F468155

General Info

Members Datasets Scaffolds Average Seq Length
602 259 602 140

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10037973|Ga0081455_100379733
Length 170
Sequence MPGLKGRRYPNDRQPVAGCFALTVTLNNLPEMRIDHDQLEVRSHDKGLYEITDQIDSKIDKCGIKNGTVTIFVQHTSCSIVIMENADPTARRDLEEFFERLVPEDADYFTHDTEGSDDMPSHIRMVLTRTSETIPIVDGKMQLGTWQGIFLFEHRRAPHRRKVVLTMIGE

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.47
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10217976 3300001989 Unclassified 559
2 JGI24737J22298_10045963 3300001990 Bacteria 1333
3 JGI24743J22301_10009340 3300001991 Bacteria 1736
4 JGI24035J26624_1000390 3300002126 Bacteria 4128
5 JGI25405J52794_10000078 3300003911 Bacteria 10653
6 JGI25405J52794_10003345 3300003911 Bacteria 2807
7 Ga0065703_1000584 3300005272 Bacteria 2832
8 Ga0065714_10201160 3300005288 Bacteria 895
9 Ga0065704_10027417 3300005289 Bacteria 995
10 Ga0065704_10193752 3300005289 Bacteria 1168
11 Ga0065704_10415633 3300005289 Bacteria 706
12 Ga0065704_10695390 3300005289 Unclassified 563
13 Ga0065712_10006984 3300005290 Unclassified 3064
14 Ga0065712_10011917 3300005290 Bacteria 2009
15 Ga0065712_10129135 3300005290 Bacteria 1559
16 Ga0065715_10012321 3300005293 Unclassified 2416
17 Ga0065715_10098646 3300005293 Bacteria 3514
18 Ga0065715_10230264 3300005293 Bacteria 1236
19 Ga0065715_10348063 3300005293 Unclassified 942
20 Ga0065715_11062046 3300005293 Bacteria 529
21 Ga0065707_10124882 3300005295 Unclassified 2023
22 Ga0065707_10207853 3300005295 Bacteria 1279
23 Ga0065707_10218351 3300005295 Bacteria 1214
24 Ga0065707_10241319 3300005295 Unclassified 1155
25 Ga0070658_10257816 3300005327 Bacteria 1480
26 Ga0070658_11050207 3300005327 Unclassified 709
27 Ga0070676_10069309 3300005328 Unclassified 2113
28 Ga0070683_100011212 3300005329 Bacteria 7735
29 Ga0070683_100048602 3300005329 Bacteria 3922
30 Ga0070690_100345759 3300005330 Unclassified 1078
31 Ga0070690_100358217 3300005330 Bacteria 1061
32 Ga0070670_100665295 3300005331 Bacteria 935
33 Ga0070677_10114873 3300005333 Unclassified 1207
34 Ga0068869_100196897 3300005334 Unclassified 1587
35 Ga0070666_10253695 3300005335 Bacteria 1246
36 Ga0070666_10316064 3300005335 Bacteria 1113
37 Ga0070666_10628452 3300005335 Bacteria 785
38 Ga0070666_11214180 3300005335 Unclassified 562
39 Ga0070680_100775128 3300005336 Bacteria 826
40 Ga0070682_100303231 3300005337 Bacteria 1173
41 Ga0068868_100031039 3300005338 Bacteria 4101
42 Ga0070660_100006893 3300005339 Bacteria 7882
43 Ga0070660_100659016 3300005339 Bacteria 877
44 Ga0070660_101472055 3300005339 Unclassified 579
45 Ga0070689_100006670 3300005340 Bacteria 8021
46 Ga0070689_100007427 3300005340 Bacteria 7661
47 Ga0070689_100118689 3300005340 Bacteria 2111
48 Ga0070661_100260373 3300005344 Bacteria 1341
49 Ga0070668_100137888 3300005347 Bacteria 1964
50 Ga0070668_100279196 3300005347 Bacteria 1394
51 Ga0070668_101541352 3300005347 Unclassified 608
52 Ga0070669_100288601 3300005353 Bacteria 1316
53 Ga0070675_100017435 3300005354 Bacteria 5705
54 Ga0070675_100033004 3300005354 Bacteria 4193
55 Ga0070675_100335377 3300005354 Bacteria 1338
56 Ga0070675_100554437 3300005354 Bacteria 1040
57 Ga0070675_100573763 3300005354 Unclassified 1022
58 Ga0070671_100031990 3300005355 Bacteria 4349
59 Ga0070671_100166078 3300005355 Unclassified 1866
60 Ga0070671_100664604 3300005355 Bacteria 903
61 Ga0070674_100115748 3300005356 Bacteria 1977
62 Ga0070674_100578873 3300005356 Bacteria 946
63 Ga0070674_100931545 3300005356 Unclassified 758
64 Ga0070673_100001802 3300005364 Bacteria 12775
65 Ga0070673_100054279 3300005364 Unclassified 3151
66 Ga0070673_101185096 3300005364 Unclassified 715
67 Ga0070673_101999310 3300005364 Unclassified 550
68 Ga0070688_100003545 3300005365 Bacteria 8042
69 Ga0070688_100003930 3300005365 Bacteria 7707
70 Ga0070688_100004655 3300005365 Bacteria 7161
71 Ga0070659_100003503 3300005366 Bacteria 11177
72 Ga0070659_100435065 3300005366 Bacteria 1111
73 Ga0070659_100634601 3300005366 Unclassified 920
74 Ga0070667_100216264 3300005367 Unclassified 1704
75 Ga0070667_100593901 3300005367 Bacteria 1020
76 Ga0070667_101045527 3300005367 Unclassified 762
77 Ga0070709_10015230 3300005434 Bacteria 4369
78 Ga0070709_10100881 3300005434 Bacteria 1923
79 Ga0070709_10576627 3300005434 Bacteria 864
80 Ga0070709_11438518 3300005434 Unclassified 559
81 Ga0070714_100013099 3300005435 Bacteria 6638
82 Ga0070714_100232632 3300005435 Unclassified 1698
83 Ga0070714_100608650 3300005435 Bacteria 1049
84 Ga0070713_100067914 3300005436 Bacteria 3003
85 Ga0070713_100154241 3300005436 Bacteria 2046
86 Ga0070713_100217462 3300005436 Unclassified 1732
87 Ga0070713_100267300 3300005436 Bacteria 1565
88 Ga0070713_100307942 3300005436 Bacteria 1460
89 Ga0070713_101438150 3300005436 Unclassified 669
90 Ga0070713_102383714 3300005436 Unclassified 512
91 Ga0070710_10038388 3300005437 Bacteria 2630
92 Ga0070710_10116481 3300005437 Unclassified 1611
93 Ga0070710_10156673 3300005437 Bacteria 1409
94 Ga0070710_10306038 3300005437 Bacteria 1039
95 Ga0070710_10573810 3300005437 Bacteria 782
96 Ga0070710_10738438 3300005437 Bacteria 698
97 Ga0070701_10171066 3300005438 Unclassified 1265
98 Ga0070701_10215165 3300005438 Bacteria 1143
99 Ga0070711_100006507 3300005439 Bacteria 7045
100 Ga0070711_100053814 3300005439 Bacteria 2775
101 Ga0070711_100102505 3300005439 Bacteria 2084
102 Ga0070705_100083056 3300005440 Unclassified 1973
103 Ga0070705_100126554 3300005440 Bacteria 1659
104 Ga0070705_100419228 3300005440 Bacteria 996
105 Ga0070700_100010793 3300005441 Bacteria 5049
106 Ga0070694_100134473 3300005444 Bacteria 1790
107 Ga0070708_100035044 3300005445 Bacteria 4370
108 Ga0070708_100155206 3300005445 Bacteria 2131
109 Ga0070708_100831488 3300005445 Unclassified 868
110 Ga0070708_101184239 3300005445 Bacteria 715
111 Ga0070708_101314879 3300005445 Bacteria 675
112 Ga0070708_102219667 3300005445 Bacteria 507
113 Ga0070663_101137110 3300005455 Bacteria 684
114 Ga0070678_100045438 3300005456 Bacteria 3143
115 Ga0070678_100061744 3300005456 Unclassified 2763
116 Ga0070678_100145796 3300005456 Unclassified 1900
117 Ga0070662_100019102 3300005457 Bacteria 4648
118 Ga0070662_100027468 3300005457 Unclassified 3950
119 Ga0070662_100121461 3300005457 Bacteria 2003
120 Ga0070662_100358049 3300005457 Bacteria 1197
121 Ga0070681_10042347 3300005458 Bacteria 4563
122 Ga0070685_10014746 3300005466 Unclassified 4144
123 Ga0070685_10061011 3300005466 Unclassified 2207
124 Ga0070706_100000218 3300005467 Bacteria 70622
125 Ga0070706_100062966 3300005467 Bacteria 3427
126 Ga0070706_100080916 3300005467 Unclassified 3008
127 Ga0070706_100089406 3300005467 Bacteria 2855
128 Ga0070706_100236259 3300005467 Unclassified 1706
129 Ga0070706_100250725 3300005467 Bacteria 1653
130 Ga0070706_101091328 3300005467 Unclassified 735
131 Ga0070706_101136366 3300005467 Unclassified 719
132 Ga0070706_101389517 3300005467 Bacteria 643
133 Ga0070707_100076452 3300005468 Unclassified 3230
134 Ga0070707_100094690 3300005468 Bacteria 2891
135 Ga0070707_100280362 3300005468 Unclassified 1620
136 Ga0070707_100312212 3300005468 Bacteria 1528
137 Ga0070707_100421366 3300005468 Bacteria 1295
138 Ga0070707_100502946 3300005468 Bacteria 1174
139 Ga0070698_100009964 3300005471 Bacteria 10161
140 Ga0070698_100022507 3300005471 Bacteria 6593
141 Ga0070698_100155739 3300005471 Bacteria 2230
142 Ga0070698_100346898 3300005471 Unclassified 1416
143 Ga0070698_100614185 3300005471 Unclassified 1028
144 Ga0070698_101416280 3300005471 Bacteria 646
145 Ga0070699_100120714 3300005518 Bacteria 2304
146 Ga0070699_100902004 3300005518 Bacteria 810
147 Ga0070699_101439049 3300005518 Unclassified 632
148 Ga0070699_101653547 3300005518 Bacteria 586
149 Ga0070679_100608386 3300005530 Unclassified 1036
150 Ga0070684_100001520 3300005535 Bacteria 16769
151 Ga0070684_100689435 3300005535 Bacteria 952
152 Ga0070684_101307466 3300005535 Bacteria 682
153 Ga0070697_100016187 3300005536 Bacteria 5864
154 Ga0070697_100032855 3300005536 Unclassified 4178
155 Ga0070697_100033606 3300005536 Bacteria 4131
156 Ga0070697_100126103 3300005536 Bacteria 2144
157 Ga0070697_100211260 3300005536 Bacteria 1652
158 Ga0070697_100351694 3300005536 Bacteria 1273
159 Ga0070697_101064601 3300005536 Bacteria 719
160 Ga0070697_101147534 3300005536 Unclassified 692
161 Ga0070697_101204533 3300005536 Unclassified 675
162 Ga0070672_100072922 3300005543 Bacteria 2735
163 Ga0070672_100215775 3300005543 Unclassified 1608
164 Ga0070672_100224980 3300005543 Unclassified 1574
165 Ga0070672_101548772 3300005543 Unclassified 594
166 Ga0070686_100391283 3300005544 Bacteria 1055
167 Ga0070695_100192050 3300005545 Bacteria 1454
168 Ga0070696_100526134 3300005546 Bacteria 944
169 Ga0070665_100027567 3300005548 Bacteria 5721
170 Ga0070665_100113471 3300005548 Unclassified 2713
171 Ga0070665_101468524 3300005548 Unclassified 690
172 Ga0070704_100002967 3300005549 Bacteria 9643
173 Ga0070704_100764964 3300005549 Bacteria 861
174 Ga0070664_101648659 3300005564 Unclassified 608
175 Ga0068857_100389551 3300005577 Unclassified 1295
176 Ga0068854_100105524 3300005578 Bacteria 2118
177 Ga0068856_100160431 3300005614 Unclassified 2259
178 Ga0068856_100161267 3300005614 Bacteria 2253
179 Ga0070702_100027995 3300005615 Unclassified 3049
180 Ga0070702_100105769 3300005615 Unclassified 1735
181 Ga0070702_101742048 3300005615 Bacteria 519
182 Ga0068864_100040823 3300005618 Unclassified 3968
183 Ga0068866_10608494 3300005718 Bacteria 739
184 Ga0068861_102105159 3300005719 Unclassified 564
185 Ga0068851_10451034 3300005834 Unclassified 764
186 Ga0068863_100002599 3300005841 Bacteria 17914
187 Ga0068863_100077542 3300005841 Bacteria 3145
188 Ga0068863_100120955 3300005841 Bacteria 2496
189 Ga0068863_100152982 3300005841 Unclassified 2208
190 Ga0068863_101503374 3300005841 Unclassified 682
191 Ga0068858_100001603 3300005842 Bacteria 23098
192 Ga0068858_100131016 3300005842 Unclassified 2351
193 Ga0068860_100007710 3300005843 Bacteria 10765
194 Ga0068860_101661350 3300005843 Unclassified 661
195 Ga0081455_10002976 3300005937 Bacteria 19806
196 Ga0081455_10003354 3300005937 Bacteria 18464
197 Ga0081455_10032679 3300005937 Bacteria 4687
198 Ga0081455_10037973 3300005937 Bacteria 4268
199 Ga0081455_10099004 3300005937 Bacteria 2346
200 Ga0081455_10124982 3300005937 Bacteria 2020
201 Ga0081540_1000057 3300005983 Bacteria 121566
202 Ga0081540_1037749 3300005983 Bacteria 2555
203 Ga0081540_1048239 3300005983 Bacteria 2134
204 Ga0081540_1088727 3300005983 Unclassified 1366
205 Ga0081539_10146363 3300005985 Bacteria 1142
206 Ga0070717_10010249 3300006028 Bacteria 7062
207 Ga0070717_10016767 3300006028 Bacteria 5686
208 Ga0070717_10017293 3300006028 Bacteria 5609
209 Ga0070717_10040998 3300006028 Unclassified 3774
210 Ga0070717_10055249 3300006028 Unclassified 3275
211 Ga0070717_10079972 3300006028 Unclassified 2742
212 Ga0070717_10113763 3300006028 Bacteria 2311
213 Ga0070717_10155883 3300006028 Bacteria 1978
214 Ga0070717_10284337 3300006028 Bacteria 1468
215 Ga0070717_10399783 3300006028 Bacteria 1234
216 Ga0070717_11866190 3300006028 Unclassified 543
217 Ga0070715_10196214 3300006163 Bacteria 1022
218 Ga0070715_10239635 3300006163 Bacteria 942
219 Ga0070716_100088639 3300006173 Unclassified 1867
220 Ga0070716_100209891 3300006173 Bacteria 1300
221 Ga0070712_100111528 3300006175 Unclassified 2042
222 Ga0070712_100115328 3300006175 Bacteria 2013
223 Ga0070712_100323916 3300006175 Bacteria 1254
224 Ga0070712_100700193 3300006175 Bacteria 864
225 Ga0070712_101016379 3300006175 Archaea 718
226 Ga0070712_101033260 3300006175 Unclassified 712
227 Ga0070712_101531319 3300006175 Bacteria 583
228 Ga0068871_100047366 3300006358 Unclassified 3467
229 Ga0068871_100061617 3300006358 Bacteria 3064
230 Ga0068871_102281082 3300006358 Unclassified 516
231 Ga0075428_100207637 3300006844 Bacteria 2117
232 Ga0075428_100854350 3300006844 Unclassified 966
233 Ga0075428_101581021 3300006844 Bacteria 686
234 Ga0075433_10499338 3300006852 Bacteria 1071
235 Ga0075433_10573608 3300006852 Bacteria 991
236 Ga0075434_100302930 3300006871 Bacteria 1619
237 Ga0075434_101240908 3300006871 Bacteria 757
238 Ga0068865_100349604 3300006881 Unclassified 1197
239 Ga0068865_100359298 3300006881 Bacteria 1182
240 Ga0068865_100532734 3300006881 Bacteria 984
241 Ga0099795_10076169 3300007788 Bacteria 1275
242 Ga0105240_10243861 3300009093 Bacteria 2082
243 Ga0111539_12177938 3300009094 Bacteria 643
244 Ga0105245_10211742 3300009098 Bacteria 1866
245 Ga0105245_12488820 3300009098 Bacteria 571
246 Ga0114129_10059979 3300009147 Bacteria 5319
247 Ga0114129_10243449 3300009147 Bacteria 2417
248 Ga0105243_10154299 3300009148 Bacteria 1973
249 Ga0105241_10207277 3300009174 Bacteria 1641
250 Ga0105242_10123314 3300009176 Unclassified 2227
251 Ga0105242_10255326 3300009176 Unclassified 1581
252 Ga0105242_10494741 3300009176 Bacteria 1162
253 Ga0105242_10571873 3300009176 Unclassified 1087
254 Ga0105248_10233792 3300009177 Unclassified 2069
255 Ga0105248_10268929 3300009177 Bacteria 1919
256 Ga0105249_10001815 3300009553 Bacteria 18572
257 Ga0105239_10046832 3300010375 Unclassified 4738
258 Ga0105239_10165378 3300010375 Bacteria 2474
259 Ga0105239_10804410 3300010375 Bacteria 1077
260 Ga0105246_10034729 3300011119 Bacteria 3363
261 Ga0105246_10377561 3300011119 Unclassified 1170
262 Ga0157371_10193774 3300013102 Bacteria 1456
263 Ga0157371_10609010 3300013102 Unclassified 813
264 Ga0157369_10021927 3300013105 Bacteria 7140
265 Ga0157369_11374019 3300013105 Bacteria 719
266 Ga0157369_11630865 3300013105 Unclassified 656
267 Ga0157374_10010136 3300013296 Bacteria 8095
268 Ga0157374_10027052 3300013296 Bacteria 5168
269 Ga0157374_10088988 3300013296 Bacteria 2941
270 Ga0157374_10110278 3300013296 Bacteria 2646
271 Ga0157374_10116211 3300013296 Bacteria 2577
272 Ga0157374_10179016 3300013296 Bacteria 2070
273 Ga0157374_10352127 3300013296 Bacteria 1463
274 Ga0157374_10630420 3300013296 Unclassified 1083
275 Ga0157374_11397965 3300013296 Bacteria 723
276 Ga0157374_12174145 3300013296 Unclassified 582
277 Ga0157378_10016630 3300013297 Bacteria 6444
278 Ga0157378_10027882 3300013297 Bacteria 4980
279 Ga0157378_10109265 3300013297 Unclassified 2533
280 Ga0157378_10186618 3300013297 Unclassified 1953
281 Ga0157378_10865934 3300013297 Bacteria 933
282 Ga0157378_11309739 3300013297 Unclassified 766
283 Ga0163162_10184484 3300013306 Unclassified 2213
284 Ga0163162_10291448 3300013306 Bacteria 1764
285 Ga0163162_10392324 3300013306 Bacteria 1521
286 Ga0163162_10531563 3300013306 Unclassified 1305
287 Ga0157372_10196037 3300013307 Bacteria 2339
288 Ga0157372_10951082 3300013307 Unclassified 996
289 Ga0157372_11018018 3300013307 Bacteria 959
290 Ga0157375_10014829 3300013308 Bacteria 6964
291 Ga0157375_10017679 3300013308 Bacteria 6443
292 Ga0157375_10126092 3300013308 Bacteria 2675
293 Ga0157375_10816712 3300013308 Bacteria 1080
294 Ga0157375_10822834 3300013308 Bacteria 1076
295 Ga0157375_11070303 3300013308 Bacteria 943
296 Ga0157375_13030756 3300013308 Bacteria 561
297 Ga0163163_10156937 3300014325 Bacteria 2320
298 Ga0163163_10250094 3300014325 Bacteria 1823
299 Ga0163163_10309103 3300014325 Unclassified 1633
300 Ga0163163_10395880 3300014325 Bacteria 1439
301 Ga0163163_10561221 3300014325 Bacteria 1204
302 Ga0163163_11673391 3300014325 Unclassified 697
303 Ga0157377_10497588 3300014745 Unclassified 851
304 Ga0157377_11404275 3300014745 Unclassified 551
305 Ga0157379_10008472 3300014968 Bacteria 8945
306 Ga0157379_11477116 3300014968 Bacteria 661
307 Ga0157376_10002885 3300014969 Bacteria 11782
308 Ga0157376_10167937 3300014969 Unclassified 1995
309 Ga0157376_10236780 3300014969 Bacteria 1699
310 Ga0157376_11218731 3300014969 Unclassified 781
311 Ga0182006_1051817 3300015261 Unclassified 1578
312 Ga0163161_10195099 3300017792 Bacteria 1558
313 Ga0163161_10237874 3300017792 Bacteria 1415
314 Ga0163161_10682739 3300017792 Unclassified 854
315 Ga0213872_10154499 3300021361 Unclassified 1001
316 Ga0213871_10048132 3300021441 Unclassified 1161
317 Ga0207666_1001723 3300025271 Bacteria 2598
318 Ga0207666_1004614 3300025271 Bacteria 1733
319 Ga0207673_1001059 3300025290 Unclassified 2966
320 Ga0207673_1001448 3300025290 Bacteria 2593
321 Ga0207697_10000492 3300025315 Bacteria 22218
322 Ga0207697_10000847 3300025315 Bacteria 17271
323 Ga0207697_10000853 3300025315 Bacteria 17252
324 Ga0207697_10007619 3300025315 Bacteria 4808
325 Ga0207697_10091530 3300025315 Bacteria 1289
326 Ga0207697_10185478 3300025315 Bacteria 913
327 Ga0207697_10260879 3300025315 Bacteria 767
328 Ga0207697_10331517 3300025315 Unclassified 676
329 Ga0207682_10141595 3300025893 Bacteria 1079
330 Ga0207692_10026824 3300025898 Bacteria 2706
331 Ga0207692_10363893 3300025898 Unclassified 894
332 Ga0207642_10279556 3300025899 Bacteria 960
333 Ga0207710_10183665 3300025900 Bacteria 1027
334 Ga0207688_10152626 3300025901 Bacteria 1365
335 Ga0207680_10075153 3300025903 Bacteria 2107
336 Ga0207680_10206446 3300025903 Unclassified 1341
337 Ga0207647_10008787 3300025904 Bacteria 7211
338 Ga0207647_10738956 3300025904 Bacteria 534
339 Ga0207685_10048213 3300025905 Bacteria 1631
340 Ga0207685_10266690 3300025905 Bacteria 835
341 Ga0207699_10171405 3300025906 Bacteria 1452
342 Ga0207699_10729406 3300025906 Unclassified 726
343 Ga0207645_10003903 3300025907 Bacteria 11144
344 Ga0207705_10441700 3300025909 Bacteria 1008
345 Ga0207684_10000292 3300025910 Bacteria 71954
346 Ga0207684_10015288 3300025910 Bacteria 6611
347 Ga0207684_10026449 3300025910 Bacteria 4946
348 Ga0207684_10033758 3300025910 Bacteria 4351
349 Ga0207684_10113658 3300025910 Unclassified 2318
350 Ga0207684_10164260 3300025910 Bacteria 1913
351 Ga0207684_10275718 3300025910 Bacteria 1451
352 Ga0207684_10296810 3300025910 Bacteria 1393
353 Ga0207684_10545153 3300025910 Unclassified 992
354 Ga0207684_11338567 3300025910 Unclassified 588
355 Ga0207695_10191894 3300025913 Bacteria 1960
356 Ga0207693_10015725 3300025915 Bacteria 6063
357 Ga0207693_10125512 3300025915 Bacteria 2017
358 Ga0207693_10415061 3300025915 Unclassified 1052
359 Ga0207693_10440011 3300025915 Unclassified 1019
360 Ga0207693_10490407 3300025915 Bacteria 959
361 Ga0207693_10617610 3300025915 Bacteria 843
362 Ga0207663_10095084 3300025916 Unclassified 1987
363 Ga0207660_10173499 3300025917 Bacteria 1670
364 Ga0207657_10014378 3300025919 Bacteria 7727
365 Ga0207657_10674391 3300025919 Bacteria 804
366 Ga0207649_10531232 3300025920 Unclassified 898
367 Ga0207652_10835864 3300025921 Bacteria 816
368 Ga0207646_10075894 3300025922 Unclassified 3003
369 Ga0207646_10092278 3300025922 Bacteria 2710
370 Ga0207646_10107483 3300025922 Bacteria 2503
371 Ga0207646_10130029 3300025922 Unclassified 2266
372 Ga0207646_10185223 3300025922 Unclassified 1880
373 Ga0207646_10269658 3300025922 Unclassified 1538
374 Ga0207646_10409251 3300025922 Unclassified 1225
375 Ga0207646_11570498 3300025922 Unclassified 568
376 Ga0207681_11123756 3300025923 Bacteria 660
377 Ga0207650_10415822 3300025925 Bacteria 1115
378 Ga0207659_10010798 3300025926 Bacteria 5748
379 Ga0207659_10121952 3300025926 Bacteria 1998
380 Ga0207659_10142419 3300025926 Unclassified 1862
381 Ga0207659_10236279 3300025926 Bacteria 1476
382 Ga0207687_10199172 3300025927 Bacteria 1564
383 Ga0207700_10040747 3300025928 Unclassified 3392
384 Ga0207700_10263213 3300025928 Bacteria 1477
385 Ga0207664_10044558 3300025929 Unclassified 3475
386 Ga0207664_10174683 3300025929 Unclassified 1841
387 Ga0207664_10358163 3300025929 Bacteria 1292
388 Ga0207664_10379862 3300025929 Bacteria 1254
389 Ga0207664_10436817 3300025929 Bacteria 1167
390 Ga0207644_10129660 3300025931 Bacteria 1929
391 Ga0207644_10205371 3300025931 Bacteria 1555
392 Ga0207644_10404467 3300025931 Bacteria 1116
393 Ga0207690_10022558 3300025932 Bacteria 3918
394 Ga0207690_10409252 3300025932 Bacteria 1083
395 Ga0207706_10030800 3300025933 Unclassified 4785
396 Ga0207706_10166312 3300025933 Bacteria 1938
397 Ga0207706_10334710 3300025933 Bacteria 1317
398 Ga0207686_10086831 3300025934 Unclassified 2056
399 Ga0207686_10155250 3300025934 Bacteria 1598
400 Ga0207709_10793729 3300025935 Unclassified 764
401 Ga0207670_10059168 3300025936 Bacteria 2605
402 Ga0207670_10062818 3300025936 Bacteria 2539
403 Ga0207670_10232379 3300025936 Bacteria 1417
404 Ga0207669_10144320 3300025937 Unclassified 1657
405 Ga0207669_10340078 3300025937 Bacteria 1156
406 Ga0207669_10396243 3300025937 Bacteria 1080
407 Ga0207704_10079830 3300025938 Bacteria 2110
408 Ga0207704_10085054 3300025938 Bacteria 2058
409 Ga0207704_10450138 3300025938 Bacteria 1027
410 Ga0207665_10033942 3300025939 Unclassified 3385
411 Ga0207665_10037908 3300025939 Bacteria 3208
412 Ga0207665_10044599 3300025939 Bacteria 2967
413 Ga0207665_10105541 3300025939 Bacteria 1973
414 Ga0207665_10140210 3300025939 Unclassified 1723
415 Ga0207665_10169394 3300025939 Unclassified 1576
416 Ga0207665_10201983 3300025939 Unclassified 1449
417 Ga0207665_11095950 3300025939 Bacteria 635
418 Ga0207691_10007809 3300025940 Bacteria 10301
419 Ga0207691_10031554 3300025940 Bacteria 4944
420 Ga0207711_11555680 3300025941 Unclassified 604
421 Ga0207689_10259595 3300025942 Unclassified 1437
422 Ga0207689_10494740 3300025942 Unclassified 1024
423 Ga0207661_10189109 3300025944 Bacteria 1804
424 Ga0207679_10071936 3300025945 Unclassified 2610
425 Ga0207651_10002389 3300025960 Bacteria 8967
426 Ga0207651_11203818 3300025960 Unclassified 680
427 Ga0207712_10007194 3300025961 Bacteria 7019
428 Ga0207712_10120200 3300025961 Unclassified 1986
429 Ga0207668_10197579 3300025972 Bacteria 1599
430 Ga0207668_10411507 3300025972 Bacteria 1146
431 Ga0207668_10703360 3300025972 Bacteria 888
432 Ga0207640_10297143 3300025981 Unclassified 1276
433 Ga0207658_10204440 3300025986 Bacteria 1651
434 Ga0207677_10036468 3300026023 Bacteria 3205
435 Ga0207703_10064701 3300026035 Bacteria 3002
436 Ga0207703_10219430 3300026035 Unclassified 1699
437 Ga0207703_11428483 3300026035 Bacteria 666
438 Ga0207678_10225600 3300026067 Unclassified 1604
439 Ga0207678_10785970 3300026067 Bacteria 840
440 Ga0207678_11124147 3300026067 Unclassified 696
441 Ga0207708_10016626 3300026075 Bacteria 5535
442 Ga0207702_10153532 3300026078 Bacteria 2097
443 Ga0207641_10021172 3300026088 Bacteria 5345
444 Ga0207641_10068173 3300026088 Bacteria 3050
445 Ga0207641_10159905 3300026088 Unclassified 2047
446 Ga0207676_10437281 3300026095 Bacteria 1230
447 Ga0207676_10782792 3300026095 Unclassified 930
448 Ga0207676_11771272 3300026095 Bacteria 616
449 Ga0207674_12090740 3300026116 Bacteria 530
450 Ga0207675_100105591 3300026118 Unclassified 2655
451 Ga0207683_10006047 3300026121 Bacteria 10362
452 Ga0207683_10034795 3300026121 Unclassified 4380
453 Ga0210002_1057659 3300027617 Bacteria 675
454 Ga0268266_10011660 3300028379 Bacteria 7629
455 Ga0268266_10323481 3300028379 Bacteria 1444
456 Ga0268266_10960691 3300028379 Unclassified 827
457 Ga0268264_10187010 3300028381 Unclassified 1885
458 Ga0373923_0120469 3300035111 Bacteria 1172
459 Ga0373953_0514098 3300035117 Bacteria 531
460 Ga0373954_0243106 3300035118 Unclassified 886
461 Ga0373956_0409127 3300035119 Unclassified 647
462 Ga0373943_0178297 3300035170 Bacteria 1167
463 Ga0373943_0724070 3300035170 Bacteria 590
464 Ga0373946_0158184 3300035171 Unclassified 1062
465 Ga0373946_0472198 3300035171 Bacteria 641
466 Ga0373955_0957777 3300035172 Bacteria 527
467 Ga0373924_0041031 3300035410 Bacteria 1896
468 Ga0373935_0377100 3300035692 Bacteria 1015
469 Ga0373927_0018960 3300035695 Unclassified 4514
470 Ga0373933_0226629 3300035724 Bacteria 1200
471 Ga0373947_0012308 3300035725 Bacteria 4903
472 Ga0373947_0033537 3300035725 Bacteria 3032
473 Ga0373947_0236747 3300035725 Bacteria 1204
474 Ga0373947_0523939 3300035725 Bacteria 806
475 Ga0373937_0331845 3300036401 Bacteria 1440
476 Ga0373937_0610467 3300036401 Bacteria 1035
477 Ga0373925_0307298 3300037068 Unclassified 1281
478 Ga0373925_0334314 3300037068 Bacteria 1228
479 Ga0373925_1284742 3300037068 Unclassified 601
480 Ga0395899_0371354 3300037312 Bacteria 952
481 Ga0395899_0534649 3300037312 Bacteria 756
482 Ga0395900_0007923 3300037418 Bacteria 10936
483 Ga0395900_0278889 3300037418 Bacteria 1664
484 Ga0395900_0518773 3300037418 Bacteria 1140
485 Ga0395900_1024403 3300037418 Bacteria 745
486 Ga0395900_1079864 3300037418 Bacteria 720
487 Ga0395898_0077009 3300037466 Bacteria 3220
488 Ga0395905_0203670 3300037471 Bacteria 1855
489 Ga0436364_0361571 3300037853 Bacteria 1090
490 Ga0395901_0154466 3300038443 Bacteria 2411
491 Ga0395901_0660134 3300038443 Bacteria 1048
492 Ga0395901_0956638 3300038443 Unclassified 835
493 Ga0395901_1875084 3300038443 Bacteria 547
494 Ga0436360_0402730 3300039438 Unclassified 1611
495 Ga0436361_0303249 3300039447 Unclassified 1512
496 Ga0436361_0675134 3300039447 Bacteria 1080
497 Ga0436362_0977882 3300039453 Unclassified 687
498 Ga0451807_0288746 3300041486 Unclassified 651
499 Ga0451839_0639711 3300041496 Unclassified 624
500 Ga0451853_3880816 3300041512 Bacteria 1679
501 Ga0439455_0036557 3300042012 Unclassified 1243
502 Ga0439458_0031886 3300042157 Unclassified 1258
503 Ga0439464_0133285 3300042439 Unclassified 770
504 Ga0466964_0020842 3300044706 Bacteria 2528
505 Ga0466967_0630308 3300045976 Bacteria 1059
506 Ga0495592_0094157 3300046454 Bacteria 2144
507 Ga0495603_0294268 3300046455 Bacteria 933
508 Ga0495651_0177862 3300046462 Bacteria 1509
509 Ga0495580_0356275 3300046472 Bacteria 991
510 Ga0495664_0330672 3300046477 Bacteria 919
511 Ga0495584_0488180 3300046491 Bacteria 627
512 Ga0495618_0128958 3300046514 Bacteria 1619
513 Ga0495618_0166494 3300046514 Unclassified 1404
514 Ga0495628_0848646 3300046516 Bacteria 636
515 Ga0495630_0293699 3300046517 Bacteria 1242
516 Ga0495630_0449651 3300046517 Unclassified 987
517 Ga0495666_0450432 3300046526 Bacteria 577
518 Ga0495652_0132881 3300046529 Bacteria 1967
519 Ga0495652_0149726 3300046529 Bacteria 1825
520 Ga0495640_0285760 3300046533 Bacteria 1027
521 Ga0495586_0799963 3300046535 Bacteria 544
522 Ga0495587_0067299 3300046536 Bacteria 2088
523 Ga0495645_0314674 3300046543 Bacteria 1018
524 Ga0495667_0215407 3300046559 Unclassified 1227
525 Ga0495634_0008725 3300046642 Bacteria 7517
526 Ga0495634_0094397 3300046642 Bacteria 1939
527 Ga0495634_0837337 3300046642 Bacteria 523
528 Ga0495635_0799286 3300046663 Unclassified 608
529 Ga0495599_0289130 3300046678 Bacteria 991
530 Ga0495646_0054827 3300046680 Bacteria 2396
531 Ga0495647_0427619 3300046681 Unclassified 611
532 Ga0495669_0190931 3300046684 Bacteria 978
533 Ga0495613_0094429 3300046689 Unclassified 2164
534 Ga0495624_0622761 3300046690 Unclassified 643
535 Ga0495581_0325631 3300047315 Unclassified 898
536 Ga0495604_0369233 3300047317 Bacteria 950
537 Ga0495674_0082451 3300047319 Bacteria 2757
538 Ga0495676_0425230 3300047321 Bacteria 879
539 Ga0495675_0366542 3300047444 Bacteria 845
540 Ga0495684_0011845 3300047471 Bacteria 6730
541 Ga0495626_0343195 3300048091 Unclassified 584
542 Ga0496100_0022890 3300048903 Unclassified 3787
543 Ga0496100_0070022 3300048903 Archaea 2338
544 Ga0496100_0540150 3300048903 Bacteria 901
545 Ga0496101_0049432 3300048904 Bacteria 3025
546 Ga0496101_0092567 3300048904 Bacteria 2251
547 Ga0496101_0116016 3300048904 Unclassified 2020
548 Ga0496102_0057758 3300048905 Unclassified 3544
549 Ga0496102_0087107 3300048905 Bacteria 2885
550 Ga0496102_0233602 3300048905 Unclassified 1733
551 Ga0496103_0096373 3300048906 Unclassified 1870
552 Ga0496103_0361681 3300048906 Bacteria 933
553 Ga0496104_0075583 3300048907 Unclassified 3208
554 Ga0496104_0234752 3300048907 Bacteria 1746
555 Ga0496104_0248553 3300048907 Bacteria 1691
556 Ga0496104_0781579 3300048907 Unclassified 861
557 Ga0496104_1058154 3300048907 Unclassified 715
558 Ga0496105_0190840 3300048908 Bacteria 1675
559 Ga0496105_0225263 3300048908 Bacteria 1525
560 Ga0496106_0023752 3300048909 Bacteria 4556
561 Ga0496106_0267467 3300048909 Unclassified 1368
562 Ga0496106_0859351 3300048909 Bacteria 718
563 Ga0496107_0058247 3300048910 Unclassified 2793
564 Ga0496107_0145246 3300048910 Bacteria 1754
565 Ga0496108_0072226 3300048911 Unclassified 2913
566 Ga0496108_0094907 3300048911 Bacteria 2539
567 Ga0496108_0146407 3300048911 Bacteria 2036
568 Ga0496108_0822476 3300048911 Bacteria 801
569 Ga0496109_0025522 3300048912 Bacteria 5267
570 Ga0496109_0360706 3300048912 Unclassified 1373
571 Ga0496109_0976852 3300048912 Unclassified 785
572 Ga0496110_0010931 3300048913 Bacteria 7403
573 Ga0496110_0785402 3300048913 Unclassified 856
574 Ga0496110_1097942 3300048913 Bacteria 704
575 Ga0496111_0074781 3300048914 Archaea 2468
576 Ga0496111_0178737 3300048914 Bacteria 1577
577 Ga0496112_0025752 3300048915 Bacteria 5650
578 Ga0496112_0209813 3300048915 Bacteria 1905
579 Ga0496112_0317332 3300048915 Unclassified 1503
580 Ga0496112_0384537 3300048915 Bacteria 1344
581 Ga0496112_0533042 3300048915 Bacteria 1108
582 Ga0496113_0359759 3300048916 Unclassified 1168
583 Ga0496113_0382520 3300048916 Bacteria 1129
584 Ga0496113_0472160 3300048916 Bacteria 1008
585 Ga0496114_0029846 3300048917 Bacteria 4483
586 Ga0496114_0045336 3300048917 Bacteria 3652
587 Ga0496115_0005912 3300048918 Bacteria 8921
588 Ga0496115_0023024 3300048918 Bacteria 4832
589 Ga0496115_0231002 3300048918 Unclassified 1525
590 Ga0496115_0361137 3300048918 Unclassified 1183
591 Ga0496115_0526085 3300048918 Archaea 948
592 Ga0501067_0255745 3300049583 Bacteria 975
593 Ga0501083_0013400 3300049744 Bacteria 5731
594 nmdc:mga05p37_224020_c1 3300050507 Bacteria 2268
595 nmdc:mga05p37_454619_c1 3300050507 Bacteria 1481
596 nmdc:mga05p37_53994_c1 3300050507 Unclassified 4943
597 nmdc:mga0n895_190623_c1 3300050512 Bacteria 2081
598 nmdc:mga0n895_768737_c1 3300050512 Bacteria 955
599 nmdc:mga0rr50_1411580_c1 3300050513 Unclassified 589
600 nmdc:mga0a205_622459_c1 3300050515 Bacteria 932
601 nmdc:mga0a205_634115_c1 3300050515 Unclassified 920
602 Ga0495619_0496329 3300053085 Bacteria 840

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0409127 Ga0373956_0409127_150_509 119
2 3300005272 Ga0065703_1000584 Ga0065703_10005842 138
3 3300005435 Ga0070714_100013099 Ga0070714_1000130994 138
4 3300005445 Ga0070708_101184239 Ga0070708_1011842392 138
5 3300005445 Ga0070708_101314879 Ga0070708_1013148791 138
6 3300005467 Ga0070706_100000218 Ga0070706_10000021840 138
7 3300005467 Ga0070706_101389517 Ga0070706_1013895171 138
8 3300005468 Ga0070707_100421366 Ga0070707_1004213661 138
9 3300005471 Ga0070698_100009964 Ga0070698_1000099643 138
10 3300005518 Ga0070699_100902004 Ga0070699_1009020042 138
11 3300005518 Ga0070699_101439049 Ga0070699_1014390491 138
12 3300005536 Ga0070697_100351694 Ga0070697_1003516942 138
13 3300006028 Ga0070717_10010249 Ga0070717_100102492 138
14 3300006028 Ga0070717_10040998 Ga0070717_100409983 138
15 3300006028 Ga0070717_10079972 Ga0070717_100799722 138
16 3300025910 Ga0207684_10000292 Ga0207684_1000029239 138
17 3300025910 Ga0207684_10113658 Ga0207684_101136585 138
18 3300025922 Ga0207646_10075894 Ga0207646_100758943 138
19 3300025922 Ga0207646_10185223 Ga0207646_101852231 138
20 3300037853 Ga0436364_0361571 Ga0436364_0361571_478_894 138
21 3300048910 Ga0496107_0145246 Ga0496107_0145246_907_1332 138
22 3300001989 JGI24739J22299_10217976 JGI24739J22299_102179761 139
23 3300001990 JGI24737J22298_10045963 JGI24737J22298_100459631 139
24 3300001991 JGI24743J22301_10009340 JGI24743J22301_100093402 139
25 3300002126 JGI24035J26624_1000390 JGI24035J26624_10003902 139
26 3300003911 JGI25405J52794_10000078 JGI25405J52794_1000007811 139
27 3300003911 JGI25405J52794_10003345 JGI25405J52794_100033452 139
28 3300005288 Ga0065714_10201160 Ga0065714_102011602 139
29 3300005289 Ga0065704_10027417 Ga0065704_100274171 139
30 3300005289 Ga0065704_10193752 Ga0065704_101937522 139
31 3300005289 Ga0065704_10415633 Ga0065704_104156331 139
32 3300005289 Ga0065704_10695390 Ga0065704_106953901 139
33 3300005290 Ga0065712_10006984 Ga0065712_100069842 139
34 3300005290 Ga0065712_10011917 Ga0065712_100119172 139
35 3300005290 Ga0065712_10129135 Ga0065712_101291353 139
36 3300005293 Ga0065715_10012321 Ga0065715_100123213 139
37 3300005293 Ga0065715_10098646 Ga0065715_100986463 139
38 3300005293 Ga0065715_10230264 Ga0065715_102302642 139
39 3300005293 Ga0065715_10348063 Ga0065715_103480631 139
40 3300005293 Ga0065715_11062046 Ga0065715_110620461 139
41 3300005295 Ga0065707_10124882 Ga0065707_101248822 139
42 3300005295 Ga0065707_10207853 Ga0065707_102078532 139
43 3300005295 Ga0065707_10218351 Ga0065707_102183511 139
44 3300005295 Ga0065707_10241319 Ga0065707_102413192 139
45 3300005327 Ga0070658_10257816 Ga0070658_102578161 139
46 3300005327 Ga0070658_11050207 Ga0070658_110502071 139
47 3300005328 Ga0070676_10069309 Ga0070676_100693092 139
48 3300005329 Ga0070683_100011212 Ga0070683_1000112125 139
49 3300005329 Ga0070683_100048602 Ga0070683_1000486023 139
50 3300005330 Ga0070690_100345759 Ga0070690_1003457591 139
51 3300005330 Ga0070690_100358217 Ga0070690_1003582172 139
52 3300005331 Ga0070670_100665295 Ga0070670_1006652951 139
53 3300005333 Ga0070677_10114873 Ga0070677_101148732 139
54 3300005334 Ga0068869_100196897 Ga0068869_1001968972 139
55 3300005335 Ga0070666_10253695 Ga0070666_102536952 139
56 3300005335 Ga0070666_10316064 Ga0070666_103160642 139
57 3300005335 Ga0070666_10628452 Ga0070666_106284521 139
58 3300005335 Ga0070666_11214180 Ga0070666_112141801 139
59 3300005336 Ga0070680_100775128 Ga0070680_1007751281 139
60 3300005337 Ga0070682_100303231 Ga0070682_1003032311 139
61 3300005338 Ga0068868_100031039 Ga0068868_1000310393 139
62 3300005339 Ga0070660_100006893 Ga0070660_1000068937 139
63 3300005339 Ga0070660_100659016 Ga0070660_1006590162 139
64 3300005339 Ga0070660_101472055 Ga0070660_1014720551 139
65 3300005340 Ga0070689_100006670 Ga0070689_1000066705 139
66 3300005340 Ga0070689_100007427 Ga0070689_1000074273 139
67 3300005340 Ga0070689_100118689 Ga0070689_1001186895 139
68 3300005344 Ga0070661_100260373 Ga0070661_1002603733 139
69 3300005347 Ga0070668_100137888 Ga0070668_1001378884 139
70 3300005347 Ga0070668_100279196 Ga0070668_1002791961 139
71 3300005347 Ga0070668_101541352 Ga0070668_1015413521 139
72 3300005353 Ga0070669_100288601 Ga0070669_1002886011 139
73 3300005354 Ga0070675_100017435 Ga0070675_1000174352 139
74 3300005354 Ga0070675_100033004 Ga0070675_1000330042 139
75 3300005354 Ga0070675_100335377 Ga0070675_1003353772 139
76 3300005354 Ga0070675_100554437 Ga0070675_1005544371 139
77 3300005354 Ga0070675_100573763 Ga0070675_1005737631 139
78 3300005355 Ga0070671_100031990 Ga0070671_1000319903 139
79 3300005355 Ga0070671_100166078 Ga0070671_1001660782 139
80 3300005355 Ga0070671_100664604 Ga0070671_1006646042 139
81 3300005356 Ga0070674_100115748 Ga0070674_1001157482 139
82 3300005356 Ga0070674_100578873 Ga0070674_1005788731 139
83 3300005356 Ga0070674_100931545 Ga0070674_1009315452 139
84 3300005364 Ga0070673_100001802 Ga0070673_10000180210 139
85 3300005364 Ga0070673_100054279 Ga0070673_1000542794 139
86 3300005364 Ga0070673_101185096 Ga0070673_1011850961 139
87 3300005364 Ga0070673_101999310 Ga0070673_1019993101 139
88 3300005365 Ga0070688_100003545 Ga0070688_1000035452 139
89 3300005365 Ga0070688_100003930 Ga0070688_1000039304 139
90 3300005365 Ga0070688_100004655 Ga0070688_1000046557 139
91 3300005366 Ga0070659_100003503 Ga0070659_1000035037 139
92 3300005366 Ga0070659_100435065 Ga0070659_1004350652 139
93 3300005366 Ga0070659_100634601 Ga0070659_1006346011 139
94 3300005367 Ga0070667_100216264 Ga0070667_1002162642 139
95 3300005367 Ga0070667_100593901 Ga0070667_1005939012 139
96 3300005367 Ga0070667_101045527 Ga0070667_1010455271 139
97 3300005434 Ga0070709_10015230 Ga0070709_100152304 139
98 3300005434 Ga0070709_10100881 Ga0070709_101008812 139
99 3300005434 Ga0070709_10576627 Ga0070709_105766272 139
100 3300005434 Ga0070709_11438518 Ga0070709_114385181 139
101 3300005435 Ga0070714_100232632 Ga0070714_1002326322 139
102 3300005435 Ga0070714_100608650 Ga0070714_1006086501 139
103 3300005436 Ga0070713_100067914 Ga0070713_1000679141 139
104 3300005436 Ga0070713_100154241 Ga0070713_1001542413 139
105 3300005436 Ga0070713_100217462 Ga0070713_1002174623 139
106 3300005436 Ga0070713_100267300 Ga0070713_1002673003 139
107 3300005436 Ga0070713_100307942 Ga0070713_1003079422 139
108 3300005436 Ga0070713_101438150 Ga0070713_1014381501 139
109 3300005436 Ga0070713_102383714 Ga0070713_1023837141 139
110 3300005437 Ga0070710_10038388 Ga0070710_100383884 139
111 3300005437 Ga0070710_10116481 Ga0070710_101164811 139
112 3300005437 Ga0070710_10156673 Ga0070710_101566732 139
113 3300005437 Ga0070710_10306038 Ga0070710_103060381 139
114 3300005437 Ga0070710_10573810 Ga0070710_105738101 139
115 3300005437 Ga0070710_10738438 Ga0070710_107384381 139
116 3300005438 Ga0070701_10171066 Ga0070701_101710661 139
117 3300005438 Ga0070701_10215165 Ga0070701_102151652 139
118 3300005439 Ga0070711_100006507 Ga0070711_1000065077 139
119 3300005439 Ga0070711_100053814 Ga0070711_1000538144 139
120 3300005439 Ga0070711_100102505 Ga0070711_1001025053 139
121 3300005440 Ga0070705_100083056 Ga0070705_1000830564 139
122 3300005440 Ga0070705_100126554 Ga0070705_1001265543 139
123 3300005440 Ga0070705_100419228 Ga0070705_1004192281 139
124 3300005441 Ga0070700_100010793 Ga0070700_1000107935 139
125 3300005444 Ga0070694_100134473 Ga0070694_1001344732 139
126 3300005445 Ga0070708_100035044 Ga0070708_1000350444 139
127 3300005445 Ga0070708_100155206 Ga0070708_1001552063 139
128 3300005445 Ga0070708_100831488 Ga0070708_1008314882 139
129 3300005445 Ga0070708_102219667 Ga0070708_1022196671 139
130 3300005455 Ga0070663_101137110 Ga0070663_1011371102 139
131 3300005456 Ga0070678_100045438 Ga0070678_1000454383 139
132 3300005456 Ga0070678_100061744 Ga0070678_1000617442 139
133 3300005456 Ga0070678_100145796 Ga0070678_1001457964 139
134 3300005457 Ga0070662_100019102 Ga0070662_1000191023 139
135 3300005457 Ga0070662_100027468 Ga0070662_1000274684 139
136 3300005457 Ga0070662_100121461 Ga0070662_1001214612 139
137 3300005457 Ga0070662_100358049 Ga0070662_1003580492 139
138 3300005458 Ga0070681_10042347 Ga0070681_100423473 139
139 3300005466 Ga0070685_10014746 Ga0070685_100147465 139
140 3300005466 Ga0070685_10061011 Ga0070685_100610112 139
141 3300005467 Ga0070706_100062966 Ga0070706_1000629665 139
142 3300005467 Ga0070706_100080916 Ga0070706_1000809163 139
143 3300005467 Ga0070706_100089406 Ga0070706_1000894062 139
144 3300005467 Ga0070706_100236259 Ga0070706_1002362593 139
145 3300005467 Ga0070706_100250725 Ga0070706_1002507252 139
146 3300005467 Ga0070706_101091328 Ga0070706_1010913281 139
147 3300005467 Ga0070706_101136366 Ga0070706_1011363662 139
148 3300005468 Ga0070707_100076452 Ga0070707_1000764523 139
149 3300005468 Ga0070707_100094690 Ga0070707_1000946902 139
150 3300005468 Ga0070707_100280362 Ga0070707_1002803622 139
151 3300005468 Ga0070707_100312212 Ga0070707_1003122122 139
152 3300005468 Ga0070707_100502946 Ga0070707_1005029462 139
153 3300005471 Ga0070698_100022507 Ga0070698_1000225073 139
154 3300005471 Ga0070698_100155739 Ga0070698_1001557393 139
155 3300005471 Ga0070698_100346898 Ga0070698_1003468982 139
156 3300005471 Ga0070698_100614185 Ga0070698_1006141852 139
157 3300005471 Ga0070698_101416280 Ga0070698_1014162801 139
158 3300005518 Ga0070699_100120714 Ga0070699_1001207143 139
159 3300005518 Ga0070699_101653547 Ga0070699_1016535471 139
160 3300005530 Ga0070679_100608386 Ga0070679_1006083861 139
161 3300005535 Ga0070684_100001520 Ga0070684_10000152014 139
162 3300005535 Ga0070684_100689435 Ga0070684_1006894351 139
163 3300005535 Ga0070684_101307466 Ga0070684_1013074661 139
164 3300005536 Ga0070697_100016187 Ga0070697_1000161874 139
165 3300005536 Ga0070697_100032855 Ga0070697_1000328554 139
166 3300005536 Ga0070697_100033606 Ga0070697_1000336062 139
167 3300005536 Ga0070697_100126103 Ga0070697_1001261034 139
168 3300005536 Ga0070697_100211260 Ga0070697_1002112602 139
169 3300005536 Ga0070697_101064601 Ga0070697_1010646011 139
170 3300005536 Ga0070697_101147534 Ga0070697_1011475341 139
171 3300005536 Ga0070697_101204533 Ga0070697_1012045331 139
172 3300005543 Ga0070672_100072922 Ga0070672_1000729222 139
173 3300005543 Ga0070672_100215775 Ga0070672_1002157752 139
174 3300005543 Ga0070672_100224980 Ga0070672_1002249801 139
175 3300005543 Ga0070672_101548772 Ga0070672_1015487721 139
176 3300005544 Ga0070686_100391283 Ga0070686_1003912832 139
177 3300005545 Ga0070695_100192050 Ga0070695_1001920502 139
178 3300005546 Ga0070696_100526134 Ga0070696_1005261342 139
179 3300005548 Ga0070665_100027567 Ga0070665_1000275677 139
180 3300005548 Ga0070665_100113471 Ga0070665_1001134714 139
181 3300005548 Ga0070665_101468524 Ga0070665_1014685241 139
182 3300005549 Ga0070704_100002967 Ga0070704_1000029677 139
183 3300005549 Ga0070704_100764964 Ga0070704_1007649641 139
184 3300005564 Ga0070664_101648659 Ga0070664_1016486591 139
185 3300005577 Ga0068857_100389551 Ga0068857_1003895512 139
186 3300005578 Ga0068854_100105524 Ga0068854_1001055244 139
187 3300005614 Ga0068856_100160431 Ga0068856_1001604311 139
188 3300005614 Ga0068856_100161267 Ga0068856_1001612672 139
189 3300005615 Ga0070702_100027995 Ga0070702_1000279951 139
190 3300005615 Ga0070702_100105769 Ga0070702_1001057691 139
191 3300005615 Ga0070702_101742048 Ga0070702_1017420481 139
192 3300005618 Ga0068864_100040823 Ga0068864_1000408233 139
193 3300005718 Ga0068866_10608494 Ga0068866_106084941 139
194 3300005719 Ga0068861_102105159 Ga0068861_1021051592 139
195 3300005834 Ga0068851_10451034 Ga0068851_104510342 139
196 3300005841 Ga0068863_100002599 Ga0068863_1000025992 139
197 3300005841 Ga0068863_100077542 Ga0068863_1000775422 139
198 3300005841 Ga0068863_100120955 Ga0068863_1001209552 139
199 3300005841 Ga0068863_100152982 Ga0068863_1001529822 139
200 3300005841 Ga0068863_101503374 Ga0068863_1015033741 139
201 3300005842 Ga0068858_100001603 Ga0068858_10000160322 139
202 3300005842 Ga0068858_100131016 Ga0068858_1001310164 139
203 3300005843 Ga0068860_100007710 Ga0068860_1000077107 139
204 3300005843 Ga0068860_101661350 Ga0068860_1016613501 139
205 3300005937 Ga0081455_10002976 Ga0081455_100029768 139
206 3300005937 Ga0081455_10003354 Ga0081455_100033547 139
207 3300005937 Ga0081455_10032679 Ga0081455_100326798 139
208 3300005937 Ga0081455_10037973 Ga0081455_100379733 139
209 3300005937 Ga0081455_10099004 Ga0081455_100990041 139
210 3300005937 Ga0081455_10124982 Ga0081455_101249821 139
211 3300005983 Ga0081540_1000057 Ga0081540_100005742 139
212 3300005983 Ga0081540_1037749 Ga0081540_10377493 139
213 3300005983 Ga0081540_1048239 Ga0081540_10482393 139
214 3300005983 Ga0081540_1088727 Ga0081540_10887273 139
215 3300005985 Ga0081539_10146363 Ga0081539_101463632 139
216 3300006028 Ga0070717_10016767 Ga0070717_100167674 139
217 3300006028 Ga0070717_10017293 Ga0070717_100172935 139
218 3300006028 Ga0070717_10055249 Ga0070717_100552494 139
219 3300006028 Ga0070717_10113763 Ga0070717_101137633 139
220 3300006028 Ga0070717_10155883 Ga0070717_101558832 139
221 3300006028 Ga0070717_10284337 Ga0070717_102843372 139
222 3300006028 Ga0070717_10399783 Ga0070717_103997832 139
223 3300006028 Ga0070717_11866190 Ga0070717_118661901 139
224 3300006163 Ga0070715_10196214 Ga0070715_101962142 139
225 3300006163 Ga0070715_10239635 Ga0070715_102396352 139
226 3300006173 Ga0070716_100088639 Ga0070716_1000886392 139
227 3300006173 Ga0070716_100209891 Ga0070716_1002098912 139
228 3300006175 Ga0070712_100111528 Ga0070712_1001115281 139
229 3300006175 Ga0070712_100115328 Ga0070712_1001153282 139
230 3300006175 Ga0070712_100323916 Ga0070712_1003239162 139
231 3300006175 Ga0070712_100700193 Ga0070712_1007001931 139
232 3300006175 Ga0070712_101016379 Ga0070712_1010163791 139
233 3300006175 Ga0070712_101033260 Ga0070712_1010332602 139
234 3300006175 Ga0070712_101531319 Ga0070712_1015313191 139
235 3300006358 Ga0068871_100047366 Ga0068871_1000473664 139
236 3300006358 Ga0068871_100061617 Ga0068871_1000616172 139
237 3300006358 Ga0068871_102281082 Ga0068871_1022810821 139
238 3300006844 Ga0075428_100207637 Ga0075428_1002076371 139
239 3300006844 Ga0075428_100854350 Ga0075428_1008543502 139
240 3300006844 Ga0075428_101581021 Ga0075428_1015810211 139
241 3300006852 Ga0075433_10499338 Ga0075433_104993382 139
242 3300006852 Ga0075433_10573608 Ga0075433_105736081 139
243 3300006871 Ga0075434_100302930 Ga0075434_1003029302 139
244 3300006871 Ga0075434_101240908 Ga0075434_1012409082 139
245 3300006881 Ga0068865_100349604 Ga0068865_1003496042 139
246 3300006881 Ga0068865_100359298 Ga0068865_1003592982 139
247 3300006881 Ga0068865_100532734 Ga0068865_1005327342 139
248 3300007788 Ga0099795_10076169 Ga0099795_100761692 139
249 3300009093 Ga0105240_10243861 Ga0105240_102438613 139
250 3300009094 Ga0111539_12177938 Ga0111539_121779381 139
251 3300009098 Ga0105245_10211742 Ga0105245_102117422 139
252 3300009098 Ga0105245_12488820 Ga0105245_124888201 139
253 3300009147 Ga0114129_10059979 Ga0114129_100599796 139
254 3300009147 Ga0114129_10243449 Ga0114129_102434492 139
255 3300009148 Ga0105243_10154299 Ga0105243_101542992 139
256 3300009174 Ga0105241_10207277 Ga0105241_102072772 139
257 3300009176 Ga0105242_10123314 Ga0105242_101233142 139
258 3300009176 Ga0105242_10255326 Ga0105242_102553262 139
259 3300009176 Ga0105242_10494741 Ga0105242_104947412 139
260 3300009176 Ga0105242_10571873 Ga0105242_105718732 139
261 3300009177 Ga0105248_10233792 Ga0105248_102337921 139
262 3300009177 Ga0105248_10268929 Ga0105248_102689292 139
263 3300009553 Ga0105249_10001815 Ga0105249_100018157 139
264 3300010375 Ga0105239_10046832 Ga0105239_100468325 139
265 3300010375 Ga0105239_10165378 Ga0105239_101653784 139
266 3300010375 Ga0105239_10804410 Ga0105239_108044102 139
267 3300011119 Ga0105246_10034729 Ga0105246_100347294 139
268 3300011119 Ga0105246_10377561 Ga0105246_103775611 139
269 3300013102 Ga0157371_10193774 Ga0157371_101937743 139
270 3300013102 Ga0157371_10609010 Ga0157371_106090102 139
271 3300013105 Ga0157369_10021927 Ga0157369_100219275 139
272 3300013105 Ga0157369_11374019 Ga0157369_113740191 139
273 3300013105 Ga0157369_11630865 Ga0157369_116308651 139
274 3300013296 Ga0157374_10010136 Ga0157374_100101363 139
275 3300013296 Ga0157374_10027052 Ga0157374_100270525 139
276 3300013296 Ga0157374_10088988 Ga0157374_100889884 139
277 3300013296 Ga0157374_10110278 Ga0157374_101102782 139
278 3300013296 Ga0157374_10116211 Ga0157374_101162112 139
279 3300013296 Ga0157374_10179016 Ga0157374_101790161 139
280 3300013296 Ga0157374_10352127 Ga0157374_103521271 139
281 3300013296 Ga0157374_10630420 Ga0157374_106304201 139
282 3300013296 Ga0157374_11397965 Ga0157374_113979651 139
283 3300013296 Ga0157374_12174145 Ga0157374_121741451 139
284 3300013297 Ga0157378_10016630 Ga0157378_100166306 139
285 3300013297 Ga0157378_10027882 Ga0157378_100278824 139
286 3300013297 Ga0157378_10109265 Ga0157378_101092653 139
287 3300013297 Ga0157378_10186618 Ga0157378_101866182 139
288 3300013297 Ga0157378_10865934 Ga0157378_108659342 139
289 3300013297 Ga0157378_11309739 Ga0157378_113097392 139
290 3300013306 Ga0163162_10184484 Ga0163162_101844842 139
291 3300013306 Ga0163162_10291448 Ga0163162_102914483 139
292 3300013306 Ga0163162_10392324 Ga0163162_103923242 139
293 3300013306 Ga0163162_10531563 Ga0163162_105315633 139
294 3300013307 Ga0157372_10196037 Ga0157372_101960374 139
295 3300013307 Ga0157372_10951082 Ga0157372_109510822 139
296 3300013307 Ga0157372_11018018 Ga0157372_110180181 139
297 3300013308 Ga0157375_10014829 Ga0157375_100148296 139
298 3300013308 Ga0157375_10017679 Ga0157375_100176792 139
299 3300013308 Ga0157375_10126092 Ga0157375_101260922 139
300 3300013308 Ga0157375_10816712 Ga0157375_108167122 139
301 3300013308 Ga0157375_10822834 Ga0157375_108228341 139
302 3300013308 Ga0157375_11070303 Ga0157375_110703031 139
303 3300013308 Ga0157375_13030756 Ga0157375_130307561 139
304 3300014325 Ga0163163_10156937 Ga0163163_101569373 139
305 3300014325 Ga0163163_10250094 Ga0163163_102500944 139
306 3300014325 Ga0163163_10309103 Ga0163163_103091032 139
307 3300014325 Ga0163163_10395880 Ga0163163_103958803 139
308 3300014325 Ga0163163_10561221 Ga0163163_105612211 139
309 3300014325 Ga0163163_11673391 Ga0163163_116733912 139
310 3300014745 Ga0157377_10497588 Ga0157377_104975881 139
311 3300014745 Ga0157377_11404275 Ga0157377_114042751 139
312 3300014968 Ga0157379_10008472 Ga0157379_100084727 139
313 3300014968 Ga0157379_11477116 Ga0157379_114771162 139
314 3300014969 Ga0157376_10002885 Ga0157376_100028857 139
315 3300014969 Ga0157376_10167937 Ga0157376_101679373 139
316 3300014969 Ga0157376_10236780 Ga0157376_102367802 139
317 3300014969 Ga0157376_11218731 Ga0157376_112187311 139
318 3300015261 Ga0182006_1051817 Ga0182006_10518172 139
319 3300017792 Ga0163161_10195099 Ga0163161_101950993 139
320 3300017792 Ga0163161_10237874 Ga0163161_102378742 139
321 3300017792 Ga0163161_10682739 Ga0163161_106827391 139
322 3300021361 Ga0213872_10154499 Ga0213872_101544992 139
323 3300021441 Ga0213871_10048132 Ga0213871_100481322 139
324 3300025271 Ga0207666_1001723 Ga0207666_10017232 139
325 3300025271 Ga0207666_1004614 Ga0207666_10046143 139
326 3300025290 Ga0207673_1001059 Ga0207673_10010594 139
327 3300025290 Ga0207673_1001448 Ga0207673_10014484 139
328 3300025315 Ga0207697_10000492 Ga0207697_1000049211 139
329 3300025315 Ga0207697_10000847 Ga0207697_1000084713 139
330 3300025315 Ga0207697_10000853 Ga0207697_1000085316 139
331 3300025315 Ga0207697_10007619 Ga0207697_100076197 139
332 3300025315 Ga0207697_10091530 Ga0207697_100915302 139
333 3300025315 Ga0207697_10185478 Ga0207697_101854781 139
334 3300025315 Ga0207697_10260879 Ga0207697_102608792 139
335 3300025315 Ga0207697_10331517 Ga0207697_103315171 139
336 3300025893 Ga0207682_10141595 Ga0207682_101415952 139
337 3300025898 Ga0207692_10026824 Ga0207692_100268241 139
338 3300025898 Ga0207692_10363893 Ga0207692_103638932 139
339 3300025899 Ga0207642_10279556 Ga0207642_102795561 139
340 3300025900 Ga0207710_10183665 Ga0207710_101836651 139
341 3300025901 Ga0207688_10152626 Ga0207688_101526261 139
342 3300025903 Ga0207680_10075153 Ga0207680_100751532 139
343 3300025903 Ga0207680_10206446 Ga0207680_102064463 139
344 3300025904 Ga0207647_10008787 Ga0207647_100087875 139
345 3300025904 Ga0207647_10738956 Ga0207647_107389561 139
346 3300025905 Ga0207685_10048213 Ga0207685_100482133 139
347 3300025905 Ga0207685_10266690 Ga0207685_102666902 139
348 3300025906 Ga0207699_10171405 Ga0207699_101714052 139
349 3300025906 Ga0207699_10729406 Ga0207699_107294062 139
350 3300025907 Ga0207645_10003903 Ga0207645_100039034 139
351 3300025909 Ga0207705_10441700 Ga0207705_104417002 139
352 3300025910 Ga0207684_10015288 Ga0207684_100152882 139
353 3300025910 Ga0207684_10026449 Ga0207684_100264494 139
354 3300025910 Ga0207684_10033758 Ga0207684_100337584 139
355 3300025910 Ga0207684_10164260 Ga0207684_101642602 139
356 3300025910 Ga0207684_10275718 Ga0207684_102757181 139
357 3300025910 Ga0207684_10296810 Ga0207684_102968102 139
358 3300025910 Ga0207684_10545153 Ga0207684_105451532 139
359 3300025910 Ga0207684_11338567 Ga0207684_113385671 139
360 3300025913 Ga0207695_10191894 Ga0207695_101918943 139
361 3300025915 Ga0207693_10015725 Ga0207693_100157254 139
362 3300025915 Ga0207693_10125512 Ga0207693_101255122 139
363 3300025915 Ga0207693_10415061 Ga0207693_104150611 139
364 3300025915 Ga0207693_10440011 Ga0207693_104400112 139
365 3300025915 Ga0207693_10490407 Ga0207693_104904072 139
366 3300025915 Ga0207693_10617610 Ga0207693_106176102 139
367 3300025916 Ga0207663_10095084 Ga0207663_100950844 139
368 3300025917 Ga0207660_10173499 Ga0207660_101734992 139
369 3300025919 Ga0207657_10014378 Ga0207657_100143785 139
370 3300025919 Ga0207657_10674391 Ga0207657_106743911 139
371 3300025920 Ga0207649_10531232 Ga0207649_105312322 139
372 3300025921 Ga0207652_10835864 Ga0207652_108358642 139
373 3300025922 Ga0207646_10092278 Ga0207646_100922784 139
374 3300025922 Ga0207646_10107483 Ga0207646_101074834 139
375 3300025922 Ga0207646_10130029 Ga0207646_101300294 139
376 3300025922 Ga0207646_10269658 Ga0207646_102696583 139
377 3300025922 Ga0207646_10409251 Ga0207646_104092512 139
378 3300025922 Ga0207646_11570498 Ga0207646_115704981 139
379 3300025923 Ga0207681_11123756 Ga0207681_111237562 139
380 3300025925 Ga0207650_10415822 Ga0207650_104158222 139
381 3300025926 Ga0207659_10010798 Ga0207659_100107985 139
382 3300025926 Ga0207659_10121952 Ga0207659_101219524 139
383 3300025926 Ga0207659_10142419 Ga0207659_101424192 139
384 3300025926 Ga0207659_10236279 Ga0207659_102362793 139
385 3300025927 Ga0207687_10199172 Ga0207687_101991721 139
386 3300025928 Ga0207700_10040747 Ga0207700_100407472 139
387 3300025928 Ga0207700_10263213 Ga0207700_102632132 139
388 3300025929 Ga0207664_10044558 Ga0207664_100445583 139
389 3300025929 Ga0207664_10174683 Ga0207664_101746831 139
390 3300025929 Ga0207664_10358163 Ga0207664_103581632 139
391 3300025929 Ga0207664_10379862 Ga0207664_103798622 139
392 3300025929 Ga0207664_10436817 Ga0207664_104368171 139
393 3300025931 Ga0207644_10129660 Ga0207644_101296602 139
394 3300025931 Ga0207644_10205371 Ga0207644_102053711 139
395 3300025931 Ga0207644_10404467 Ga0207644_104044672 139
396 3300025932 Ga0207690_10022558 Ga0207690_100225584 139
397 3300025932 Ga0207690_10409252 Ga0207690_104092522 139
398 3300025933 Ga0207706_10030800 Ga0207706_100308003 139
399 3300025933 Ga0207706_10166312 Ga0207706_101663123 139
400 3300025933 Ga0207706_10334710 Ga0207706_103347102 139
401 3300025934 Ga0207686_10086831 Ga0207686_100868312 139
402 3300025934 Ga0207686_10155250 Ga0207686_101552503 139
403 3300025935 Ga0207709_10793729 Ga0207709_107937291 139
404 3300025936 Ga0207670_10059168 Ga0207670_100591684 139
405 3300025936 Ga0207670_10062818 Ga0207670_100628184 139
406 3300025936 Ga0207670_10232379 Ga0207670_102323792 139
407 3300025937 Ga0207669_10144320 Ga0207669_101443202 139
408 3300025937 Ga0207669_10340078 Ga0207669_103400782 139
409 3300025937 Ga0207669_10396243 Ga0207669_103962432 139
410 3300025938 Ga0207704_10079830 Ga0207704_100798301 139
411 3300025938 Ga0207704_10085054 Ga0207704_100850544 139
412 3300025938 Ga0207704_10450138 Ga0207704_104501382 139
413 3300025939 Ga0207665_10033942 Ga0207665_100339422 139
414 3300025939 Ga0207665_10037908 Ga0207665_100379082 139
415 3300025939 Ga0207665_10044599 Ga0207665_100445992 139
416 3300025939 Ga0207665_10105541 Ga0207665_101055412 139
417 3300025939 Ga0207665_10140210 Ga0207665_101402102 139
418 3300025939 Ga0207665_10169394 Ga0207665_101693942 139
419 3300025939 Ga0207665_10201983 Ga0207665_102019832 139
420 3300025939 Ga0207665_11095950 Ga0207665_110959501 139
421 3300025940 Ga0207691_10007809 Ga0207691_100078096 139
422 3300025940 Ga0207691_10031554 Ga0207691_100315543 139
423 3300025941 Ga0207711_11555680 Ga0207711_115556802 139
424 3300025942 Ga0207689_10259595 Ga0207689_102595951 139
425 3300025942 Ga0207689_10494740 Ga0207689_104947401 139
426 3300025944 Ga0207661_10189109 Ga0207661_101891091 139
427 3300025945 Ga0207679_10071936 Ga0207679_100719362 139
428 3300025960 Ga0207651_10002389 Ga0207651_100023897 139
429 3300025960 Ga0207651_11203818 Ga0207651_112038181 139
430 3300025961 Ga0207712_10007194 Ga0207712_100071947 139
431 3300025961 Ga0207712_10120200 Ga0207712_101202003 139
432 3300025972 Ga0207668_10197579 Ga0207668_101975792 139
433 3300025972 Ga0207668_10411507 Ga0207668_104115072 139
434 3300025972 Ga0207668_10703360 Ga0207668_107033601 139
435 3300025981 Ga0207640_10297143 Ga0207640_102971433 139
436 3300025986 Ga0207658_10204440 Ga0207658_102044402 139
437 3300026023 Ga0207677_10036468 Ga0207677_100364681 139
438 3300026035 Ga0207703_10064701 Ga0207703_100647011 139
439 3300026035 Ga0207703_10219430 Ga0207703_102194302 139
440 3300026035 Ga0207703_11428483 Ga0207703_114284831 139
441 3300026067 Ga0207678_10225600 Ga0207678_102256001 139
442 3300026067 Ga0207678_10785970 Ga0207678_107859702 139
443 3300026067 Ga0207678_11124147 Ga0207678_111241472 139
444 3300026075 Ga0207708_10016626 Ga0207708_100166261 139
445 3300026078 Ga0207702_10153532 Ga0207702_101535322 139
446 3300026088 Ga0207641_10021172 Ga0207641_100211728 139
447 3300026088 Ga0207641_10068173 Ga0207641_100681732 139
448 3300026088 Ga0207641_10159905 Ga0207641_101599053 139
449 3300026095 Ga0207676_10437281 Ga0207676_104372812 139
450 3300026095 Ga0207676_10782792 Ga0207676_107827922 139
451 3300026095 Ga0207676_11771272 Ga0207676_117712721 139
452 3300026116 Ga0207674_12090740 Ga0207674_120907401 139
453 3300026118 Ga0207675_100105591 Ga0207675_1001055911 139
454 3300026121 Ga0207683_10006047 Ga0207683_100060473 139
455 3300026121 Ga0207683_10034795 Ga0207683_100347953 139
456 3300027617 Ga0210002_1057659 Ga0210002_10576592 139
457 3300028379 Ga0268266_10011660 Ga0268266_100116604 139
458 3300028379 Ga0268266_10323481 Ga0268266_103234812 139
459 3300028379 Ga0268266_10960691 Ga0268266_109606911 139
460 3300028381 Ga0268264_10187010 Ga0268264_101870103 139
461 3300035111 Ga0373923_0120469 Ga0373923_0120469_439_858 139
462 3300035117 Ga0373953_0514098 Ga0373953_0514098_24_449 139
463 3300035118 Ga0373954_0243106 Ga0373954_0243106_423_842 139
464 3300035170 Ga0373943_0178297 Ga0373943_0178297_528_947 139
465 3300035170 Ga0373943_0724070 Ga0373943_0724070_115_534 139
466 3300035171 Ga0373946_0158184 Ga0373946_0158184_323_742 139
467 3300035171 Ga0373946_0472198 Ga0373946_0472198_105_524 139
468 3300035172 Ga0373955_0957777 Ga0373955_0957777_27_446 139
469 3300035410 Ga0373924_0041031 Ga0373924_0041031_270_689 139
470 3300035692 Ga0373935_0377100 Ga0373935_0377100_457_876 139
471 3300035695 Ga0373927_0018960 Ga0373927_0018960_1941_2360 139
472 3300035724 Ga0373933_0226629 Ga0373933_0226629_635_1054 139
473 3300035725 Ga0373947_0012308 Ga0373947_0012308_1475_1894 139
474 3300035725 Ga0373947_0033537 Ga0373947_0033537_2031_2450 139
475 3300035725 Ga0373947_0236747 Ga0373947_0236747_137_556 139
476 3300035725 Ga0373947_0523939 Ga0373947_0523939_216_635 139
477 3300036401 Ga0373937_0331845 Ga0373937_0331845_165_584 139
478 3300036401 Ga0373937_0610467 Ga0373937_0610467_581_1000 139
479 3300037068 Ga0373925_0307298 Ga0373925_0307298_267_686 139
480 3300037068 Ga0373925_0334314 Ga0373925_0334314_319_738 139
481 3300037068 Ga0373925_1284742 Ga0373925_1284742_143_562 139
482 3300037312 Ga0395899_0371354 Ga0395899_0371354_116_535 139
483 3300037312 Ga0395899_0534649 Ga0395899_0534649_276_695 139
484 3300037418 Ga0395900_0007923 Ga0395900_0007923_2168_2587 139
485 3300037418 Ga0395900_0278889 Ga0395900_0278889_118_537 139
486 3300037418 Ga0395900_0518773 Ga0395900_0518773_366_785 139
487 3300037418 Ga0395900_1024403 Ga0395900_1024403_211_630 139
488 3300037418 Ga0395900_1079864 Ga0395900_1079864_236_655 139
489 3300037466 Ga0395898_0077009 Ga0395898_0077009_1586_2005 139
490 3300037471 Ga0395905_0203670 Ga0395905_0203670_962_1381 139
491 3300038443 Ga0395901_0154466 Ga0395901_0154466_600_1019 139
492 3300038443 Ga0395901_0660134 Ga0395901_0660134_189_608 139
493 3300038443 Ga0395901_0956638 Ga0395901_0956638_372_791 139
494 3300038443 Ga0395901_1875084 Ga0395901_1875084_50_469 139
495 3300039438 Ga0436360_0402730 Ga0436360_0402730_1069_1497 139
496 3300039447 Ga0436361_0303249 Ga0436361_0303249_339_767 139
497 3300039447 Ga0436361_0675134 Ga0436361_0675134_210_638 139
498 3300039453 Ga0436362_0977882 Ga0436362_0977882_34_462 139
499 3300041486 Ga0451807_0288746 Ga0451807_0288746_202_621 139
500 3300041496 Ga0451839_0639711 Ga0451839_0639711_89_508 139
501 3300041512 Ga0451853_3880816 Ga0451853_3880816_125_544 139
502 3300042012 Ga0439455_0036557 Ga0439455_0036557_19_438 139
503 3300042157 Ga0439458_0031886 Ga0439458_0031886_113_532 139
504 3300042439 Ga0439464_0133285 Ga0439464_0133285_42_461 139
505 3300044706 Ga0466964_0020842 Ga0466964_0020842_853_1272 139
506 3300045976 Ga0466967_0630308 Ga0466967_0630308_61_480 139
507 3300046454 Ga0495592_0094157 Ga0495592_0094157_452_871 139
508 3300046455 Ga0495603_0294268 Ga0495603_0294268_492_911 139
509 3300046462 Ga0495651_0177862 Ga0495651_0177862_191_610 139
510 3300046472 Ga0495580_0356275 Ga0495580_0356275_101_520 139
511 3300046477 Ga0495664_0330672 Ga0495664_0330672_31_456 139
512 3300046491 Ga0495584_0488180 Ga0495584_0488180_171_590 139
513 3300046514 Ga0495618_0128958 Ga0495618_0128958_535_954 139
514 3300046514 Ga0495618_0166494 Ga0495618_0166494_180_599 139
515 3300046516 Ga0495628_0848646 Ga0495628_0848646_202_621 139
516 3300046517 Ga0495630_0293699 Ga0495630_0293699_708_1127 139
517 3300046517 Ga0495630_0449651 Ga0495630_0449651_449_868 139
518 3300046526 Ga0495666_0450432 Ga0495666_0450432_103_522 139
519 3300046529 Ga0495652_0132881 Ga0495652_0132881_403_822 139
520 3300046529 Ga0495652_0149726 Ga0495652_0149726_1017_1436 139
521 3300046533 Ga0495640_0285760 Ga0495640_0285760_336_755 139
522 3300046535 Ga0495586_0799963 Ga0495586_0799963_107_526 139
523 3300046536 Ga0495587_0067299 Ga0495587_0067299_446_865 139
524 3300046543 Ga0495645_0314674 Ga0495645_0314674_40_459 139
525 3300046559 Ga0495667_0215407 Ga0495667_0215407_15_434 139
526 3300046642 Ga0495634_0008725 Ga0495634_0008725_881_1300 139
527 3300046642 Ga0495634_0094397 Ga0495634_0094397_253_672 139
528 3300046642 Ga0495634_0837337 Ga0495634_0837337_35_454 139
529 3300046663 Ga0495635_0799286 Ga0495635_0799286_49_468 139
530 3300046678 Ga0495599_0289130 Ga0495599_0289130_433_852 139
531 3300046680 Ga0495646_0054827 Ga0495646_0054827_198_617 139
532 3300046681 Ga0495647_0427619 Ga0495647_0427619_59_478 139
533 3300046684 Ga0495669_0190931 Ga0495669_0190931_250_669 139
534 3300046689 Ga0495613_0094429 Ga0495613_0094429_64_483 139
535 3300046690 Ga0495624_0622761 Ga0495624_0622761_87_506 139
536 3300047315 Ga0495581_0325631 Ga0495581_0325631_270_689 139
537 3300047317 Ga0495604_0369233 Ga0495604_0369233_10_429 139
538 3300047319 Ga0495674_0082451 Ga0495674_0082451_589_1008 139
539 3300047321 Ga0495676_0425230 Ga0495676_0425230_31_450 139
540 3300047444 Ga0495675_0366542 Ga0495675_0366542_269_688 139
541 3300047471 Ga0495684_0011845 Ga0495684_0011845_6106_6525 139
542 3300048091 Ga0495626_0343195 Ga0495626_0343195_45_464 139
543 3300048903 Ga0496100_0022890 Ga0496100_0022890_814_1233 139
544 3300048903 Ga0496100_0070022 Ga0496100_0070022_221_664 139
545 3300048903 Ga0496100_0540150 Ga0496100_0540150_361_780 139
546 3300048904 Ga0496101_0049432 Ga0496101_0049432_806_1249 139
547 3300048904 Ga0496101_0092567 Ga0496101_0092567_269_688 139
548 3300048904 Ga0496101_0116016 Ga0496101_0116016_447_866 139
549 3300048905 Ga0496102_0057758 Ga0496102_0057758_1946_2365 139
550 3300048905 Ga0496102_0087107 Ga0496102_0087107_1079_1498 139
551 3300048905 Ga0496102_0233602 Ga0496102_0233602_511_930 139
552 3300048906 Ga0496103_0096373 Ga0496103_0096373_1008_1427 139
553 3300048906 Ga0496103_0361681 Ga0496103_0361681_251_670 139
554 3300048907 Ga0496104_0075583 Ga0496104_0075583_447_866 139
555 3300048907 Ga0496104_0234752 Ga0496104_0234752_459_878 139
556 3300048907 Ga0496104_0248553 Ga0496104_0248553_159_578 139
557 3300048907 Ga0496104_0781579 Ga0496104_0781579_304_741 139
558 3300048907 Ga0496104_1058154 Ga0496104_1058154_161_580 139
559 3300048908 Ga0496105_0190840 Ga0496105_0190840_957_1376 139
560 3300048908 Ga0496105_0225263 Ga0496105_0225263_887_1306 139
561 3300048909 Ga0496106_0023752 Ga0496106_0023752_3286_3705 139
562 3300048909 Ga0496106_0267467 Ga0496106_0267467_589_1008 139
563 3300048909 Ga0496106_0859351 Ga0496106_0859351_203_622 139
564 3300048910 Ga0496107_0058247 Ga0496107_0058247_205_624 139
565 3300048911 Ga0496108_0072226 Ga0496108_0072226_885_1322 139
566 3300048911 Ga0496108_0094907 Ga0496108_0094907_1901_2320 139
567 3300048911 Ga0496108_0146407 Ga0496108_0146407_963_1406 139
568 3300048911 Ga0496108_0822476 Ga0496108_0822476_35_454 139
569 3300048912 Ga0496109_0025522 Ga0496109_0025522_4331_4750 139
570 3300048912 Ga0496109_0360706 Ga0496109_0360706_361_780 139
571 3300048912 Ga0496109_0976852 Ga0496109_0976852_143_580 139
572 3300048913 Ga0496110_0010931 Ga0496110_0010931_1569_1988 139
573 3300048913 Ga0496110_0785402 Ga0496110_0785402_282_701 139
574 3300048913 Ga0496110_1097942 Ga0496110_1097942_155_574 139
575 3300048914 Ga0496111_0074781 Ga0496111_0074781_1657_2076 139
576 3300048914 Ga0496111_0178737 Ga0496111_0178737_265_684 139
577 3300048915 Ga0496112_0025752 Ga0496112_0025752_2471_2890 139
578 3300048915 Ga0496112_0209813 Ga0496112_0209813_52_471 139
579 3300048915 Ga0496112_0317332 Ga0496112_0317332_157_576 139
580 3300048915 Ga0496112_0384537 Ga0496112_0384537_400_819 139
581 3300048915 Ga0496112_0533042 Ga0496112_0533042_135_554 139
582 3300048916 Ga0496113_0359759 Ga0496113_0359759_24_443 139
583 3300048916 Ga0496113_0382520 Ga0496113_0382520_300_719 139
584 3300048916 Ga0496113_0472160 Ga0496113_0472160_485_904 139
585 3300048917 Ga0496114_0029846 Ga0496114_0029846_3973_4392 139
586 3300048917 Ga0496114_0045336 Ga0496114_0045336_955_1374 139
587 3300048918 Ga0496115_0005912 Ga0496115_0005912_7377_7796 139
588 3300048918 Ga0496115_0023024 Ga0496115_0023024_2358_2777 139
589 3300048918 Ga0496115_0231002 Ga0496115_0231002_537_956 139
590 3300048918 Ga0496115_0361137 Ga0496115_0361137_513_932 139
591 3300048918 Ga0496115_0526085 Ga0496115_0526085_482_901 139
592 3300049583 Ga0501067_0255745 Ga0501067_0255745_89_508 139
593 3300049744 Ga0501083_0013400 Ga0501083_0013400_1674_2093 139
594 3300050507 nmdc:mga05p37_224020_c1 nmdc:mga05p37_224020_c1_117_536 139
595 3300050507 nmdc:mga05p37_454619_c1 nmdc:mga05p37_454619_c1_523_966 139
596 3300050507 nmdc:mga05p37_53994_c1 nmdc:mga05p37_53994_c1_2895_3314 139
597 3300050512 nmdc:mga0n895_190623_c1 nmdc:mga0n895_190623_c1_1563_1982 139
598 3300050512 nmdc:mga0n895_768737_c1 nmdc:mga0n895_768737_c1_494_913 139
599 3300050513 nmdc:mga0rr50_1411580_c1 nmdc:mga0rr50_1411580_c1_96_515 139
600 3300050515 nmdc:mga0a205_622459_c1 nmdc:mga0a205_622459_c1_30_449 139
601 3300050515 nmdc:mga0a205_634115_c1 nmdc:mga0a205_634115_c1_192_611 139
602 3300053085 Ga0495619_0496329 Ga0495619_0496329_288_707 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

50

167

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.9504 5 139
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9496 6 137
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9458 2 139
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.937 6 137
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9362 1 139
ID Description Score Start End Superfamily
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.944 3 139 2.60.120.460
2cu5A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9363 5 137 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9314 2 139 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9253 2 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9251 1 138 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A2V6A5S9-F1-model_v4 YjbQ family protein 0.9789 1 139
AF-A0A838MZW0-F1-model_v4 YjbQ family protein 0.978 1 139
AF-V5SFJ0-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9757 3 139
AF-H1G2P0-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9752 1 139
AF-A0A2V5S9A0-F1-model_v4 YjbQ family protein 0.9751 1 139

Feature Viewer

pLDDT pTM Quality
93.34 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map