria 5535
506 Ga0495593_0121813 3300047673 Bacteria 1327
507 Ga0495602_0002633 3300048088 Bacteria 18336
508 Ga0495602_0035464 3300048088 Bacteria 4651
509 Ga0496102_0231595 3300048905 Bacteria 1742
510 Ga0496102_1075381 3300048905 Bacteria 724
511 Ga0496106_0101589 3300048909 Unclassified 2230
512 Ga0496106_0189663 3300048909 Unclassified 1634
513 Ga0496106_0300295 3300048909 Bacteria 1288
514 Ga0496109_0235668 3300048912 Bacteria 1722
515 Ga0496110_0010031 3300048913 Bacteria 7685
516 Ga0496110_0048636 3300048913 Unclassified 3718
517 Ga0496110_1760837 3300048913 Unclassified 530
518 Ga0496111_0797509 3300048914 Bacteria 684
519 Ga0496112_0000203 3300048915 Bacteria 39021
520 Ga0496113_0523758 3300048916 Bacteria 951
521 Ga0501039_0321659 3300049575 Unclassified 1216
522 Ga0501040_0184002 3300049576 Unclassified 1481
523 Ga0501040_0831755 3300049576 Unclassified 668
524 Ga0501040_0880983 3300049576 Unclassified 648
525 Ga0501070_0883663 3300049586 Unclassified 698
526 Ga0501071_0704178 3300049587 Unclassified 778
527 Ga0501076_0597479 3300049592 Bacteria 910
528 Ga0501076_0999679 3300049592 Unclassified 689
529 Ga0501076_1086853 3300049592 Unclassified 659
530 Ga0501077_0845879 3300049593 Unclassified 588
531 Ga0501206_053740 3300049653 Unclassified 647
532 Ga0501209_194732 3300049656 Bacteria 622
533 Ga0501216_111399 3300049660 Unclassified 615
534 Ga0501235_011520 3300049669 Bacteria 1939
535 Ga0501235_067431 3300049669 Bacteria 843
536 Ga0501249_007184 3300049679 Bacteria 2299
537 Ga0501257_040289 3300049686 Bacteria 1146
538 Ga0501257_057889 3300049686 Bacteria 976
539 Ga0501259_010423 3300049688 Bacteria 1518
540 Ga0501225_0034976 3300049705 Bacteria 1383
541 Ga0501079_0363105 3300049741 Bacteria 1135
542 Ga0501079_0506702 3300049741 Unclassified 949
543 Ga0501081_0376326 3300049743 Bacteria 1049
544 Ga0501262_054985 3300049759 Bacteria 624
545 Ga0501263_024666 3300049760 Bacteria 825
546 Ga0501273_009038 3300049770 Bacteria 1203
547 nmdc:mga05p37_1013607_c1 3300050507 Unclassified 880
548 nmdc:mga05p37_1167181_c1 3300050507 Unclassified 799
549 nmdc:mga05p37_121666_c1 3300050507 Bacteria 3206
550 nmdc:mga05p37_337258_c1 3300050507 Bacteria 1779
551 nmdc:mga05p37_508974_c1 3300050507 Bacteria 1380
552 nmdc:mga09592_147647_c1 3300050508 Bacteria 2028
553 nmdc:mga09592_386739_c1 3300050508 Unclassified 1209
554 nmdc:mga09592_856716_c1 3300050508 Unclassified 766
555 nmdc:mga09592_971930_c1 3300050508 Unclassified 711
556 nmdc:mga0qj67_1097254_c1 3300050509 Unclassified 622
557 nmdc:mga0qj67_177742_c1 3300050509 Bacteria 1728
558 nmdc:mga0qj67_353214_c1 3300050509 Unclassified 1188
559 nmdc:mga06r32_426366_c1 3300050510 Unclassified 1307
560 nmdc:mga06r32_548667_c1 3300050510 Bacteria 1130
561 nmdc:mga08y16_1471_c1 3300050511 Bacteria 23637
562 nmdc:mga08y16_194195_c1 3300050511 Bacteria 2105
563 nmdc:mga08y16_268890_c1 3300050511 Bacteria 1760
564 nmdc:mga08y16_58030_c1 3300050511 Bacteria 4044
565 nmdc:mga08y16_823445_c1 3300050511 Unclassified 919
566 nmdc:mga0n895_1225819_c1 3300050512 Unclassified 723
567 nmdc:mga0n895_15692_c1 3300050512 Bacteria 6920
568 nmdc:mga0n895_1729862_c1 3300050512 Bacteria 587
569 nmdc:mga0n895_2132837_c1 3300050512 Unclassified 516
570 nmdc:mga0n895_294658_c1 3300050512 Bacteria 1645
571 nmdc:mga0n895_359_c1 3300050512 Bacteria 30652
572 nmdc:mga0n895_509905_c1 3300050512 Bacteria 1211
573 nmdc:mga0n895_572662_c1 3300050512 Unclassified 1134
574 nmdc:mga0n895_68911_c1 3300050512 Bacteria 3504
575 nmdc:mga0n895_801220_c1 3300050512 Unclassified 932
576 nmdc:mga0n895_9876_c1 3300050512 Bacteria 8393
577 nmdc:mga0rr50_1450522_c1 3300050513 Unclassified 580
578 nmdc:mga0rr50_15494_c1 3300050513 Bacteria 5034
579 nmdc:mga0rr50_314661_c1 3300050513 Bacteria 1312
580 nmdc:mga0rr50_560320_c1 3300050513 Unclassified 973
581 nmdc:mga08x19_124687_c1 3300050514 Unclassified 1729
582 nmdc:mga08x19_486359_c1 3300050514 Bacteria 871
583 nmdc:mga08x19_654390_c1 3300050514 Unclassified 745
584 nmdc:mga08x19_80795_c1 3300050514 Bacteria 2134
585 nmdc:mga0a205_1168039_c1 3300050515 Unclassified 617
586 nmdc:mga0a205_182712_c1 3300050515 Unclassified 1991
587 nmdc:mga0a205_362215_c1 3300050515 Bacteria 1316
588 nmdc:mga0a205_5241_c1 3300050515 Bacteria 10392
589 nmdc:mga0a205_599263_c1 3300050515 Bacteria 955
590 nmdc:mga0a205_624768_c1 3300050515 Unclassified 929
591 nmdc:mga0a205_86905_c1 3300050515 Unclassified 3020
592 nmdc:mga0a205_965256_c1 3300050515 Unclassified 699
593 Ga0495601_0024704 3300053077 Bacteria 3701
594 Ga0495601_0039380 3300053077 Bacteria 2960
595 Ga0495601_0091709 3300053077 Bacteria 1956
596 Ga0495601_0467566 3300053077 Bacteria 815
597 Ga0495612_0002745 3300053078 Bacteria 7293
598 Ga0495595_0036689 3300053084 Unclassified 2225
599 Ga0495619_0025776 3300053085 Bacteria 3778
600 Ga0501084_1190541 3300054114 Unclassified 639
601 Ga0501082_0666988 3300060353 Unclassified 910
602 Ga0530510_0902364 3300061734 Unclassified 675
603 Ga0163162_11000515
604 MRS1b_contig_4143441
605 MBSR1b_contig_6132909
606 Ga0058861_11426154
607 Ga0065712_10080964
608 Ga0065712_10299561
609 Ga0065715_10125708
610 Ga0065715_10159684
611 Ga0070683_100299201
612 Ga0070690_100318401
613 Ga0070680_100057478
614 Ga0070680_100366749
615 Ga0070680_100433390
616 Ga0068868_101863171
617 Ga0070660_100159195
618 Ga0070689_100000341
619 Ga0070689_100003170
620 Ga0070689_100385453
621 Ga0070691_10007472
622 Ga0070691_10138167
623 Ga0070687_100002284
624 Ga0070692_10613117
625 Ga0070668_100440582
626 Ga0070669_101275526
627 Ga0070675_100005043
628 Ga0070675_101150287
629 Ga0070671_100003681
630 Ga0070671_101127598
631 Ga0070674_100001128
632 Ga0070673_100720114
633 Ga0070688_100000233
634 Ga0070688_100000348
635 Ga0070688_101803723
636 Ga0070659_100990269
637 Ga0070659_101317297
638 Ga0070703_10015378
639 Ga0070703_10203064
640 Ga0070703_10361689
641 Ga0070709_10004593
642 Ga0070709_10115223
643 Ga0070714_100030417
644 Ga0070714_101041995
645 Ga0070714_102368422
646 Ga0070713_100000229
647 Ga0070713_100141182
648 Ga0070713_100516152
649 Ga0070713_100516542
650 Ga0070701_10034972
651 Ga0070701_10046204
652 Ga0070701_10587992
653 Ga0070701_10729729
654 Ga0070711_100000715
655 Ga0070705_100019522
656 Ga0070705_100969880
657 Ga0070700_100036303
658 Ga0070700_100125702
659 Ga0070694_100021598
660 Ga0070694_100028856
661 Ga0070694_100069204
662 Ga0070694_100069244
663 Ga0070694_100432835
664 Ga0070708_100037270
665 Ga0070708_100431515
666 Ga0070708_100618701
667 Ga0070708_100780553
668 Ga0070708_100930833
669 Ga0070678_101683221
670 Ga0070662_100297705
671 Ga0070681_10001143
672 Ga0070681_10005906
673 Ga0070681_10198183
674 Ga0070681_10661876
675 Ga0068867_100943719
676 Ga0070685_10008535
677 Ga0070706_100063119
678 Ga0070706_100515582
679 Ga0070706_101828403
680 Ga0070707_100047363
681 Ga0070707_100137079
682 Ga0070707_101101481
683 Ga0070707_101351485
684 Ga0070698_100109596
685 Ga0070698_100218360
686 Ga0070698_100450224
687 Ga0070698_100821104
688 Ga0070699_100005198
689 Ga0070699_100060638
690 Ga0070699_100417835
691 Ga0070699_100714436
692 Ga0070679_100051335
693 Ga0070679_100109056
694 Ga0070679_100679634
695 Ga0070679_101483994
696 Ga0070684_100943649
697 Ga0070684_101198463
698 Ga0070684_101780125
699 Ga0070697_100014537
700 Ga0070697_100297098
701 Ga0070697_100363893
702 Ga0070697_101433820
703 Ga0070672_100283783
704 Ga0070672_100357338
705 Ga0070672_100789007
706 Ga0070686_100027697
707 Ga0070686_100551242
708 Ga0070686_100621905
709 Ga0070695_100001010
710 Ga0070695_100012637
711 Ga0070695_100074733
712 Ga0070695_100107441
713 Ga0070695_100662820
714 Ga0070696_100008270
715 Ga0070696_100247336
716 Ga0070696_100424944
717 Ga0070696_100532914
718 Ga0070693_101199045
719 Ga0070704_100136526
720 Ga0070704_100238694
721 Ga0070704_100619563
722 Ga0070704_100626958
723 Ga0070704_100690155
724 Ga0070704_101370672
725 Ga0070704_101432817
726 Ga0068855_100281628
727 Ga0070664_100789283
728 Ga0070664_100977270
729 Ga0070664_102146932
730 Ga0068857_100182495
731 Ga0068856_100165136
732 Ga0068856_101243858
733 Ga0070702_100191584
734 Ga0070702_100202519
735 Ga0070702_100651806
736 Ga0068859_100098470
737 Ga0068859_100768455
738 Ga0068859_101009484
739 Ga0068859_101176787
740 Ga0068864_100004125
741 Ga0068866_10746293
742 Ga0068861_100481742
743 Ga0068863_100024077
744 Ga0068863_100084045
745 Ga0068858_100046017
746 Ga0068858_100768560
747 Ga0068858_100853703
748 Ga0068860_100682814
749 Ga0068862_100454126
750 Ga0068862_100636578
751 Ga0068862_102254572
752 Ga0070717_10014030
753 Ga0070717_10458599
754 Ga0070717_10566898
755 Ga0070716_100359347
756 Ga0070712_100008399
757 Ga0070712_100014487
758 Ga0070712_100405255
759 Ga0070712_101046440
760 Ga0097621_101018818
761 Ga0068871_100850652
762 Ga0075428_100011025
763 Ga0075428_100037835
764 Ga0075428_100468318
765 Ga0075428_100556423
766 Ga0075428_100992590
767 Ga0075428_101541595
768 Ga0075428_102120030
769 Ga0075430_100604664
770 Ga0075431_100292635
771 Ga0075431_100437548
772 Ga0075431_100512852
773 Ga0075431_100642080
774 Ga0075431_100784731
775 Ga0075431_100876436
776 Ga0075431_101616520
777 Ga0075433_10010933
778 Ga0075433_10045910
779 Ga0075433_10151746
780 Ga0075433_10201625
781 Ga0075433_10682638
782 Ga0075433_10822076
783 Ga0075434_100000684
784 Ga0075434_100007125
785 Ga0075434_100017992
786 Ga0075434_100349985
787 Ga0075434_100450676
788 Ga0075434_100563977
789 Ga0075434_100939654
790 Ga0075434_101359197
791 Ga0075429_100055936
792 Ga0075429_100175663
793 Ga0075429_100596002
794 Ga0075429_100852463
795 Ga0068865_100707057
796 Ga0075436_100023772
797 Ga0075436_100093218
798 Ga0075436_100207240
799 Ga0075436_100457887
800 Ga0097620_100098470
801 Ga0097620_100768286
802 Ga0097620_101009484
803 Ga0097620_101176758
804 Ga0075435_100006966
805 Ga0075435_100041263
806 Ga0075435_100643811
807 Ga0075435_101328513
808 Ga0105251_10109471
809 Ga0105240_10048661
810 Ga0105240_10095639
811 Ga0111539_10085643
812 Ga0111539_10186848
813 Ga0111539_10217660
814 Ga0111539_10230965
815 Ga0111539_10283191
816 Ga0111539_11226402
817 Ga0105245_10007524
818 Ga0105245_10013473
819 Ga0114129_10338578
820 Ga0114129_10530169
821 Ga0114129_10776957
822 Ga0114129_10843030
823 Ga0114129_11080547
824 Ga0114129_11384217
825 Ga0114129_11670765
826 Ga0105243_12219521
827 Ga0105241_10261147
828 Ga0105241_11229502
829 Ga0105242_10001494
830 Ga0105248_10016518
831 Ga0105248_10149871
832 Ga0105248_10320743
833 Ga0105248_10634794
834 Ga0105248_10745225
835 Ga0105248_13135691
836 Ga0105237_10662925
837 Ga0105249_10500593
838 Ga0105249_12114331
839 Ga0105246_10384099
840 Ga0157370_10007853
841 Ga0157370_10023623
842 Ga0157370_10041537
843 Ga0157369_10620279
844 Ga0157374_11613168
845 Ga0157378_12174181
846 Ga0163162_10179129
847 Ga0157372_10053218
848 Ga0157372_10071675
849 Ga0157372_10284421
850 Ga0157375_10322061
851 Ga0157375_11941874
852 Ga0163163_10000056
853 Ga0163163_10198791
854 Ga0163163_12323033
855 Ga0157380_11120594
856 Ga0157377_10067711
857 Ga0157379_10230795
858 Ga0157379_10762344
859 Ga0157379_11062651
860 Ga0157376_10127965
861 Ga0157376_10855061
862 Ga0157376_11287801
863 Ga0157376_11409724
864 Ga0207653_10004262
865 Ga0207680_10112673
866 Ga0207680_10890879
867 Ga0207699_10003559
868 Ga0207684_10044587
869 Ga0207684_10184282
870 Ga0207684_10476900
871 Ga0207684_10587515
872 Ga0207654_11134362
873 Ga0207707_10030823
874 Ga0207707_10062056
875 Ga0207707_10086134
876 Ga0207695_10018908
877 Ga0207695_10121273
878 Ga0207693_10022168
879 Ga0207693_10762813
880 Ga0207663_10000117
881 Ga0207660_10374001
882 Ga0207660_10827062
883 Ga0207662_10066204
884 Ga0207657_10174328
885 Ga0207657_10974968
886 Ga0207652_10115849
887 Ga0207652_10151964
888 Ga0207646_10117170
889 Ga0207646_10155502
890 Ga0207646_10283678
891 Ga0207646_10395280
892 Ga0207646_10815534
893 Ga0207650_10708237
894 Ga0207659_10002030
895 Ga0207687_10084222
896 Ga0207700_10001398
897 Ga0207700_10433719
898 Ga0207700_10564289
899 Ga0207700_10859346
900 Ga0207664_10032815
901 Ga0207664_10318011
902 Ga0207644_10017022
903 Ga0207690_10163667
904 Ga0207706_10224432
905 Ga0207706_11065004
906 Ga0207686_10010287
907 Ga0207709_11533726
908 Ga0207670_10000111
909 Ga0207669_10004819
910 Ga0207704_11708048
911 Ga0207665_10024340
912 Ga0207691_10560366
913 Ga0207691_10748624
914 Ga0207711_10052996
915 Ga0207711_10070020
916 Ga0207711_10282074
917 Ga0207711_10612661
918 Ga0207661_10448146
919 Ga0207661_10861233
920 Ga0207661_11062653
921 Ga0207661_11424278
922 Ga0207679_11210892
923 Ga0207667_10316234
924 Ga0207668_10896547
925 Ga0207640_10768412
926 Ga0207703_10137382
927 Ga0207708_10101807
928 Ga0207708_10231501
929 Ga0207702_10131859
930 Ga0207641_10032309
931 Ga0207641_10228354
932 Ga0207641_11511692
933 Ga0207641_12110539
934 Ga0207648_11120520
935 Ga0207676_10025843
936 Ga0207674_10060272
937 Ga0207683_11142022
938 Ga0209969_1009726
939 Ga0209969_1034915
940 Ga0209967_1002415
941 Ga0210000_1005294
942 Ga0209995_1000388
943 Ga0209968_1001587
944 Ga0209999_1004681
945 Ga0209982_1031444
946 Ga0209970_1000718
947 Ga0210002_1030689
948 Ga0209983_1003862
949 Ga0209971_1000317
950 Ga0209966_1006707
951 Ga0209998_10004085
952 Ga0209998_10005143
953 Ga0209974_10000287
954 Ga0209974_10046322
955 Ga0209974_10212485
956 Ga0207428_10004265
957 Ga0207428_10149064
958 Ga0207428_10204081
959 Ga0207428_10238413
960 Ga0268265_10625106
961 Ga0268265_11677479
962 Ga0268264_10653265
963 Ga0265332_10077350
964 Ga0265329_10113999
965 Ga0265339_10089660
966 Ga0307408_100076476
967 Ga0307408_100283901
968 Ga0307408_101348892
969 Ga0307405_10119084
970 Ga0307405_11396995
971 Ga0307413_10059694
972 Ga0307413_10363697
973 Ga0307413_11236110
974 Ga0307410_10039995
975 Ga0307410_10352986
976 Ga0307410_11522726
977 Ga0307406_10147454
978 Ga0307406_10184767
979 Ga0307412_10183619
980 Ga0307412_10608894
981 Ga0307412_11055261
982 Ga0307409_100067187
983 Ga0307409_101152589
984 Ga0307416_100004508
985 Ga0307416_100090101
986 Ga0307416_100132033
987 Ga0307416_100274900
988 Ga0307416_101220521
989 Ga0307414_10001614
990 Ga0307414_10632055
991 Ga0307414_10789383
992 Ga0307415_100000691
993 Ga0307415_102162651
994 Ga0373958_0139513
995 Ga0373934_0003001
996 Ga0373934_0065294
997 Ga0373923_0020906
998 Ga0373954_0028635
999 Ga0373954_0095280
1000 Ga0373956_0003431
1001 Ga0373957_0015754
1002 Ga0373960_0117381
1003 Ga0373955_0004817
1004 Ga0373931_0207330
1005 Ga0373935_0349388
1006 Ga0373935_0785167
1007 Ga0373927_0093464
1008 Ga0373933_0002014
1009 Ga0373947_0107644
1010 Ga0373937_0000510
1011 Ga0373937_0054103
1012 Ga0373937_0062391
1013 Ga0373937_0242926
1014 Ga0373937_0676194
1015 Ga0316582_0586844
1016 Ga0373925_0116425
1017 Ga0395898_0835407
1018 Ga0395905_0139744
1019 Ga0242419_020287
1020 Ga0242420_010838
1021 Ga0242420_017594
1022 Ga0439448_0120128
1023 Ga0439455_0033584
1024 Ga0439455_0114058
1025 Ga0439435_0166855
1026 Ga0439459_0181825
1027 Ga0451577_0173841
1028 Ga0451577_0295217
1029 Ga0451577_1444933
1030 Ga0453683_0001801
1031 Ga0453683_0005690
1032 Ga0453683_0134943
1033 Ga0466966_0207693
1034 Ga0466959_0212060
1035 Ga0451576_0007537
1036 Ga0451576_0008735
1037 Ga0451576_0056700
1038 Ga0451576_0082311
1039 Ga0451576_0137550
1040 Ga0451576_0160944
1041 Ga0451576_0423154
1042 Ga0451576_1186041
1043 Ga0451576_1708969
1044 Ga0451576_1840698
1045 Ga0466967_0096809
1046 Ga0466967_0289470
1047 Ga0466967_0390265
1048 Ga0495592_0018841
1049 Ga0495592_0180984
1050 Ga0495629_0070891
1051 Ga0495651_0012186
1052 Ga0495651_0210156
1053 Ga0495653_0001660
1054 Ga0495639_0005907
1055 Ga0495662_0210771
1056 Ga0495664_0125526
1057 Ga0495594_0360670
1058 Ga0495608_0007312
1059 Ga0495608_0057868
1060 Ga0495608_0087416
1061 Ga0495618_0018977
1062 Ga0495628_0002595
1063 Ga0495628_0665915
1064 Ga0495630_0002790
1065 Ga0495630_0061922
1066 Ga0495630_1089558
1067 Ga0495666_0125873
1068 Ga0495652_0001667
1069 Ga0495665_0002516
1070 Ga0495665_0030773
1071 Ga0495640_0317068
1072 Ga0495586_0071324
1073 Ga0495586_0283721
1074 Ga0495587_0000305
1075 Ga0495598_0409640
1076 Ga0495645_0000169
1077 Ga0495645_0020602
1078 Ga0495645_0604586
1079 Ga0495622_0315380
1080 Ga0495667_0001098
1081 Ga0495667_0001439
1082 Ga0495667_0341941
1083 Ga0495634_0761760
1084 Ga0495635_0000227
1085 Ga0495635_0661176
1086 Ga0495657_0001254
1087 Ga0495657_0141008
1088 Ga0495599_0006680
1089 Ga0495599_0026475
1090 Ga0495599_0065325
1091 Ga0495623_0000029
1092 Ga0495623_0229646
1093 Ga0495646_0019795
1094 Ga0495613_0229844
1095 Ga0495613_0921711
1096 Ga0495600_0000902
1097 Ga0495600_0132513
1098 Ga0495581_0053395
1099 Ga0495604_0000404
1100 Ga0495674_0041206
1101 Ga0495674_0052489
1102 Ga0495676_0578680
1103 Ga0495680_0007163
1104 Ga0495680_0483959
1105 Ga0495675_0013327
1106 Ga0495684_0001464
1107 Ga0495684_0017384
1108 Ga0495593_0121813
1109 Ga0495602_0002633
1110 Ga0495602_0035464
1111 Ga0496102_0231595
1112 Ga0496102_1075381
1113 Ga0496106_0101589
1114 Ga0496106_0189663
1115 Ga0496106_0300295
1116 Ga0496109_0235668
1117 Ga0496110_0010031
1118 Ga0496110_0048636
1119 Ga0496110_1760837
1120 Ga0496111_0797509
1121 Ga0496112_0000203
1122 Ga0496113_0523758
1123 Ga0501039_0321659
1124 Ga0501040_0184002
1125 Ga0501040_0831755
1126 Ga0501040_0880983
1127 Ga0501070_0883663
1128 Ga0501071_0704178
1129 Ga0501076_0597479
1130 Ga0501076_0999679
1131 Ga0501076_1086853
1132 Ga0501077_0845879
1133 Ga0501206_053740
1134 Ga0501209_194732
1135 Ga0501216_111399
1136 Ga0501235_011520
1137 Ga0501235_067431
1138 Ga0501249_007184
1139 Ga0501257_040289
1140 Ga0501257_057889
1141 Ga0501259_010423
1142 Ga0501225_0034976
1143 Ga0501079_0363105
1144 Ga0501079_0506702
1145 Ga0501081_0376326
1146 Ga0501262_054985
1147 Ga0501263_024666
1148 Ga0501273_009038
1149 nmdc:mga05p37_1013607_c1
1150 nmdc:mga05p37_1167181_c1
1151 nmdc:mga05p37_121666_c1
1152 nmdc:mga05p37_337258_c1
1153 nmdc:mga05p37_508974_c1
1154 nmdc:mga09592_147647_c1
1155 nmdc:mga09592_386739_c1
1156 nmdc:mga09592_856716_c1
1157 nmdc:mga09592_971930_c1
1158 nmdc:mga0qj67_1097254_c1
1159 nmdc:mga0qj67_177742_c1
1160 nmdc:mga0qj67_353214_c1
1161 nmdc:mga06r32_426366_c1
1162 nmdc:mga06r32_548667_c1
1163 nmdc:mga08y16_1471_c1
1164 nmdc:mga08y16_194195_c1
1165 nmdc:mga08y16_268890_c1
1166 nmdc:mga08y16_58030_c1
1167 nmdc:mga08y16_823445_c1
1168 nmdc:mga0n895_1225819_c1
1169 nmdc:mga0n895_15692_c1
1170 nmdc:mga0n895_1729862_c1
1171 nmdc:mga0n895_2132837_c1
1172 nmdc:mga0n895_294658_c1
1173 nmdc:mga0n895_359_c1
1174 nmdc:mga0n895_509905_c1
1175 nmdc:mga0n895_572662_c1
1176 nmdc:mga0n895_68911_c1
1177 nmdc:mga0n895_801220_c1
1178 nmdc:mga0n895_9876_c1
1179 nmdc:mga0rr50_1450522_c1
1180 nmdc:mga0rr50_15494_c1
1181 nmdc:mga0rr50_314661_c1
1182 nmdc:mga0rr50_560320_c1
1183 nmdc:mga08x19_124687_c1
1184 nmdc:mga08x19_486359_c1
1185 nmdc:mga08x19_654390_c1
1186 nmdc:mga08x19_80795_c1
1187 nmdc:mga0a205_1168039_c1
1188 nmdc:mga0a205_182712_c1
1189 nmdc:mga0a205_362215_c1
1190 nmdc:mga0a205_5241_c1
1191 nmdc:mga0a205_599263_c1
1192 nmdc:mga0a205_624768_c1
1193 nmdc:mga0a205_86905_c1
1194 nmdc:mga0a205_965256_c1
1195 Ga0495601_0024704
1196 Ga0495601_0039380
1197 Ga0495601_0091709
1198 Ga0495601_0467566
1199 Ga0495612_0002745
1200 Ga0495595_0036689
1201 Ga0495619_0025776
1202 Ga0501084_1190541
1203 Ga0501082_0666988
1204 Ga0530510_0902364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11528

DUF3224

Protein of unknown function (DUF3224)

5

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q03-assembly1.cif.gz_B crystal structure of uncharacterized protein (yp_563039.1) from shewanella denitrificans os217 at 1.80 a resolution 0.9343 1 130
2q03-assembly1.cif.gz_B crystal structure of uncharacterized protein (yp_563039.1) from shewanella denitrificans os217 at 1.80 a resolution 0.9207 1 130
2ooj-assembly1.cif.gz_A crystal structure of a protein with unknown function from duf3224 family (so_1590) from shewanella oneidensis mr-1 at 1.84 a resolution 0.8193 1 132
2ooj-assembly1.cif.gz_B crystal structure of a protein with unknown function from duf3224 family (so_1590) from shewanella oneidensis mr-1 at 1.84 a resolution 0.8103 1 132
2ooj-assembly1.cif.gz_A crystal structure of a protein with unknown function from duf3224 family (so_1590) from shewanella oneidensis mr-1 at 1.84 a resolution 0.8079 1 132
ID Description Score Start End Superfamily
2q03B00 Mainly Beta;Beta Barrel;AOC barrel-like;SO1590-like 0.93 1 130 2.40.350.10
2q03B00 Mainly Beta;Beta Barrel;AOC barrel-like;SO1590-like 0.9158 1 130 2.40.350.10
2oojA00 Mainly Beta;Beta Barrel;AOC barrel-like;SO1590-like 0.7589 1 132 2.40.350.10
2oojA00 Mainly Beta;Beta Barrel;AOC barrel-like;SO1590-like 0.7421 1 132 2.40.350.10
af_Q9M2S5_17_155_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6775 7 61 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2V7M527-F1-model_v4 DUF3224 domain-containing protein 0.9989 30 132
AF-A0A2V7UG06-F1-model_v4 DUF3224 domain-containing protein 0.9958 3 132
AF-A0A2V7RUX5-F1-model_v4 DUF3224 domain-containing protein 0.995 1 132
AF-A0A1G0SXI7-F1-model_v4 DUF3224 domain-containing protein 0.9921 1 132
AF-A0A2V7NBP0-F1-model_v4 DUF3224 domain-containing protein 0.9901 1 132

Map