F468155
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 602 | 259 | 602 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10037973|Ga0081455_100379733 |
| Length | 170 |
| Sequence | MPGLKGRRYPNDRQPVAGCFALTVTLNNLPEMRIDHDQLEVRSHDKGLYEITDQIDSKIDKCGIKNGTVTIFVQHTSCSIVIMENADPTARRDLEEFFERLVPEDADYFTHDTEGSDDMPSHIRMVLTRTSETIPIVDGKMQLGTWQGIFLFEHRRAPHRRKVVLTMIGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 114 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 196 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 197 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 198 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 202 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 203 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 204 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.47 |
| Rhizosphere | 91.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10217976 | 3300001989 | Unclassified | 559 |
| 2 | JGI24737J22298_10045963 | 3300001990 | Bacteria | 1333 |
| 3 | JGI24743J22301_10009340 | 3300001991 | Bacteria | 1736 |
| 4 | JGI24035J26624_1000390 | 3300002126 | Bacteria | 4128 |
| 5 | JGI25405J52794_10000078 | 3300003911 | Bacteria | 10653 |
| 6 | JGI25405J52794_10003345 | 3300003911 | Bacteria | 2807 |
| 7 | Ga0065703_1000584 | 3300005272 | Bacteria | 2832 |
| 8 | Ga0065714_10201160 | 3300005288 | Bacteria | 895 |
| 9 | Ga0065704_10027417 | 3300005289 | Bacteria | 995 |
| 10 | Ga0065704_10193752 | 3300005289 | Bacteria | 1168 |
| 11 | Ga0065704_10415633 | 3300005289 | Bacteria | 706 |
| 12 | Ga0065704_10695390 | 3300005289 | Unclassified | 563 |
| 13 | Ga0065712_10006984 | 3300005290 | Unclassified | 3064 |
| 14 | Ga0065712_10011917 | 3300005290 | Bacteria | 2009 |
| 15 | Ga0065712_10129135 | 3300005290 | Bacteria | 1559 |
| 16 | Ga0065715_10012321 | 3300005293 | Unclassified | 2416 |
| 17 | Ga0065715_10098646 | 3300005293 | Bacteria | 3514 |
| 18 | Ga0065715_10230264 | 3300005293 | Bacteria | 1236 |
| 19 | Ga0065715_10348063 | 3300005293 | Unclassified | 942 |
| 20 | Ga0065715_11062046 | 3300005293 | Bacteria | 529 |
| 21 | Ga0065707_10124882 | 3300005295 | Unclassified | 2023 |
| 22 | Ga0065707_10207853 | 3300005295 | Bacteria | 1279 |
| 23 | Ga0065707_10218351 | 3300005295 | Bacteria | 1214 |
| 24 | Ga0065707_10241319 | 3300005295 | Unclassified | 1155 |
| 25 | Ga0070658_10257816 | 3300005327 | Bacteria | 1480 |
| 26 | Ga0070658_11050207 | 3300005327 | Unclassified | 709 |
| 27 | Ga0070676_10069309 | 3300005328 | Unclassified | 2113 |
| 28 | Ga0070683_100011212 | 3300005329 | Bacteria | 7735 |
| 29 | Ga0070683_100048602 | 3300005329 | Bacteria | 3922 |
| 30 | Ga0070690_100345759 | 3300005330 | Unclassified | 1078 |
| 31 | Ga0070690_100358217 | 3300005330 | Bacteria | 1061 |
| 32 | Ga0070670_100665295 | 3300005331 | Bacteria | 935 |
| 33 | Ga0070677_10114873 | 3300005333 | Unclassified | 1207 |
| 34 | Ga0068869_100196897 | 3300005334 | Unclassified | 1587 |
| 35 | Ga0070666_10253695 | 3300005335 | Bacteria | 1246 |
| 36 | Ga0070666_10316064 | 3300005335 | Bacteria | 1113 |
| 37 | Ga0070666_10628452 | 3300005335 | Bacteria | 785 |
| 38 | Ga0070666_11214180 | 3300005335 | Unclassified | 562 |
| 39 | Ga0070680_100775128 | 3300005336 | Bacteria | 826 |
| 40 | Ga0070682_100303231 | 3300005337 | Bacteria | 1173 |
| 41 | Ga0068868_100031039 | 3300005338 | Bacteria | 4101 |
| 42 | Ga0070660_100006893 | 3300005339 | Bacteria | 7882 |
| 43 | Ga0070660_100659016 | 3300005339 | Bacteria | 877 |
| 44 | Ga0070660_101472055 | 3300005339 | Unclassified | 579 |
| 45 | Ga0070689_100006670 | 3300005340 | Bacteria | 8021 |
| 46 | Ga0070689_100007427 | 3300005340 | Bacteria | 7661 |
| 47 | Ga0070689_100118689 | 3300005340 | Bacteria | 2111 |
| 48 | Ga0070661_100260373 | 3300005344 | Bacteria | 1341 |
| 49 | Ga0070668_100137888 | 3300005347 | Bacteria | 1964 |
| 50 | Ga0070668_100279196 | 3300005347 | Bacteria | 1394 |
| 51 | Ga0070668_101541352 | 3300005347 | Unclassified | 608 |
| 52 | Ga0070669_100288601 | 3300005353 | Bacteria | 1316 |
| 53 | Ga0070675_100017435 | 3300005354 | Bacteria | 5705 |
| 54 | Ga0070675_100033004 | 3300005354 | Bacteria | 4193 |
| 55 | Ga0070675_100335377 | 3300005354 | Bacteria | 1338 |
| 56 | Ga0070675_100554437 | 3300005354 | Bacteria | 1040 |
| 57 | Ga0070675_100573763 | 3300005354 | Unclassified | 1022 |
| 58 | Ga0070671_100031990 | 3300005355 | Bacteria | 4349 |
| 59 | Ga0070671_100166078 | 3300005355 | Unclassified | 1866 |
| 60 | Ga0070671_100664604 | 3300005355 | Bacteria | 903 |
| 61 | Ga0070674_100115748 | 3300005356 | Bacteria | 1977 |
| 62 | Ga0070674_100578873 | 3300005356 | Bacteria | 946 |
| 63 | Ga0070674_100931545 | 3300005356 | Unclassified | 758 |
| 64 | Ga0070673_100001802 | 3300005364 | Bacteria | 12775 |
| 65 | Ga0070673_100054279 | 3300005364 | Unclassified | 3151 |
| 66 | Ga0070673_101185096 | 3300005364 | Unclassified | 715 |
| 67 | Ga0070673_101999310 | 3300005364 | Unclassified | 550 |
| 68 | Ga0070688_100003545 | 3300005365 | Bacteria | 8042 |
| 69 | Ga0070688_100003930 | 3300005365 | Bacteria | 7707 |
| 70 | Ga0070688_100004655 | 3300005365 | Bacteria | 7161 |
| 71 | Ga0070659_100003503 | 3300005366 | Bacteria | 11177 |
| 72 | Ga0070659_100435065 | 3300005366 | Bacteria | 1111 |
| 73 | Ga0070659_100634601 | 3300005366 | Unclassified | 920 |
| 74 | Ga0070667_100216264 | 3300005367 | Unclassified | 1704 |
| 75 | Ga0070667_100593901 | 3300005367 | Bacteria | 1020 |
| 76 | Ga0070667_101045527 | 3300005367 | Unclassified | 762 |
| 77 | Ga0070709_10015230 | 3300005434 | Bacteria | 4369 |
| 78 | Ga0070709_10100881 | 3300005434 | Bacteria | 1923 |
| 79 | Ga0070709_10576627 | 3300005434 | Bacteria | 864 |
| 80 | Ga0070709_11438518 | 3300005434 | Unclassified | 559 |
| 81 | Ga0070714_100013099 | 3300005435 | Bacteria | 6638 |
| 82 | Ga0070714_100232632 | 3300005435 | Unclassified | 1698 |
| 83 | Ga0070714_100608650 | 3300005435 | Bacteria | 1049 |
| 84 | Ga0070713_100067914 | 3300005436 | Bacteria | 3003 |
| 85 | Ga0070713_100154241 | 3300005436 | Bacteria | 2046 |
| 86 | Ga0070713_100217462 | 3300005436 | Unclassified | 1732 |
| 87 | Ga0070713_100267300 | 3300005436 | Bacteria | 1565 |
| 88 | Ga0070713_100307942 | 3300005436 | Bacteria | 1460 |
| 89 | Ga0070713_101438150 | 3300005436 | Unclassified | 669 |
| 90 | Ga0070713_102383714 | 3300005436 | Unclassified | 512 |
| 91 | Ga0070710_10038388 | 3300005437 | Bacteria | 2630 |
| 92 | Ga0070710_10116481 | 3300005437 | Unclassified | 1611 |
| 93 | Ga0070710_10156673 | 3300005437 | Bacteria | 1409 |
| 94 | Ga0070710_10306038 | 3300005437 | Bacteria | 1039 |
| 95 | Ga0070710_10573810 | 3300005437 | Bacteria | 782 |
| 96 | Ga0070710_10738438 | 3300005437 | Bacteria | 698 |
| 97 | Ga0070701_10171066 | 3300005438 | Unclassified | 1265 |
| 98 | Ga0070701_10215165 | 3300005438 | Bacteria | 1143 |
| 99 | Ga0070711_100006507 | 3300005439 | Bacteria | 7045 |
| 100 | Ga0070711_100053814 | 3300005439 | Bacteria | 2775 |
| 101 | Ga0070711_100102505 | 3300005439 | Bacteria | 2084 |
| 102 | Ga0070705_100083056 | 3300005440 | Unclassified | 1973 |
| 103 | Ga0070705_100126554 | 3300005440 | Bacteria | 1659 |
| 104 | Ga0070705_100419228 | 3300005440 | Bacteria | 996 |
| 105 | Ga0070700_100010793 | 3300005441 | Bacteria | 5049 |
| 106 | Ga0070694_100134473 | 3300005444 | Bacteria | 1790 |
| 107 | Ga0070708_100035044 | 3300005445 | Bacteria | 4370 |
| 108 | Ga0070708_100155206 | 3300005445 | Bacteria | 2131 |
| 109 | Ga0070708_100831488 | 3300005445 | Unclassified | 868 |
| 110 | Ga0070708_101184239 | 3300005445 | Bacteria | 715 |
| 111 | Ga0070708_101314879 | 3300005445 | Bacteria | 675 |
| 112 | Ga0070708_102219667 | 3300005445 | Bacteria | 507 |
| 113 | Ga0070663_101137110 | 3300005455 | Bacteria | 684 |
| 114 | Ga0070678_100045438 | 3300005456 | Bacteria | 3143 |
| 115 | Ga0070678_100061744 | 3300005456 | Unclassified | 2763 |
| 116 | Ga0070678_100145796 | 3300005456 | Unclassified | 1900 |
| 117 | Ga0070662_100019102 | 3300005457 | Bacteria | 4648 |
| 118 | Ga0070662_100027468 | 3300005457 | Unclassified | 3950 |
| 119 | Ga0070662_100121461 | 3300005457 | Bacteria | 2003 |
| 120 | Ga0070662_100358049 | 3300005457 | Bacteria | 1197 |
| 121 | Ga0070681_10042347 | 3300005458 | Bacteria | 4563 |
| 122 | Ga0070685_10014746 | 3300005466 | Unclassified | 4144 |
| 123 | Ga0070685_10061011 | 3300005466 | Unclassified | 2207 |
| 124 | Ga0070706_100000218 | 3300005467 | Bacteria | 70622 |
| 125 | Ga0070706_100062966 | 3300005467 | Bacteria | 3427 |
| 126 | Ga0070706_100080916 | 3300005467 | Unclassified | 3008 |
| 127 | Ga0070706_100089406 | 3300005467 | Bacteria | 2855 |
| 128 | Ga0070706_100236259 | 3300005467 | Unclassified | 1706 |
| 129 | Ga0070706_100250725 | 3300005467 | Bacteria | 1653 |
| 130 | Ga0070706_101091328 | 3300005467 | Unclassified | 735 |
| 131 | Ga0070706_101136366 | 3300005467 | Unclassified | 719 |
| 132 | Ga0070706_101389517 | 3300005467 | Bacteria | 643 |
| 133 | Ga0070707_100076452 | 3300005468 | Unclassified | 3230 |
| 134 | Ga0070707_100094690 | 3300005468 | Bacteria | 2891 |
| 135 | Ga0070707_100280362 | 3300005468 | Unclassified | 1620 |
| 136 | Ga0070707_100312212 | 3300005468 | Bacteria | 1528 |
| 137 | Ga0070707_100421366 | 3300005468 | Bacteria | 1295 |
| 138 | Ga0070707_100502946 | 3300005468 | Bacteria | 1174 |
| 139 | Ga0070698_100009964 | 3300005471 | Bacteria | 10161 |
| 140 | Ga0070698_100022507 | 3300005471 | Bacteria | 6593 |
| 141 | Ga0070698_100155739 | 3300005471 | Bacteria | 2230 |
| 142 | Ga0070698_100346898 | 3300005471 | Unclassified | 1416 |
| 143 | Ga0070698_100614185 | 3300005471 | Unclassified | 1028 |
| 144 | Ga0070698_101416280 | 3300005471 | Bacteria | 646 |
| 145 | Ga0070699_100120714 | 3300005518 | Bacteria | 2304 |
| 146 | Ga0070699_100902004 | 3300005518 | Bacteria | 810 |
| 147 | Ga0070699_101439049 | 3300005518 | Unclassified | 632 |
| 148 | Ga0070699_101653547 | 3300005518 | Bacteria | 586 |
| 149 | Ga0070679_100608386 | 3300005530 | Unclassified | 1036 |
| 150 | Ga0070684_100001520 | 3300005535 | Bacteria | 16769 |
| 151 | Ga0070684_100689435 | 3300005535 | Bacteria | 952 |
| 152 | Ga0070684_101307466 | 3300005535 | Bacteria | 682 |
| 153 | Ga0070697_100016187 | 3300005536 | Bacteria | 5864 |
| 154 | Ga0070697_100032855 | 3300005536 | Unclassified | 4178 |
| 155 | Ga0070697_100033606 | 3300005536 | Bacteria | 4131 |
| 156 | Ga0070697_100126103 | 3300005536 | Bacteria | 2144 |
| 157 | Ga0070697_100211260 | 3300005536 | Bacteria | 1652 |
| 158 | Ga0070697_100351694 | 3300005536 | Bacteria | 1273 |
| 159 | Ga0070697_101064601 | 3300005536 | Bacteria | 719 |
| 160 | Ga0070697_101147534 | 3300005536 | Unclassified | 692 |
| 161 | Ga0070697_101204533 | 3300005536 | Unclassified | 675 |
| 162 | Ga0070672_100072922 | 3300005543 | Bacteria | 2735 |
| 163 | Ga0070672_100215775 | 3300005543 | Unclassified | 1608 |
| 164 | Ga0070672_100224980 | 3300005543 | Unclassified | 1574 |
| 165 | Ga0070672_101548772 | 3300005543 | Unclassified | 594 |
| 166 | Ga0070686_100391283 | 3300005544 | Bacteria | 1055 |
| 167 | Ga0070695_100192050 | 3300005545 | Bacteria | 1454 |
| 168 | Ga0070696_100526134 | 3300005546 | Bacteria | 944 |
| 169 | Ga0070665_100027567 | 3300005548 | Bacteria | 5721 |
| 170 | Ga0070665_100113471 | 3300005548 | Unclassified | 2713 |
| 171 | Ga0070665_101468524 | 3300005548 | Unclassified | 690 |
| 172 | Ga0070704_100002967 | 3300005549 | Bacteria | 9643 |
| 173 | Ga0070704_100764964 | 3300005549 | Bacteria | 861 |
| 174 | Ga0070664_101648659 | 3300005564 | Unclassified | 608 |
| 175 | Ga0068857_100389551 | 3300005577 | Unclassified | 1295 |
| 176 | Ga0068854_100105524 | 3300005578 | Bacteria | 2118 |
| 177 | Ga0068856_100160431 | 3300005614 | Unclassified | 2259 |
| 178 | Ga0068856_100161267 | 3300005614 | Bacteria | 2253 |
| 179 | Ga0070702_100027995 | 3300005615 | Unclassified | 3049 |
| 180 | Ga0070702_100105769 | 3300005615 | Unclassified | 1735 |
| 181 | Ga0070702_101742048 | 3300005615 | Bacteria | 519 |
| 182 | Ga0068864_100040823 | 3300005618 | Unclassified | 3968 |
| 183 | Ga0068866_10608494 | 3300005718 | Bacteria | 739 |
| 184 | Ga0068861_102105159 | 3300005719 | Unclassified | 564 |
| 185 | Ga0068851_10451034 | 3300005834 | Unclassified | 764 |
| 186 | Ga0068863_100002599 | 3300005841 | Bacteria | 17914 |
| 187 | Ga0068863_100077542 | 3300005841 | Bacteria | 3145 |
| 188 | Ga0068863_100120955 | 3300005841 | Bacteria | 2496 |
| 189 | Ga0068863_100152982 | 3300005841 | Unclassified | 2208 |
| 190 | Ga0068863_101503374 | 3300005841 | Unclassified | 682 |
| 191 | Ga0068858_100001603 | 3300005842 | Bacteria | 23098 |
| 192 | Ga0068858_100131016 | 3300005842 | Unclassified | 2351 |
| 193 | Ga0068860_100007710 | 3300005843 | Bacteria | 10765 |
| 194 | Ga0068860_101661350 | 3300005843 | Unclassified | 661 |
| 195 | Ga0081455_10002976 | 3300005937 | Bacteria | 19806 |
| 196 | Ga0081455_10003354 | 3300005937 | Bacteria | 18464 |
| 197 | Ga0081455_10032679 | 3300005937 | Bacteria | 4687 |
| 198 | Ga0081455_10037973 | 3300005937 | Bacteria | 4268 |
| 199 | Ga0081455_10099004 | 3300005937 | Bacteria | 2346 |
| 200 | Ga0081455_10124982 | 3300005937 | Bacteria | 2020 |
| 201 | Ga0081540_1000057 | 3300005983 | Bacteria | 121566 |
| 202 | Ga0081540_1037749 | 3300005983 | Bacteria | 2555 |
| 203 | Ga0081540_1048239 | 3300005983 | Bacteria | 2134 |
| 204 | Ga0081540_1088727 | 3300005983 | Unclassified | 1366 |
| 205 | Ga0081539_10146363 | 3300005985 | Bacteria | 1142 |
| 206 | Ga0070717_10010249 | 3300006028 | Bacteria | 7062 |
| 207 | Ga0070717_10016767 | 3300006028 | Bacteria | 5686 |
| 208 | Ga0070717_10017293 | 3300006028 | Bacteria | 5609 |
| 209 | Ga0070717_10040998 | 3300006028 | Unclassified | 3774 |
| 210 | Ga0070717_10055249 | 3300006028 | Unclassified | 3275 |
| 211 | Ga0070717_10079972 | 3300006028 | Unclassified | 2742 |
| 212 | Ga0070717_10113763 | 3300006028 | Bacteria | 2311 |
| 213 | Ga0070717_10155883 | 3300006028 | Bacteria | 1978 |
| 214 | Ga0070717_10284337 | 3300006028 | Bacteria | 1468 |
| 215 | Ga0070717_10399783 | 3300006028 | Bacteria | 1234 |
| 216 | Ga0070717_11866190 | 3300006028 | Unclassified | 543 |
| 217 | Ga0070715_10196214 | 3300006163 | Bacteria | 1022 |
| 218 | Ga0070715_10239635 | 3300006163 | Bacteria | 942 |
| 219 | Ga0070716_100088639 | 3300006173 | Unclassified | 1867 |
| 220 | Ga0070716_100209891 | 3300006173 | Bacteria | 1300 |
| 221 | Ga0070712_100111528 | 3300006175 | Unclassified | 2042 |
| 222 | Ga0070712_100115328 | 3300006175 | Bacteria | 2013 |
| 223 | Ga0070712_100323916 | 3300006175 | Bacteria | 1254 |
| 224 | Ga0070712_100700193 | 3300006175 | Bacteria | 864 |
| 225 | Ga0070712_101016379 | 3300006175 | Archaea | 718 |
| 226 | Ga0070712_101033260 | 3300006175 | Unclassified | 712 |
| 227 | Ga0070712_101531319 | 3300006175 | Bacteria | 583 |
| 228 | Ga0068871_100047366 | 3300006358 | Unclassified | 3467 |
| 229 | Ga0068871_100061617 | 3300006358 | Bacteria | 3064 |
| 230 | Ga0068871_102281082 | 3300006358 | Unclassified | 516 |
| 231 | Ga0075428_100207637 | 3300006844 | Bacteria | 2117 |
| 232 | Ga0075428_100854350 | 3300006844 | Unclassified | 966 |
| 233 | Ga0075428_101581021 | 3300006844 | Bacteria | 686 |
| 234 | Ga0075433_10499338 | 3300006852 | Bacteria | 1071 |
| 235 | Ga0075433_10573608 | 3300006852 | Bacteria | 991 |
| 236 | Ga0075434_100302930 | 3300006871 | Bacteria | 1619 |
| 237 | Ga0075434_101240908 | 3300006871 | Bacteria | 757 |
| 238 | Ga0068865_100349604 | 3300006881 | Unclassified | 1197 |
| 239 | Ga0068865_100359298 | 3300006881 | Bacteria | 1182 |
| 240 | Ga0068865_100532734 | 3300006881 | Bacteria | 984 |
| 241 | Ga0099795_10076169 | 3300007788 | Bacteria | 1275 |
| 242 | Ga0105240_10243861 | 3300009093 | Bacteria | 2082 |
| 243 | Ga0111539_12177938 | 3300009094 | Bacteria | 643 |
| 244 | Ga0105245_10211742 | 3300009098 | Bacteria | 1866 |
| 245 | Ga0105245_12488820 | 3300009098 | Bacteria | 571 |
| 246 | Ga0114129_10059979 | 3300009147 | Bacteria | 5319 |
| 247 | Ga0114129_10243449 | 3300009147 | Bacteria | 2417 |
| 248 | Ga0105243_10154299 | 3300009148 | Bacteria | 1973 |
| 249 | Ga0105241_10207277 | 3300009174 | Bacteria | 1641 |
| 250 | Ga0105242_10123314 | 3300009176 | Unclassified | 2227 |
| 251 | Ga0105242_10255326 | 3300009176 | Unclassified | 1581 |
| 252 | Ga0105242_10494741 | 3300009176 | Bacteria | 1162 |
| 253 | Ga0105242_10571873 | 3300009176 | Unclassified | 1087 |
| 254 | Ga0105248_10233792 | 3300009177 | Unclassified | 2069 |
| 255 | Ga0105248_10268929 | 3300009177 | Bacteria | 1919 |
| 256 | Ga0105249_10001815 | 3300009553 | Bacteria | 18572 |
| 257 | Ga0105239_10046832 | 3300010375 | Unclassified | 4738 |
| 258 | Ga0105239_10165378 | 3300010375 | Bacteria | 2474 |
| 259 | Ga0105239_10804410 | 3300010375 | Bacteria | 1077 |
| 260 | Ga0105246_10034729 | 3300011119 | Bacteria | 3363 |
| 261 | Ga0105246_10377561 | 3300011119 | Unclassified | 1170 |
| 262 | Ga0157371_10193774 | 3300013102 | Bacteria | 1456 |
| 263 | Ga0157371_10609010 | 3300013102 | Unclassified | 813 |
| 264 | Ga0157369_10021927 | 3300013105 | Bacteria | 7140 |
| 265 | Ga0157369_11374019 | 3300013105 | Bacteria | 719 |
| 266 | Ga0157369_11630865 | 3300013105 | Unclassified | 656 |
| 267 | Ga0157374_10010136 | 3300013296 | Bacteria | 8095 |
| 268 | Ga0157374_10027052 | 3300013296 | Bacteria | 5168 |
| 269 | Ga0157374_10088988 | 3300013296 | Bacteria | 2941 |
| 270 | Ga0157374_10110278 | 3300013296 | Bacteria | 2646 |
| 271 | Ga0157374_10116211 | 3300013296 | Bacteria | 2577 |
| 272 | Ga0157374_10179016 | 3300013296 | Bacteria | 2070 |
| 273 | Ga0157374_10352127 | 3300013296 | Bacteria | 1463 |
| 274 | Ga0157374_10630420 | 3300013296 | Unclassified | 1083 |
| 275 | Ga0157374_11397965 | 3300013296 | Bacteria | 723 |
| 276 | Ga0157374_12174145 | 3300013296 | Unclassified | 582 |
| 277 | Ga0157378_10016630 | 3300013297 | Bacteria | 6444 |
| 278 | Ga0157378_10027882 | 3300013297 | Bacteria | 4980 |
| 279 | Ga0157378_10109265 | 3300013297 | Unclassified | 2533 |
| 280 | Ga0157378_10186618 | 3300013297 | Unclassified | 1953 |
| 281 | Ga0157378_10865934 | 3300013297 | Bacteria | 933 |
| 282 | Ga0157378_11309739 | 3300013297 | Unclassified | 766 |
| 283 | Ga0163162_10184484 | 3300013306 | Unclassified | 2213 |
| 284 | Ga0163162_10291448 | 3300013306 | Bacteria | 1764 |
| 285 | Ga0163162_10392324 | 3300013306 | Bacteria | 1521 |
| 286 | Ga0163162_10531563 | 3300013306 | Unclassified | 1305 |
| 287 | Ga0157372_10196037 | 3300013307 | Bacteria | 2339 |
| 288 | Ga0157372_10951082 | 3300013307 | Unclassified | 996 |
| 289 | Ga0157372_11018018 | 3300013307 | Bacteria | 959 |
| 290 | Ga0157375_10014829 | 3300013308 | Bacteria | 6964 |
| 291 | Ga0157375_10017679 | 3300013308 | Bacteria | 6443 |
| 292 | Ga0157375_10126092 | 3300013308 | Bacteria | 2675 |
| 293 | Ga0157375_10816712 | 3300013308 | Bacteria | 1080 |
| 294 | Ga0157375_10822834 | 3300013308 | Bacteria | 1076 |
| 295 | Ga0157375_11070303 | 3300013308 | Bacteria | 943 |
| 296 | Ga0157375_13030756 | 3300013308 | Bacteria | 561 |
| 297 | Ga0163163_10156937 | 3300014325 | Bacteria | 2320 |
| 298 | Ga0163163_10250094 | 3300014325 | Bacteria | 1823 |
| 299 | Ga0163163_10309103 | 3300014325 | Unclassified | 1633 |
| 300 | Ga0163163_10395880 | 3300014325 | Bacteria | 1439 |
| 301 | Ga0163163_10561221 | 3300014325 | Bacteria | 1204 |
| 302 | Ga0163163_11673391 | 3300014325 | Unclassified | 697 |
| 303 | Ga0157377_10497588 | 3300014745 | Unclassified | 851 |
| 304 | Ga0157377_11404275 | 3300014745 | Unclassified | 551 |
| 305 | Ga0157379_10008472 | 3300014968 | Bacteria | 8945 |
| 306 | Ga0157379_11477116 | 3300014968 | Bacteria | 661 |
| 307 | Ga0157376_10002885 | 3300014969 | Bacteria | 11782 |
| 308 | Ga0157376_10167937 | 3300014969 | Unclassified | 1995 |
| 309 | Ga0157376_10236780 | 3300014969 | Bacteria | 1699 |
| 310 | Ga0157376_11218731 | 3300014969 | Unclassified | 781 |
| 311 | Ga0182006_1051817 | 3300015261 | Unclassified | 1578 |
| 312 | Ga0163161_10195099 | 3300017792 | Bacteria | 1558 |
| 313 | Ga0163161_10237874 | 3300017792 | Bacteria | 1415 |
| 314 | Ga0163161_10682739 | 3300017792 | Unclassified | 854 |
| 315 | Ga0213872_10154499 | 3300021361 | Unclassified | 1001 |
| 316 | Ga0213871_10048132 | 3300021441 | Unclassified | 1161 |
| 317 | Ga0207666_1001723 | 3300025271 | Bacteria | 2598 |
| 318 | Ga0207666_1004614 | 3300025271 | Bacteria | 1733 |
| 319 | Ga0207673_1001059 | 3300025290 | Unclassified | 2966 |
| 320 | Ga0207673_1001448 | 3300025290 | Bacteria | 2593 |
| 321 | Ga0207697_10000492 | 3300025315 | Bacteria | 22218 |
| 322 | Ga0207697_10000847 | 3300025315 | Bacteria | 17271 |
| 323 | Ga0207697_10000853 | 3300025315 | Bacteria | 17252 |
| 324 | Ga0207697_10007619 | 3300025315 | Bacteria | 4808 |
| 325 | Ga0207697_10091530 | 3300025315 | Bacteria | 1289 |
| 326 | Ga0207697_10185478 | 3300025315 | Bacteria | 913 |
| 327 | Ga0207697_10260879 | 3300025315 | Bacteria | 767 |
| 328 | Ga0207697_10331517 | 3300025315 | Unclassified | 676 |
| 329 | Ga0207682_10141595 | 3300025893 | Bacteria | 1079 |
| 330 | Ga0207692_10026824 | 3300025898 | Bacteria | 2706 |
| 331 | Ga0207692_10363893 | 3300025898 | Unclassified | 894 |
| 332 | Ga0207642_10279556 | 3300025899 | Bacteria | 960 |
| 333 | Ga0207710_10183665 | 3300025900 | Bacteria | 1027 |
| 334 | Ga0207688_10152626 | 3300025901 | Bacteria | 1365 |
| 335 | Ga0207680_10075153 | 3300025903 | Bacteria | 2107 |
| 336 | Ga0207680_10206446 | 3300025903 | Unclassified | 1341 |
| 337 | Ga0207647_10008787 | 3300025904 | Bacteria | 7211 |
| 338 | Ga0207647_10738956 | 3300025904 | Bacteria | 534 |
| 339 | Ga0207685_10048213 | 3300025905 | Bacteria | 1631 |
| 340 | Ga0207685_10266690 | 3300025905 | Bacteria | 835 |
| 341 | Ga0207699_10171405 | 3300025906 | Bacteria | 1452 |
| 342 | Ga0207699_10729406 | 3300025906 | Unclassified | 726 |
| 343 | Ga0207645_10003903 | 3300025907 | Bacteria | 11144 |
| 344 | Ga0207705_10441700 | 3300025909 | Bacteria | 1008 |
| 345 | Ga0207684_10000292 | 3300025910 | Bacteria | 71954 |
| 346 | Ga0207684_10015288 | 3300025910 | Bacteria | 6611 |
| 347 | Ga0207684_10026449 | 3300025910 | Bacteria | 4946 |
| 348 | Ga0207684_10033758 | 3300025910 | Bacteria | 4351 |
| 349 | Ga0207684_10113658 | 3300025910 | Unclassified | 2318 |
| 350 | Ga0207684_10164260 | 3300025910 | Bacteria | 1913 |
| 351 | Ga0207684_10275718 | 3300025910 | Bacteria | 1451 |
| 352 | Ga0207684_10296810 | 3300025910 | Bacteria | 1393 |
| 353 | Ga0207684_10545153 | 3300025910 | Unclassified | 992 |
| 354 | Ga0207684_11338567 | 3300025910 | Unclassified | 588 |
| 355 | Ga0207695_10191894 | 3300025913 | Bacteria | 1960 |
| 356 | Ga0207693_10015725 | 3300025915 | Bacteria | 6063 |
| 357 | Ga0207693_10125512 | 3300025915 | Bacteria | 2017 |
| 358 | Ga0207693_10415061 | 3300025915 | Unclassified | 1052 |
| 359 | Ga0207693_10440011 | 3300025915 | Unclassified | 1019 |
| 360 | Ga0207693_10490407 | 3300025915 | Bacteria | 959 |
| 361 | Ga0207693_10617610 | 3300025915 | Bacteria | 843 |
| 362 | Ga0207663_10095084 | 3300025916 | Unclassified | 1987 |
| 363 | Ga0207660_10173499 | 3300025917 | Bacteria | 1670 |
| 364 | Ga0207657_10014378 | 3300025919 | Bacteria | 7727 |
| 365 | Ga0207657_10674391 | 3300025919 | Bacteria | 804 |
| 366 | Ga0207649_10531232 | 3300025920 | Unclassified | 898 |
| 367 | Ga0207652_10835864 | 3300025921 | Bacteria | 816 |
| 368 | Ga0207646_10075894 | 3300025922 | Unclassified | 3003 |
| 369 | Ga0207646_10092278 | 3300025922 | Bacteria | 2710 |
| 370 | Ga0207646_10107483 | 3300025922 | Bacteria | 2503 |
| 371 | Ga0207646_10130029 | 3300025922 | Unclassified | 2266 |
| 372 | Ga0207646_10185223 | 3300025922 | Unclassified | 1880 |
| 373 | Ga0207646_10269658 | 3300025922 | Unclassified | 1538 |
| 374 | Ga0207646_10409251 | 3300025922 | Unclassified | 1225 |
| 375 | Ga0207646_11570498 | 3300025922 | Unclassified | 568 |
| 376 | Ga0207681_11123756 | 3300025923 | Bacteria | 660 |
| 377 | Ga0207650_10415822 | 3300025925 | Bacteria | 1115 |
| 378 | Ga0207659_10010798 | 3300025926 | Bacteria | 5748 |
| 379 | Ga0207659_10121952 | 3300025926 | Bacteria | 1998 |
| 380 | Ga0207659_10142419 | 3300025926 | Unclassified | 1862 |
| 381 | Ga0207659_10236279 | 3300025926 | Bacteria | 1476 |
| 382 | Ga0207687_10199172 | 3300025927 | Bacteria | 1564 |
| 383 | Ga0207700_10040747 | 3300025928 | Unclassified | 3392 |
| 384 | Ga0207700_10263213 | 3300025928 | Bacteria | 1477 |
| 385 | Ga0207664_10044558 | 3300025929 | Unclassified | 3475 |
| 386 | Ga0207664_10174683 | 3300025929 | Unclassified | 1841 |
| 387 | Ga0207664_10358163 | 3300025929 | Bacteria | 1292 |
| 388 | Ga0207664_10379862 | 3300025929 | Bacteria | 1254 |
| 389 | Ga0207664_10436817 | 3300025929 | Bacteria | 1167 |
| 390 | Ga0207644_10129660 | 3300025931 | Bacteria | 1929 |
| 391 | Ga0207644_10205371 | 3300025931 | Bacteria | 1555 |
| 392 | Ga0207644_10404467 | 3300025931 | Bacteria | 1116 |
| 393 | Ga0207690_10022558 | 3300025932 | Bacteria | 3918 |
| 394 | Ga0207690_10409252 | 3300025932 | Bacteria | 1083 |
| 395 | Ga0207706_10030800 | 3300025933 | Unclassified | 4785 |
| 396 | Ga0207706_10166312 | 3300025933 | Bacteria | 1938 |
| 397 | Ga0207706_10334710 | 3300025933 | Bacteria | 1317 |
| 398 | Ga0207686_10086831 | 3300025934 | Unclassified | 2056 |
| 399 | Ga0207686_10155250 | 3300025934 | Bacteria | 1598 |
| 400 | Ga0207709_10793729 | 3300025935 | Unclassified | 764 |
| 401 | Ga0207670_10059168 | 3300025936 | Bacteria | 2605 |
| 402 | Ga0207670_10062818 | 3300025936 | Bacteria | 2539 |
| 403 | Ga0207670_10232379 | 3300025936 | Bacteria | 1417 |
| 404 | Ga0207669_10144320 | 3300025937 | Unclassified | 1657 |
| 405 | Ga0207669_10340078 | 3300025937 | Bacteria | 1156 |
| 406 | Ga0207669_10396243 | 3300025937 | Bacteria | 1080 |
| 407 | Ga0207704_10079830 | 3300025938 | Bacteria | 2110 |
| 408 | Ga0207704_10085054 | 3300025938 | Bacteria | 2058 |
| 409 | Ga0207704_10450138 | 3300025938 | Bacteria | 1027 |
| 410 | Ga0207665_10033942 | 3300025939 | Unclassified | 3385 |
| 411 | Ga0207665_10037908 | 3300025939 | Bacteria | 3208 |
| 412 | Ga0207665_10044599 | 3300025939 | Bacteria | 2967 |
| 413 | Ga0207665_10105541 | 3300025939 | Bacteria | 1973 |
| 414 | Ga0207665_10140210 | 3300025939 | Unclassified | 1723 |
| 415 | Ga0207665_10169394 | 3300025939 | Unclassified | 1576 |
| 416 | Ga0207665_10201983 | 3300025939 | Unclassified | 1449 |
| 417 | Ga0207665_11095950 | 3300025939 | Bacteria | 635 |
| 418 | Ga0207691_10007809 | 3300025940 | Bacteria | 10301 |
| 419 | Ga0207691_10031554 | 3300025940 | Bacteria | 4944 |
| 420 | Ga0207711_11555680 | 3300025941 | Unclassified | 604 |
| 421 | Ga0207689_10259595 | 3300025942 | Unclassified | 1437 |
| 422 | Ga0207689_10494740 | 3300025942 | Unclassified | 1024 |
| 423 | Ga0207661_10189109 | 3300025944 | Bacteria | 1804 |
| 424 | Ga0207679_10071936 | 3300025945 | Unclassified | 2610 |
| 425 | Ga0207651_10002389 | 3300025960 | Bacteria | 8967 |
| 426 | Ga0207651_11203818 | 3300025960 | Unclassified | 680 |
| 427 | Ga0207712_10007194 | 3300025961 | Bacteria | 7019 |
| 428 | Ga0207712_10120200 | 3300025961 | Unclassified | 1986 |
| 429 | Ga0207668_10197579 | 3300025972 | Bacteria | 1599 |
| 430 | Ga0207668_10411507 | 3300025972 | Bacteria | 1146 |
| 431 | Ga0207668_10703360 | 3300025972 | Bacteria | 888 |
| 432 | Ga0207640_10297143 | 3300025981 | Unclassified | 1276 |
| 433 | Ga0207658_10204440 | 3300025986 | Bacteria | 1651 |
| 434 | Ga0207677_10036468 | 3300026023 | Bacteria | 3205 |
| 435 | Ga0207703_10064701 | 3300026035 | Bacteria | 3002 |
| 436 | Ga0207703_10219430 | 3300026035 | Unclassified | 1699 |
| 437 | Ga0207703_11428483 | 3300026035 | Bacteria | 666 |
| 438 | Ga0207678_10225600 | 3300026067 | Unclassified | 1604 |
| 439 | Ga0207678_10785970 | 3300026067 | Bacteria | 840 |
| 440 | Ga0207678_11124147 | 3300026067 | Unclassified | 696 |
| 441 | Ga0207708_10016626 | 3300026075 | Bacteria | 5535 |
| 442 | Ga0207702_10153532 | 3300026078 | Bacteria | 2097 |
| 443 | Ga0207641_10021172 | 3300026088 | Bacteria | 5345 |
| 444 | Ga0207641_10068173 | 3300026088 | Bacteria | 3050 |
| 445 | Ga0207641_10159905 | 3300026088 | Unclassified | 2047 |
| 446 | Ga0207676_10437281 | 3300026095 | Bacteria | 1230 |
| 447 | Ga0207676_10782792 | 3300026095 | Unclassified | 930 |
| 448 | Ga0207676_11771272 | 3300026095 | Bacteria | 616 |
| 449 | Ga0207674_12090740 | 3300026116 | Bacteria | 530 |
| 450 | Ga0207675_100105591 | 3300026118 | Unclassified | 2655 |
| 451 | Ga0207683_10006047 | 3300026121 | Bacteria | 10362 |
| 452 | Ga0207683_10034795 | 3300026121 | Unclassified | 4380 |
| 453 | Ga0210002_1057659 | 3300027617 | Bacteria | 675 |
| 454 | Ga0268266_10011660 | 3300028379 | Bacteria | 7629 |
| 455 | Ga0268266_10323481 | 3300028379 | Bacteria | 1444 |
| 456 | Ga0268266_10960691 | 3300028379 | Unclassified | 827 |
| 457 | Ga0268264_10187010 | 3300028381 | Unclassified | 1885 |
| 458 | Ga0373923_0120469 | 3300035111 | Bacteria | 1172 |
| 459 | Ga0373953_0514098 | 3300035117 | Bacteria | 531 |
| 460 | Ga0373954_0243106 | 3300035118 | Unclassified | 886 |
| 461 | Ga0373956_0409127 | 3300035119 | Unclassified | 647 |
| 462 | Ga0373943_0178297 | 3300035170 | Bacteria | 1167 |
| 463 | Ga0373943_0724070 | 3300035170 | Bacteria | 590 |
| 464 | Ga0373946_0158184 | 3300035171 | Unclassified | 1062 |
| 465 | Ga0373946_0472198 | 3300035171 | Bacteria | 641 |
| 466 | Ga0373955_0957777 | 3300035172 | Bacteria | 527 |
| 467 | Ga0373924_0041031 | 3300035410 | Bacteria | 1896 |
| 468 | Ga0373935_0377100 | 3300035692 | Bacteria | 1015 |
| 469 | Ga0373927_0018960 | 3300035695 | Unclassified | 4514 |
| 470 | Ga0373933_0226629 | 3300035724 | Bacteria | 1200 |
| 471 | Ga0373947_0012308 | 3300035725 | Bacteria | 4903 |
| 472 | Ga0373947_0033537 | 3300035725 | Bacteria | 3032 |
| 473 | Ga0373947_0236747 | 3300035725 | Bacteria | 1204 |
| 474 | Ga0373947_0523939 | 3300035725 | Bacteria | 806 |
| 475 | Ga0373937_0331845 | 3300036401 | Bacteria | 1440 |
| 476 | Ga0373937_0610467 | 3300036401 | Bacteria | 1035 |
| 477 | Ga0373925_0307298 | 3300037068 | Unclassified | 1281 |
| 478 | Ga0373925_0334314 | 3300037068 | Bacteria | 1228 |
| 479 | Ga0373925_1284742 | 3300037068 | Unclassified | 601 |
| 480 | Ga0395899_0371354 | 3300037312 | Bacteria | 952 |
| 481 | Ga0395899_0534649 | 3300037312 | Bacteria | 756 |
| 482 | Ga0395900_0007923 | 3300037418 | Bacteria | 10936 |
| 483 | Ga0395900_0278889 | 3300037418 | Bacteria | 1664 |
| 484 | Ga0395900_0518773 | 3300037418 | Bacteria | 1140 |
| 485 | Ga0395900_1024403 | 3300037418 | Bacteria | 745 |
| 486 | Ga0395900_1079864 | 3300037418 | Bacteria | 720 |
| 487 | Ga0395898_0077009 | 3300037466 | Bacteria | 3220 |
| 488 | Ga0395905_0203670 | 3300037471 | Bacteria | 1855 |
| 489 | Ga0436364_0361571 | 3300037853 | Bacteria | 1090 |
| 490 | Ga0395901_0154466 | 3300038443 | Bacteria | 2411 |
| 491 | Ga0395901_0660134 | 3300038443 | Bacteria | 1048 |
| 492 | Ga0395901_0956638 | 3300038443 | Unclassified | 835 |
| 493 | Ga0395901_1875084 | 3300038443 | Bacteria | 547 |
| 494 | Ga0436360_0402730 | 3300039438 | Unclassified | 1611 |
| 495 | Ga0436361_0303249 | 3300039447 | Unclassified | 1512 |
| 496 | Ga0436361_0675134 | 3300039447 | Bacteria | 1080 |
| 497 | Ga0436362_0977882 | 3300039453 | Unclassified | 687 |
| 498 | Ga0451807_0288746 | 3300041486 | Unclassified | 651 |
| 499 | Ga0451839_0639711 | 3300041496 | Unclassified | 624 |
| 500 | Ga0451853_3880816 | 3300041512 | Bacteria | 1679 |
| 501 | Ga0439455_0036557 | 3300042012 | Unclassified | 1243 |
| 502 | Ga0439458_0031886 | 3300042157 | Unclassified | 1258 |
| 503 | Ga0439464_0133285 | 3300042439 | Unclassified | 770 |
| 504 | Ga0466964_0020842 | 3300044706 | Bacteria | 2528 |
| 505 | Ga0466967_0630308 | 3300045976 | Bacteria | 1059 |
| 506 | Ga0495592_0094157 | 3300046454 | Bacteria | 2144 |
| 507 | Ga0495603_0294268 | 3300046455 | Bacteria | 933 |
| 508 | Ga0495651_0177862 | 3300046462 | Bacteria | 1509 |
| 509 | Ga0495580_0356275 | 3300046472 | Bacteria | 991 |
| 510 | Ga0495664_0330672 | 3300046477 | Bacteria | 919 |
| 511 | Ga0495584_0488180 | 3300046491 | Bacteria | 627 |
| 512 | Ga0495618_0128958 | 3300046514 | Bacteria | 1619 |
| 513 | Ga0495618_0166494 | 3300046514 | Unclassified | 1404 |
| 514 | Ga0495628_0848646 | 3300046516 | Bacteria | 636 |
| 515 | Ga0495630_0293699 | 3300046517 | Bacteria | 1242 |
| 516 | Ga0495630_0449651 | 3300046517 | Unclassified | 987 |
| 517 | Ga0495666_0450432 | 3300046526 | Bacteria | 577 |
| 518 | Ga0495652_0132881 | 3300046529 | Bacteria | 1967 |
| 519 | Ga0495652_0149726 | 3300046529 | Bacteria | 1825 |
| 520 | Ga0495640_0285760 | 3300046533 | Bacteria | 1027 |
| 521 | Ga0495586_0799963 | 3300046535 | Bacteria | 544 |
| 522 | Ga0495587_0067299 | 3300046536 | Bacteria | 2088 |
| 523 | Ga0495645_0314674 | 3300046543 | Bacteria | 1018 |
| 524 | Ga0495667_0215407 | 3300046559 | Unclassified | 1227 |
| 525 | Ga0495634_0008725 | 3300046642 | Bacteria | 7517 |
| 526 | Ga0495634_0094397 | 3300046642 | Bacteria | 1939 |
| 527 | Ga0495634_0837337 | 3300046642 | Bacteria | 523 |
| 528 | Ga0495635_0799286 | 3300046663 | Unclassified | 608 |
| 529 | Ga0495599_0289130 | 3300046678 | Bacteria | 991 |
| 530 | Ga0495646_0054827 | 3300046680 | Bacteria | 2396 |
| 531 | Ga0495647_0427619 | 3300046681 | Unclassified | 611 |
| 532 | Ga0495669_0190931 | 3300046684 | Bacteria | 978 |
| 533 | Ga0495613_0094429 | 3300046689 | Unclassified | 2164 |
| 534 | Ga0495624_0622761 | 3300046690 | Unclassified | 643 |
| 535 | Ga0495581_0325631 | 3300047315 | Unclassified | 898 |
| 536 | Ga0495604_0369233 | 3300047317 | Bacteria | 950 |
| 537 | Ga0495674_0082451 | 3300047319 | Bacteria | 2757 |
| 538 | Ga0495676_0425230 | 3300047321 | Bacteria | 879 |
| 539 | Ga0495675_0366542 | 3300047444 | Bacteria | 845 |
| 540 | Ga0495684_0011845 | 3300047471 | Bacteria | 6730 |
| 541 | Ga0495626_0343195 | 3300048091 | Unclassified | 584 |
| 542 | Ga0496100_0022890 | 3300048903 | Unclassified | 3787 |
| 543 | Ga0496100_0070022 | 3300048903 | Archaea | 2338 |
| 544 | Ga0496100_0540150 | 3300048903 | Bacteria | 901 |
| 545 | Ga0496101_0049432 | 3300048904 | Bacteria | 3025 |
| 546 | Ga0496101_0092567 | 3300048904 | Bacteria | 2251 |
| 547 | Ga0496101_0116016 | 3300048904 | Unclassified | 2020 |
| 548 | Ga0496102_0057758 | 3300048905 | Unclassified | 3544 |
| 549 | Ga0496102_0087107 | 3300048905 | Bacteria | 2885 |
| 550 | Ga0496102_0233602 | 3300048905 | Unclassified | 1733 |
| 551 | Ga0496103_0096373 | 3300048906 | Unclassified | 1870 |
| 552 | Ga0496103_0361681 | 3300048906 | Bacteria | 933 |
| 553 | Ga0496104_0075583 | 3300048907 | Unclassified | 3208 |
| 554 | Ga0496104_0234752 | 3300048907 | Bacteria | 1746 |
| 555 | Ga0496104_0248553 | 3300048907 | Bacteria | 1691 |
| 556 | Ga0496104_0781579 | 3300048907 | Unclassified | 861 |
| 557 | Ga0496104_1058154 | 3300048907 | Unclassified | 715 |
| 558 | Ga0496105_0190840 | 3300048908 | Bacteria | 1675 |
| 559 | Ga0496105_0225263 | 3300048908 | Bacteria | 1525 |
| 560 | Ga0496106_0023752 | 3300048909 | Bacteria | 4556 |
| 561 | Ga0496106_0267467 | 3300048909 | Unclassified | 1368 |
| 562 | Ga0496106_0859351 | 3300048909 | Bacteria | 718 |
| 563 | Ga0496107_0058247 | 3300048910 | Unclassified | 2793 |
| 564 | Ga0496107_0145246 | 3300048910 | Bacteria | 1754 |
| 565 | Ga0496108_0072226 | 3300048911 | Unclassified | 2913 |
| 566 | Ga0496108_0094907 | 3300048911 | Bacteria | 2539 |
| 567 | Ga0496108_0146407 | 3300048911 | Bacteria | 2036 |
| 568 | Ga0496108_0822476 | 3300048911 | Bacteria | 801 |
| 569 | Ga0496109_0025522 | 3300048912 | Bacteria | 5267 |
| 570 | Ga0496109_0360706 | 3300048912 | Unclassified | 1373 |
| 571 | Ga0496109_0976852 | 3300048912 | Unclassified | 785 |
| 572 | Ga0496110_0010931 | 3300048913 | Bacteria | 7403 |
| 573 | Ga0496110_0785402 | 3300048913 | Unclassified | 856 |
| 574 | Ga0496110_1097942 | 3300048913 | Bacteria | 704 |
| 575 | Ga0496111_0074781 | 3300048914 | Archaea | 2468 |
| 576 | Ga0496111_0178737 | 3300048914 | Bacteria | 1577 |
| 577 | Ga0496112_0025752 | 3300048915 | Bacteria | 5650 |
| 578 | Ga0496112_0209813 | 3300048915 | Bacteria | 1905 |
| 579 | Ga0496112_0317332 | 3300048915 | Unclassified | 1503 |
| 580 | Ga0496112_0384537 | 3300048915 | Bacteria | 1344 |
| 581 | Ga0496112_0533042 | 3300048915 | Bacteria | 1108 |
| 582 | Ga0496113_0359759 | 3300048916 | Unclassified | 1168 |
| 583 | Ga0496113_0382520 | 3300048916 | Bacteria | 1129 |
| 584 | Ga0496113_0472160 | 3300048916 | Bacteria | 1008 |
| 585 | Ga0496114_0029846 | 3300048917 | Bacteria | 4483 |
| 586 | Ga0496114_0045336 | 3300048917 | Bacteria | 3652 |
| 587 | Ga0496115_0005912 | 3300048918 | Bacteria | 8921 |
| 588 | Ga0496115_0023024 | 3300048918 | Bacteria | 4832 |
| 589 | Ga0496115_0231002 | 3300048918 | Unclassified | 1525 |
| 590 | Ga0496115_0361137 | 3300048918 | Unclassified | 1183 |
| 591 | Ga0496115_0526085 | 3300048918 | Archaea | 948 |
| 592 | Ga0501067_0255745 | 3300049583 | Bacteria | 975 |
| 593 | Ga0501083_0013400 | 3300049744 | Bacteria | 5731 |
| 594 | nmdc:mga05p37_224020_c1 | 3300050507 | Bacteria | 2268 |
| 595 | nmdc:mga05p37_454619_c1 | 3300050507 | Bacteria | 1481 |
| 596 | nmdc:mga05p37_53994_c1 | 3300050507 | Unclassified | 4943 |
| 597 | nmdc:mga0n895_190623_c1 | 3300050512 | Bacteria | 2081 |
| 598 | nmdc:mga0n895_768737_c1 | 3300050512 | Bacteria | 955 |
| 599 | nmdc:mga0rr50_1411580_c1 | 3300050513 | Unclassified | 589 |
| 600 | nmdc:mga0a205_622459_c1 | 3300050515 | Bacteria | 932 |
| 601 | nmdc:mga0a205_634115_c1 | 3300050515 | Unclassified | 920 |
| 602 | Ga0495619_0496329 | 3300053085 | Bacteria | 840 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035119 | Ga0373956_0409127 | Ga0373956_0409127_150_509 | 119 |
| 2 | 3300005272 | Ga0065703_1000584 | Ga0065703_10005842 | 138 |
| 3 | 3300005435 | Ga0070714_100013099 | Ga0070714_1000130994 | 138 |
| 4 | 3300005445 | Ga0070708_101184239 | Ga0070708_1011842392 | 138 |
| 5 | 3300005445 | Ga0070708_101314879 | Ga0070708_1013148791 | 138 |
| 6 | 3300005467 | Ga0070706_100000218 | Ga0070706_10000021840 | 138 |
| 7 | 3300005467 | Ga0070706_101389517 | Ga0070706_1013895171 | 138 |
| 8 | 3300005468 | Ga0070707_100421366 | Ga0070707_1004213661 | 138 |
| 9 | 3300005471 | Ga0070698_100009964 | Ga0070698_1000099643 | 138 |
| 10 | 3300005518 | Ga0070699_100902004 | Ga0070699_1009020042 | 138 |
| 11 | 3300005518 | Ga0070699_101439049 | Ga0070699_1014390491 | 138 |
| 12 | 3300005536 | Ga0070697_100351694 | Ga0070697_1003516942 | 138 |
| 13 | 3300006028 | Ga0070717_10010249 | Ga0070717_100102492 | 138 |
| 14 | 3300006028 | Ga0070717_10040998 | Ga0070717_100409983 | 138 |
| 15 | 3300006028 | Ga0070717_10079972 | Ga0070717_100799722 | 138 |
| 16 | 3300025910 | Ga0207684_10000292 | Ga0207684_1000029239 | 138 |
| 17 | 3300025910 | Ga0207684_10113658 | Ga0207684_101136585 | 138 |
| 18 | 3300025922 | Ga0207646_10075894 | Ga0207646_100758943 | 138 |
| 19 | 3300025922 | Ga0207646_10185223 | Ga0207646_101852231 | 138 |
| 20 | 3300037853 | Ga0436364_0361571 | Ga0436364_0361571_478_894 | 138 |
| 21 | 3300048910 | Ga0496107_0145246 | Ga0496107_0145246_907_1332 | 138 |
| 22 | 3300001989 | JGI24739J22299_10217976 | JGI24739J22299_102179761 | 139 |
| 23 | 3300001990 | JGI24737J22298_10045963 | JGI24737J22298_100459631 | 139 |
| 24 | 3300001991 | JGI24743J22301_10009340 | JGI24743J22301_100093402 | 139 |
| 25 | 3300002126 | JGI24035J26624_1000390 | JGI24035J26624_10003902 | 139 |
| 26 | 3300003911 | JGI25405J52794_10000078 | JGI25405J52794_1000007811 | 139 |
| 27 | 3300003911 | JGI25405J52794_10003345 | JGI25405J52794_100033452 | 139 |
| 28 | 3300005288 | Ga0065714_10201160 | Ga0065714_102011602 | 139 |
| 29 | 3300005289 | Ga0065704_10027417 | Ga0065704_100274171 | 139 |
| 30 | 3300005289 | Ga0065704_10193752 | Ga0065704_101937522 | 139 |
| 31 | 3300005289 | Ga0065704_10415633 | Ga0065704_104156331 | 139 |
| 32 | 3300005289 | Ga0065704_10695390 | Ga0065704_106953901 | 139 |
| 33 | 3300005290 | Ga0065712_10006984 | Ga0065712_100069842 | 139 |
| 34 | 3300005290 | Ga0065712_10011917 | Ga0065712_100119172 | 139 |
| 35 | 3300005290 | Ga0065712_10129135 | Ga0065712_101291353 | 139 |
| 36 | 3300005293 | Ga0065715_10012321 | Ga0065715_100123213 | 139 |
| 37 | 3300005293 | Ga0065715_10098646 | Ga0065715_100986463 | 139 |
| 38 | 3300005293 | Ga0065715_10230264 | Ga0065715_102302642 | 139 |
| 39 | 3300005293 | Ga0065715_10348063 | Ga0065715_103480631 | 139 |
| 40 | 3300005293 | Ga0065715_11062046 | Ga0065715_110620461 | 139 |
| 41 | 3300005295 | Ga0065707_10124882 | Ga0065707_101248822 | 139 |
| 42 | 3300005295 | Ga0065707_10207853 | Ga0065707_102078532 | 139 |
| 43 | 3300005295 | Ga0065707_10218351 | Ga0065707_102183511 | 139 |
| 44 | 3300005295 | Ga0065707_10241319 | Ga0065707_102413192 | 139 |
| 45 | 3300005327 | Ga0070658_10257816 | Ga0070658_102578161 | 139 |
| 46 | 3300005327 | Ga0070658_11050207 | Ga0070658_110502071 | 139 |
| 47 | 3300005328 | Ga0070676_10069309 | Ga0070676_100693092 | 139 |
| 48 | 3300005329 | Ga0070683_100011212 | Ga0070683_1000112125 | 139 |
| 49 | 3300005329 | Ga0070683_100048602 | Ga0070683_1000486023 | 139 |
| 50 | 3300005330 | Ga0070690_100345759 | Ga0070690_1003457591 | 139 |
| 51 | 3300005330 | Ga0070690_100358217 | Ga0070690_1003582172 | 139 |
| 52 | 3300005331 | Ga0070670_100665295 | Ga0070670_1006652951 | 139 |
| 53 | 3300005333 | Ga0070677_10114873 | Ga0070677_101148732 | 139 |
| 54 | 3300005334 | Ga0068869_100196897 | Ga0068869_1001968972 | 139 |
| 55 | 3300005335 | Ga0070666_10253695 | Ga0070666_102536952 | 139 |
| 56 | 3300005335 | Ga0070666_10316064 | Ga0070666_103160642 | 139 |
| 57 | 3300005335 | Ga0070666_10628452 | Ga0070666_106284521 | 139 |
| 58 | 3300005335 | Ga0070666_11214180 | Ga0070666_112141801 | 139 |
| 59 | 3300005336 | Ga0070680_100775128 | Ga0070680_1007751281 | 139 |
| 60 | 3300005337 | Ga0070682_100303231 | Ga0070682_1003032311 | 139 |
| 61 | 3300005338 | Ga0068868_100031039 | Ga0068868_1000310393 | 139 |
| 62 | 3300005339 | Ga0070660_100006893 | Ga0070660_1000068937 | 139 |
| 63 | 3300005339 | Ga0070660_100659016 | Ga0070660_1006590162 | 139 |
| 64 | 3300005339 | Ga0070660_101472055 | Ga0070660_1014720551 | 139 |
| 65 | 3300005340 | Ga0070689_100006670 | Ga0070689_1000066705 | 139 |
| 66 | 3300005340 | Ga0070689_100007427 | Ga0070689_1000074273 | 139 |
| 67 | 3300005340 | Ga0070689_100118689 | Ga0070689_1001186895 | 139 |
| 68 | 3300005344 | Ga0070661_100260373 | Ga0070661_1002603733 | 139 |
| 69 | 3300005347 | Ga0070668_100137888 | Ga0070668_1001378884 | 139 |
| 70 | 3300005347 | Ga0070668_100279196 | Ga0070668_1002791961 | 139 |
| 71 | 3300005347 | Ga0070668_101541352 | Ga0070668_1015413521 | 139 |
| 72 | 3300005353 | Ga0070669_100288601 | Ga0070669_1002886011 | 139 |
| 73 | 3300005354 | Ga0070675_100017435 | Ga0070675_1000174352 | 139 |
| 74 | 3300005354 | Ga0070675_100033004 | Ga0070675_1000330042 | 139 |
| 75 | 3300005354 | Ga0070675_100335377 | Ga0070675_1003353772 | 139 |
| 76 | 3300005354 | Ga0070675_100554437 | Ga0070675_1005544371 | 139 |
| 77 | 3300005354 | Ga0070675_100573763 | Ga0070675_1005737631 | 139 |
| 78 | 3300005355 | Ga0070671_100031990 | Ga0070671_1000319903 | 139 |
| 79 | 3300005355 | Ga0070671_100166078 | Ga0070671_1001660782 | 139 |
| 80 | 3300005355 | Ga0070671_100664604 | Ga0070671_1006646042 | 139 |
| 81 | 3300005356 | Ga0070674_100115748 | Ga0070674_1001157482 | 139 |
| 82 | 3300005356 | Ga0070674_100578873 | Ga0070674_1005788731 | 139 |
| 83 | 3300005356 | Ga0070674_100931545 | Ga0070674_1009315452 | 139 |
| 84 | 3300005364 | Ga0070673_100001802 | Ga0070673_10000180210 | 139 |
| 85 | 3300005364 | Ga0070673_100054279 | Ga0070673_1000542794 | 139 |
| 86 | 3300005364 | Ga0070673_101185096 | Ga0070673_1011850961 | 139 |
| 87 | 3300005364 | Ga0070673_101999310 | Ga0070673_1019993101 | 139 |
| 88 | 3300005365 | Ga0070688_100003545 | Ga0070688_1000035452 | 139 |
| 89 | 3300005365 | Ga0070688_100003930 | Ga0070688_1000039304 | 139 |
| 90 | 3300005365 | Ga0070688_100004655 | Ga0070688_1000046557 | 139 |
| 91 | 3300005366 | Ga0070659_100003503 | Ga0070659_1000035037 | 139 |
| 92 | 3300005366 | Ga0070659_100435065 | Ga0070659_1004350652 | 139 |
| 93 | 3300005366 | Ga0070659_100634601 | Ga0070659_1006346011 | 139 |
| 94 | 3300005367 | Ga0070667_100216264 | Ga0070667_1002162642 | 139 |
| 95 | 3300005367 | Ga0070667_100593901 | Ga0070667_1005939012 | 139 |
| 96 | 3300005367 | Ga0070667_101045527 | Ga0070667_1010455271 | 139 |
| 97 | 3300005434 | Ga0070709_10015230 | Ga0070709_100152304 | 139 |
| 98 | 3300005434 | Ga0070709_10100881 | Ga0070709_101008812 | 139 |
| 99 | 3300005434 | Ga0070709_10576627 | Ga0070709_105766272 | 139 |
| 100 | 3300005434 | Ga0070709_11438518 | Ga0070709_114385181 | 139 |
| 101 | 3300005435 | Ga0070714_100232632 | Ga0070714_1002326322 | 139 |
| 102 | 3300005435 | Ga0070714_100608650 | Ga0070714_1006086501 | 139 |
| 103 | 3300005436 | Ga0070713_100067914 | Ga0070713_1000679141 | 139 |
| 104 | 3300005436 | Ga0070713_100154241 | Ga0070713_1001542413 | 139 |
| 105 | 3300005436 | Ga0070713_100217462 | Ga0070713_1002174623 | 139 |
| 106 | 3300005436 | Ga0070713_100267300 | Ga0070713_1002673003 | 139 |
| 107 | 3300005436 | Ga0070713_100307942 | Ga0070713_1003079422 | 139 |
| 108 | 3300005436 | Ga0070713_101438150 | Ga0070713_1014381501 | 139 |
| 109 | 3300005436 | Ga0070713_102383714 | Ga0070713_1023837141 | 139 |
| 110 | 3300005437 | Ga0070710_10038388 | Ga0070710_100383884 | 139 |
| 111 | 3300005437 | Ga0070710_10116481 | Ga0070710_101164811 | 139 |
| 112 | 3300005437 | Ga0070710_10156673 | Ga0070710_101566732 | 139 |
| 113 | 3300005437 | Ga0070710_10306038 | Ga0070710_103060381 | 139 |
| 114 | 3300005437 | Ga0070710_10573810 | Ga0070710_105738101 | 139 |
| 115 | 3300005437 | Ga0070710_10738438 | Ga0070710_107384381 | 139 |
| 116 | 3300005438 | Ga0070701_10171066 | Ga0070701_101710661 | 139 |
| 117 | 3300005438 | Ga0070701_10215165 | Ga0070701_102151652 | 139 |
| 118 | 3300005439 | Ga0070711_100006507 | Ga0070711_1000065077 | 139 |
| 119 | 3300005439 | Ga0070711_100053814 | Ga0070711_1000538144 | 139 |
| 120 | 3300005439 | Ga0070711_100102505 | Ga0070711_1001025053 | 139 |
| 121 | 3300005440 | Ga0070705_100083056 | Ga0070705_1000830564 | 139 |
| 122 | 3300005440 | Ga0070705_100126554 | Ga0070705_1001265543 | 139 |
| 123 | 3300005440 | Ga0070705_100419228 | Ga0070705_1004192281 | 139 |
| 124 | 3300005441 | Ga0070700_100010793 | Ga0070700_1000107935 | 139 |
| 125 | 3300005444 | Ga0070694_100134473 | Ga0070694_1001344732 | 139 |
| 126 | 3300005445 | Ga0070708_100035044 | Ga0070708_1000350444 | 139 |
| 127 | 3300005445 | Ga0070708_100155206 | Ga0070708_1001552063 | 139 |
| 128 | 3300005445 | Ga0070708_100831488 | Ga0070708_1008314882 | 139 |
| 129 | 3300005445 | Ga0070708_102219667 | Ga0070708_1022196671 | 139 |
| 130 | 3300005455 | Ga0070663_101137110 | Ga0070663_1011371102 | 139 |
| 131 | 3300005456 | Ga0070678_100045438 | Ga0070678_1000454383 | 139 |
| 132 | 3300005456 | Ga0070678_100061744 | Ga0070678_1000617442 | 139 |
| 133 | 3300005456 | Ga0070678_100145796 | Ga0070678_1001457964 | 139 |
| 134 | 3300005457 | Ga0070662_100019102 | Ga0070662_1000191023 | 139 |
| 135 | 3300005457 | Ga0070662_100027468 | Ga0070662_1000274684 | 139 |
| 136 | 3300005457 | Ga0070662_100121461 | Ga0070662_1001214612 | 139 |
| 137 | 3300005457 | Ga0070662_100358049 | Ga0070662_1003580492 | 139 |
| 138 | 3300005458 | Ga0070681_10042347 | Ga0070681_100423473 | 139 |
| 139 | 3300005466 | Ga0070685_10014746 | Ga0070685_100147465 | 139 |
| 140 | 3300005466 | Ga0070685_10061011 | Ga0070685_100610112 | 139 |
| 141 | 3300005467 | Ga0070706_100062966 | Ga0070706_1000629665 | 139 |
| 142 | 3300005467 | Ga0070706_100080916 | Ga0070706_1000809163 | 139 |
| 143 | 3300005467 | Ga0070706_100089406 | Ga0070706_1000894062 | 139 |
| 144 | 3300005467 | Ga0070706_100236259 | Ga0070706_1002362593 | 139 |
| 145 | 3300005467 | Ga0070706_100250725 | Ga0070706_1002507252 | 139 |
| 146 | 3300005467 | Ga0070706_101091328 | Ga0070706_1010913281 | 139 |
| 147 | 3300005467 | Ga0070706_101136366 | Ga0070706_1011363662 | 139 |
| 148 | 3300005468 | Ga0070707_100076452 | Ga0070707_1000764523 | 139 |
| 149 | 3300005468 | Ga0070707_100094690 | Ga0070707_1000946902 | 139 |
| 150 | 3300005468 | Ga0070707_100280362 | Ga0070707_1002803622 | 139 |
| 151 | 3300005468 | Ga0070707_100312212 | Ga0070707_1003122122 | 139 |
| 152 | 3300005468 | Ga0070707_100502946 | Ga0070707_1005029462 | 139 |
| 153 | 3300005471 | Ga0070698_100022507 | Ga0070698_1000225073 | 139 |
| 154 | 3300005471 | Ga0070698_100155739 | Ga0070698_1001557393 | 139 |
| 155 | 3300005471 | Ga0070698_100346898 | Ga0070698_1003468982 | 139 |
| 156 | 3300005471 | Ga0070698_100614185 | Ga0070698_1006141852 | 139 |
| 157 | 3300005471 | Ga0070698_101416280 | Ga0070698_1014162801 | 139 |
| 158 | 3300005518 | Ga0070699_100120714 | Ga0070699_1001207143 | 139 |
| 159 | 3300005518 | Ga0070699_101653547 | Ga0070699_1016535471 | 139 |
| 160 | 3300005530 | Ga0070679_100608386 | Ga0070679_1006083861 | 139 |
| 161 | 3300005535 | Ga0070684_100001520 | Ga0070684_10000152014 | 139 |
| 162 | 3300005535 | Ga0070684_100689435 | Ga0070684_1006894351 | 139 |
| 163 | 3300005535 | Ga0070684_101307466 | Ga0070684_1013074661 | 139 |
| 164 | 3300005536 | Ga0070697_100016187 | Ga0070697_1000161874 | 139 |
| 165 | 3300005536 | Ga0070697_100032855 | Ga0070697_1000328554 | 139 |
| 166 | 3300005536 | Ga0070697_100033606 | Ga0070697_1000336062 | 139 |
| 167 | 3300005536 | Ga0070697_100126103 | Ga0070697_1001261034 | 139 |
| 168 | 3300005536 | Ga0070697_100211260 | Ga0070697_1002112602 | 139 |
| 169 | 3300005536 | Ga0070697_101064601 | Ga0070697_1010646011 | 139 |
| 170 | 3300005536 | Ga0070697_101147534 | Ga0070697_1011475341 | 139 |
| 171 | 3300005536 | Ga0070697_101204533 | Ga0070697_1012045331 | 139 |
| 172 | 3300005543 | Ga0070672_100072922 | Ga0070672_1000729222 | 139 |
| 173 | 3300005543 | Ga0070672_100215775 | Ga0070672_1002157752 | 139 |
| 174 | 3300005543 | Ga0070672_100224980 | Ga0070672_1002249801 | 139 |
| 175 | 3300005543 | Ga0070672_101548772 | Ga0070672_1015487721 | 139 |
| 176 | 3300005544 | Ga0070686_100391283 | Ga0070686_1003912832 | 139 |
| 177 | 3300005545 | Ga0070695_100192050 | Ga0070695_1001920502 | 139 |
| 178 | 3300005546 | Ga0070696_100526134 | Ga0070696_1005261342 | 139 |
| 179 | 3300005548 | Ga0070665_100027567 | Ga0070665_1000275677 | 139 |
| 180 | 3300005548 | Ga0070665_100113471 | Ga0070665_1001134714 | 139 |
| 181 | 3300005548 | Ga0070665_101468524 | Ga0070665_1014685241 | 139 |
| 182 | 3300005549 | Ga0070704_100002967 | Ga0070704_1000029677 | 139 |
| 183 | 3300005549 | Ga0070704_100764964 | Ga0070704_1007649641 | 139 |
| 184 | 3300005564 | Ga0070664_101648659 | Ga0070664_1016486591 | 139 |
| 185 | 3300005577 | Ga0068857_100389551 | Ga0068857_1003895512 | 139 |
| 186 | 3300005578 | Ga0068854_100105524 | Ga0068854_1001055244 | 139 |
| 187 | 3300005614 | Ga0068856_100160431 | Ga0068856_1001604311 | 139 |
| 188 | 3300005614 | Ga0068856_100161267 | Ga0068856_1001612672 | 139 |
| 189 | 3300005615 | Ga0070702_100027995 | Ga0070702_1000279951 | 139 |
| 190 | 3300005615 | Ga0070702_100105769 | Ga0070702_1001057691 | 139 |
| 191 | 3300005615 | Ga0070702_101742048 | Ga0070702_1017420481 | 139 |
| 192 | 3300005618 | Ga0068864_100040823 | Ga0068864_1000408233 | 139 |
| 193 | 3300005718 | Ga0068866_10608494 | Ga0068866_106084941 | 139 |
| 194 | 3300005719 | Ga0068861_102105159 | Ga0068861_1021051592 | 139 |
| 195 | 3300005834 | Ga0068851_10451034 | Ga0068851_104510342 | 139 |
| 196 | 3300005841 | Ga0068863_100002599 | Ga0068863_1000025992 | 139 |
| 197 | 3300005841 | Ga0068863_100077542 | Ga0068863_1000775422 | 139 |
| 198 | 3300005841 | Ga0068863_100120955 | Ga0068863_1001209552 | 139 |
| 199 | 3300005841 | Ga0068863_100152982 | Ga0068863_1001529822 | 139 |
| 200 | 3300005841 | Ga0068863_101503374 | Ga0068863_1015033741 | 139 |
| 201 | 3300005842 | Ga0068858_100001603 | Ga0068858_10000160322 | 139 |
| 202 | 3300005842 | Ga0068858_100131016 | Ga0068858_1001310164 | 139 |
| 203 | 3300005843 | Ga0068860_100007710 | Ga0068860_1000077107 | 139 |
| 204 | 3300005843 | Ga0068860_101661350 | Ga0068860_1016613501 | 139 |
| 205 | 3300005937 | Ga0081455_10002976 | Ga0081455_100029768 | 139 |
| 206 | 3300005937 | Ga0081455_10003354 | Ga0081455_100033547 | 139 |
| 207 | 3300005937 | Ga0081455_10032679 | Ga0081455_100326798 | 139 |
| 208 | 3300005937 | Ga0081455_10037973 | Ga0081455_100379733 | 139 |
| 209 | 3300005937 | Ga0081455_10099004 | Ga0081455_100990041 | 139 |
| 210 | 3300005937 | Ga0081455_10124982 | Ga0081455_101249821 | 139 |
| 211 | 3300005983 | Ga0081540_1000057 | Ga0081540_100005742 | 139 |
| 212 | 3300005983 | Ga0081540_1037749 | Ga0081540_10377493 | 139 |
| 213 | 3300005983 | Ga0081540_1048239 | Ga0081540_10482393 | 139 |
| 214 | 3300005983 | Ga0081540_1088727 | Ga0081540_10887273 | 139 |
| 215 | 3300005985 | Ga0081539_10146363 | Ga0081539_101463632 | 139 |
| 216 | 3300006028 | Ga0070717_10016767 | Ga0070717_100167674 | 139 |
| 217 | 3300006028 | Ga0070717_10017293 | Ga0070717_100172935 | 139 |
| 218 | 3300006028 | Ga0070717_10055249 | Ga0070717_100552494 | 139 |
| 219 | 3300006028 | Ga0070717_10113763 | Ga0070717_101137633 | 139 |
| 220 | 3300006028 | Ga0070717_10155883 | Ga0070717_101558832 | 139 |
| 221 | 3300006028 | Ga0070717_10284337 | Ga0070717_102843372 | 139 |
| 222 | 3300006028 | Ga0070717_10399783 | Ga0070717_103997832 | 139 |
| 223 | 3300006028 | Ga0070717_11866190 | Ga0070717_118661901 | 139 |
| 224 | 3300006163 | Ga0070715_10196214 | Ga0070715_101962142 | 139 |
| 225 | 3300006163 | Ga0070715_10239635 | Ga0070715_102396352 | 139 |
| 226 | 3300006173 | Ga0070716_100088639 | Ga0070716_1000886392 | 139 |
| 227 | 3300006173 | Ga0070716_100209891 | Ga0070716_1002098912 | 139 |
| 228 | 3300006175 | Ga0070712_100111528 | Ga0070712_1001115281 | 139 |
| 229 | 3300006175 | Ga0070712_100115328 | Ga0070712_1001153282 | 139 |
| 230 | 3300006175 | Ga0070712_100323916 | Ga0070712_1003239162 | 139 |
| 231 | 3300006175 | Ga0070712_100700193 | Ga0070712_1007001931 | 139 |
| 232 | 3300006175 | Ga0070712_101016379 | Ga0070712_1010163791 | 139 |
| 233 | 3300006175 | Ga0070712_101033260 | Ga0070712_1010332602 | 139 |
| 234 | 3300006175 | Ga0070712_101531319 | Ga0070712_1015313191 | 139 |
| 235 | 3300006358 | Ga0068871_100047366 | Ga0068871_1000473664 | 139 |
| 236 | 3300006358 | Ga0068871_100061617 | Ga0068871_1000616172 | 139 |
| 237 | 3300006358 | Ga0068871_102281082 | Ga0068871_1022810821 | 139 |
| 238 | 3300006844 | Ga0075428_100207637 | Ga0075428_1002076371 | 139 |
| 239 | 3300006844 | Ga0075428_100854350 | Ga0075428_1008543502 | 139 |
| 240 | 3300006844 | Ga0075428_101581021 | Ga0075428_1015810211 | 139 |
| 241 | 3300006852 | Ga0075433_10499338 | Ga0075433_104993382 | 139 |
| 242 | 3300006852 | Ga0075433_10573608 | Ga0075433_105736081 | 139 |
| 243 | 3300006871 | Ga0075434_100302930 | Ga0075434_1003029302 | 139 |
| 244 | 3300006871 | Ga0075434_101240908 | Ga0075434_1012409082 | 139 |
| 245 | 3300006881 | Ga0068865_100349604 | Ga0068865_1003496042 | 139 |
| 246 | 3300006881 | Ga0068865_100359298 | Ga0068865_1003592982 | 139 |
| 247 | 3300006881 | Ga0068865_100532734 | Ga0068865_1005327342 | 139 |
| 248 | 3300007788 | Ga0099795_10076169 | Ga0099795_100761692 | 139 |
| 249 | 3300009093 | Ga0105240_10243861 | Ga0105240_102438613 | 139 |
| 250 | 3300009094 | Ga0111539_12177938 | Ga0111539_121779381 | 139 |
| 251 | 3300009098 | Ga0105245_10211742 | Ga0105245_102117422 | 139 |
| 252 | 3300009098 | Ga0105245_12488820 | Ga0105245_124888201 | 139 |
| 253 | 3300009147 | Ga0114129_10059979 | Ga0114129_100599796 | 139 |
| 254 | 3300009147 | Ga0114129_10243449 | Ga0114129_102434492 | 139 |
| 255 | 3300009148 | Ga0105243_10154299 | Ga0105243_101542992 | 139 |
| 256 | 3300009174 | Ga0105241_10207277 | Ga0105241_102072772 | 139 |
| 257 | 3300009176 | Ga0105242_10123314 | Ga0105242_101233142 | 139 |
| 258 | 3300009176 | Ga0105242_10255326 | Ga0105242_102553262 | 139 |
| 259 | 3300009176 | Ga0105242_10494741 | Ga0105242_104947412 | 139 |
| 260 | 3300009176 | Ga0105242_10571873 | Ga0105242_105718732 | 139 |
| 261 | 3300009177 | Ga0105248_10233792 | Ga0105248_102337921 | 139 |
| 262 | 3300009177 | Ga0105248_10268929 | Ga0105248_102689292 | 139 |
| 263 | 3300009553 | Ga0105249_10001815 | Ga0105249_100018157 | 139 |
| 264 | 3300010375 | Ga0105239_10046832 | Ga0105239_100468325 | 139 |
| 265 | 3300010375 | Ga0105239_10165378 | Ga0105239_101653784 | 139 |
| 266 | 3300010375 | Ga0105239_10804410 | Ga0105239_108044102 | 139 |
| 267 | 3300011119 | Ga0105246_10034729 | Ga0105246_100347294 | 139 |
| 268 | 3300011119 | Ga0105246_10377561 | Ga0105246_103775611 | 139 |
| 269 | 3300013102 | Ga0157371_10193774 | Ga0157371_101937743 | 139 |
| 270 | 3300013102 | Ga0157371_10609010 | Ga0157371_106090102 | 139 |
| 271 | 3300013105 | Ga0157369_10021927 | Ga0157369_100219275 | 139 |
| 272 | 3300013105 | Ga0157369_11374019 | Ga0157369_113740191 | 139 |
| 273 | 3300013105 | Ga0157369_11630865 | Ga0157369_116308651 | 139 |
| 274 | 3300013296 | Ga0157374_10010136 | Ga0157374_100101363 | 139 |
| 275 | 3300013296 | Ga0157374_10027052 | Ga0157374_100270525 | 139 |
| 276 | 3300013296 | Ga0157374_10088988 | Ga0157374_100889884 | 139 |
| 277 | 3300013296 | Ga0157374_10110278 | Ga0157374_101102782 | 139 |
| 278 | 3300013296 | Ga0157374_10116211 | Ga0157374_101162112 | 139 |
| 279 | 3300013296 | Ga0157374_10179016 | Ga0157374_101790161 | 139 |
| 280 | 3300013296 | Ga0157374_10352127 | Ga0157374_103521271 | 139 |
| 281 | 3300013296 | Ga0157374_10630420 | Ga0157374_106304201 | 139 |
| 282 | 3300013296 | Ga0157374_11397965 | Ga0157374_113979651 | 139 |
| 283 | 3300013296 | Ga0157374_12174145 | Ga0157374_121741451 | 139 |
| 284 | 3300013297 | Ga0157378_10016630 | Ga0157378_100166306 | 139 |
| 285 | 3300013297 | Ga0157378_10027882 | Ga0157378_100278824 | 139 |
| 286 | 3300013297 | Ga0157378_10109265 | Ga0157378_101092653 | 139 |
| 287 | 3300013297 | Ga0157378_10186618 | Ga0157378_101866182 | 139 |
| 288 | 3300013297 | Ga0157378_10865934 | Ga0157378_108659342 | 139 |
| 289 | 3300013297 | Ga0157378_11309739 | Ga0157378_113097392 | 139 |
| 290 | 3300013306 | Ga0163162_10184484 | Ga0163162_101844842 | 139 |
| 291 | 3300013306 | Ga0163162_10291448 | Ga0163162_102914483 | 139 |
| 292 | 3300013306 | Ga0163162_10392324 | Ga0163162_103923242 | 139 |
| 293 | 3300013306 | Ga0163162_10531563 | Ga0163162_105315633 | 139 |
| 294 | 3300013307 | Ga0157372_10196037 | Ga0157372_101960374 | 139 |
| 295 | 3300013307 | Ga0157372_10951082 | Ga0157372_109510822 | 139 |
| 296 | 3300013307 | Ga0157372_11018018 | Ga0157372_110180181 | 139 |
| 297 | 3300013308 | Ga0157375_10014829 | Ga0157375_100148296 | 139 |
| 298 | 3300013308 | Ga0157375_10017679 | Ga0157375_100176792 | 139 |
| 299 | 3300013308 | Ga0157375_10126092 | Ga0157375_101260922 | 139 |
| 300 | 3300013308 | Ga0157375_10816712 | Ga0157375_108167122 | 139 |
| 301 | 3300013308 | Ga0157375_10822834 | Ga0157375_108228341 | 139 |
| 302 | 3300013308 | Ga0157375_11070303 | Ga0157375_110703031 | 139 |
| 303 | 3300013308 | Ga0157375_13030756 | Ga0157375_130307561 | 139 |
| 304 | 3300014325 | Ga0163163_10156937 | Ga0163163_101569373 | 139 |
| 305 | 3300014325 | Ga0163163_10250094 | Ga0163163_102500944 | 139 |
| 306 | 3300014325 | Ga0163163_10309103 | Ga0163163_103091032 | 139 |
| 307 | 3300014325 | Ga0163163_10395880 | Ga0163163_103958803 | 139 |
| 308 | 3300014325 | Ga0163163_10561221 | Ga0163163_105612211 | 139 |
| 309 | 3300014325 | Ga0163163_11673391 | Ga0163163_116733912 | 139 |
| 310 | 3300014745 | Ga0157377_10497588 | Ga0157377_104975881 | 139 |
| 311 | 3300014745 | Ga0157377_11404275 | Ga0157377_114042751 | 139 |
| 312 | 3300014968 | Ga0157379_10008472 | Ga0157379_100084727 | 139 |
| 313 | 3300014968 | Ga0157379_11477116 | Ga0157379_114771162 | 139 |
| 314 | 3300014969 | Ga0157376_10002885 | Ga0157376_100028857 | 139 |
| 315 | 3300014969 | Ga0157376_10167937 | Ga0157376_101679373 | 139 |
| 316 | 3300014969 | Ga0157376_10236780 | Ga0157376_102367802 | 139 |
| 317 | 3300014969 | Ga0157376_11218731 | Ga0157376_112187311 | 139 |
| 318 | 3300015261 | Ga0182006_1051817 | Ga0182006_10518172 | 139 |
| 319 | 3300017792 | Ga0163161_10195099 | Ga0163161_101950993 | 139 |
| 320 | 3300017792 | Ga0163161_10237874 | Ga0163161_102378742 | 139 |
| 321 | 3300017792 | Ga0163161_10682739 | Ga0163161_106827391 | 139 |
| 322 | 3300021361 | Ga0213872_10154499 | Ga0213872_101544992 | 139 |
| 323 | 3300021441 | Ga0213871_10048132 | Ga0213871_100481322 | 139 |
| 324 | 3300025271 | Ga0207666_1001723 | Ga0207666_10017232 | 139 |
| 325 | 3300025271 | Ga0207666_1004614 | Ga0207666_10046143 | 139 |
| 326 | 3300025290 | Ga0207673_1001059 | Ga0207673_10010594 | 139 |
| 327 | 3300025290 | Ga0207673_1001448 | Ga0207673_10014484 | 139 |
| 328 | 3300025315 | Ga0207697_10000492 | Ga0207697_1000049211 | 139 |
| 329 | 3300025315 | Ga0207697_10000847 | Ga0207697_1000084713 | 139 |
| 330 | 3300025315 | Ga0207697_10000853 | Ga0207697_1000085316 | 139 |
| 331 | 3300025315 | Ga0207697_10007619 | Ga0207697_100076197 | 139 |
| 332 | 3300025315 | Ga0207697_10091530 | Ga0207697_100915302 | 139 |
| 333 | 3300025315 | Ga0207697_10185478 | Ga0207697_101854781 | 139 |
| 334 | 3300025315 | Ga0207697_10260879 | Ga0207697_102608792 | 139 |
| 335 | 3300025315 | Ga0207697_10331517 | Ga0207697_103315171 | 139 |
| 336 | 3300025893 | Ga0207682_10141595 | Ga0207682_101415952 | 139 |
| 337 | 3300025898 | Ga0207692_10026824 | Ga0207692_100268241 | 139 |
| 338 | 3300025898 | Ga0207692_10363893 | Ga0207692_103638932 | 139 |
| 339 | 3300025899 | Ga0207642_10279556 | Ga0207642_102795561 | 139 |
| 340 | 3300025900 | Ga0207710_10183665 | Ga0207710_101836651 | 139 |
| 341 | 3300025901 | Ga0207688_10152626 | Ga0207688_101526261 | 139 |
| 342 | 3300025903 | Ga0207680_10075153 | Ga0207680_100751532 | 139 |
| 343 | 3300025903 | Ga0207680_10206446 | Ga0207680_102064463 | 139 |
| 344 | 3300025904 | Ga0207647_10008787 | Ga0207647_100087875 | 139 |
| 345 | 3300025904 | Ga0207647_10738956 | Ga0207647_107389561 | 139 |
| 346 | 3300025905 | Ga0207685_10048213 | Ga0207685_100482133 | 139 |
| 347 | 3300025905 | Ga0207685_10266690 | Ga0207685_102666902 | 139 |
| 348 | 3300025906 | Ga0207699_10171405 | Ga0207699_101714052 | 139 |
| 349 | 3300025906 | Ga0207699_10729406 | Ga0207699_107294062 | 139 |
| 350 | 3300025907 | Ga0207645_10003903 | Ga0207645_100039034 | 139 |
| 351 | 3300025909 | Ga0207705_10441700 | Ga0207705_104417002 | 139 |
| 352 | 3300025910 | Ga0207684_10015288 | Ga0207684_100152882 | 139 |
| 353 | 3300025910 | Ga0207684_10026449 | Ga0207684_100264494 | 139 |
| 354 | 3300025910 | Ga0207684_10033758 | Ga0207684_100337584 | 139 |
| 355 | 3300025910 | Ga0207684_10164260 | Ga0207684_101642602 | 139 |
| 356 | 3300025910 | Ga0207684_10275718 | Ga0207684_102757181 | 139 |
| 357 | 3300025910 | Ga0207684_10296810 | Ga0207684_102968102 | 139 |
| 358 | 3300025910 | Ga0207684_10545153 | Ga0207684_105451532 | 139 |
| 359 | 3300025910 | Ga0207684_11338567 | Ga0207684_113385671 | 139 |
| 360 | 3300025913 | Ga0207695_10191894 | Ga0207695_101918943 | 139 |
| 361 | 3300025915 | Ga0207693_10015725 | Ga0207693_100157254 | 139 |
| 362 | 3300025915 | Ga0207693_10125512 | Ga0207693_101255122 | 139 |
| 363 | 3300025915 | Ga0207693_10415061 | Ga0207693_104150611 | 139 |
| 364 | 3300025915 | Ga0207693_10440011 | Ga0207693_104400112 | 139 |
| 365 | 3300025915 | Ga0207693_10490407 | Ga0207693_104904072 | 139 |
| 366 | 3300025915 | Ga0207693_10617610 | Ga0207693_106176102 | 139 |
| 367 | 3300025916 | Ga0207663_10095084 | Ga0207663_100950844 | 139 |
| 368 | 3300025917 | Ga0207660_10173499 | Ga0207660_101734992 | 139 |
| 369 | 3300025919 | Ga0207657_10014378 | Ga0207657_100143785 | 139 |
| 370 | 3300025919 | Ga0207657_10674391 | Ga0207657_106743911 | 139 |
| 371 | 3300025920 | Ga0207649_10531232 | Ga0207649_105312322 | 139 |
| 372 | 3300025921 | Ga0207652_10835864 | Ga0207652_108358642 | 139 |
| 373 | 3300025922 | Ga0207646_10092278 | Ga0207646_100922784 | 139 |
| 374 | 3300025922 | Ga0207646_10107483 | Ga0207646_101074834 | 139 |
| 375 | 3300025922 | Ga0207646_10130029 | Ga0207646_101300294 | 139 |
| 376 | 3300025922 | Ga0207646_10269658 | Ga0207646_102696583 | 139 |
| 377 | 3300025922 | Ga0207646_10409251 | Ga0207646_104092512 | 139 |
| 378 | 3300025922 | Ga0207646_11570498 | Ga0207646_115704981 | 139 |
| 379 | 3300025923 | Ga0207681_11123756 | Ga0207681_111237562 | 139 |
| 380 | 3300025925 | Ga0207650_10415822 | Ga0207650_104158222 | 139 |
| 381 | 3300025926 | Ga0207659_10010798 | Ga0207659_100107985 | 139 |
| 382 | 3300025926 | Ga0207659_10121952 | Ga0207659_101219524 | 139 |
| 383 | 3300025926 | Ga0207659_10142419 | Ga0207659_101424192 | 139 |
| 384 | 3300025926 | Ga0207659_10236279 | Ga0207659_102362793 | 139 |
| 385 | 3300025927 | Ga0207687_10199172 | Ga0207687_101991721 | 139 |
| 386 | 3300025928 | Ga0207700_10040747 | Ga0207700_100407472 | 139 |
| 387 | 3300025928 | Ga0207700_10263213 | Ga0207700_102632132 | 139 |
| 388 | 3300025929 | Ga0207664_10044558 | Ga0207664_100445583 | 139 |
| 389 | 3300025929 | Ga0207664_10174683 | Ga0207664_101746831 | 139 |
| 390 | 3300025929 | Ga0207664_10358163 | Ga0207664_103581632 | 139 |
| 391 | 3300025929 | Ga0207664_10379862 | Ga0207664_103798622 | 139 |
| 392 | 3300025929 | Ga0207664_10436817 | Ga0207664_104368171 | 139 |
| 393 | 3300025931 | Ga0207644_10129660 | Ga0207644_101296602 | 139 |
| 394 | 3300025931 | Ga0207644_10205371 | Ga0207644_102053711 | 139 |
| 395 | 3300025931 | Ga0207644_10404467 | Ga0207644_104044672 | 139 |
| 396 | 3300025932 | Ga0207690_10022558 | Ga0207690_100225584 | 139 |
| 397 | 3300025932 | Ga0207690_10409252 | Ga0207690_104092522 | 139 |
| 398 | 3300025933 | Ga0207706_10030800 | Ga0207706_100308003 | 139 |
| 399 | 3300025933 | Ga0207706_10166312 | Ga0207706_101663123 | 139 |
| 400 | 3300025933 | Ga0207706_10334710 | Ga0207706_103347102 | 139 |
| 401 | 3300025934 | Ga0207686_10086831 | Ga0207686_100868312 | 139 |
| 402 | 3300025934 | Ga0207686_10155250 | Ga0207686_101552503 | 139 |
| 403 | 3300025935 | Ga0207709_10793729 | Ga0207709_107937291 | 139 |
| 404 | 3300025936 | Ga0207670_10059168 | Ga0207670_100591684 | 139 |
| 405 | 3300025936 | Ga0207670_10062818 | Ga0207670_100628184 | 139 |
| 406 | 3300025936 | Ga0207670_10232379 | Ga0207670_102323792 | 139 |
| 407 | 3300025937 | Ga0207669_10144320 | Ga0207669_101443202 | 139 |
| 408 | 3300025937 | Ga0207669_10340078 | Ga0207669_103400782 | 139 |
| 409 | 3300025937 | Ga0207669_10396243 | Ga0207669_103962432 | 139 |
| 410 | 3300025938 | Ga0207704_10079830 | Ga0207704_100798301 | 139 |
| 411 | 3300025938 | Ga0207704_10085054 | Ga0207704_100850544 | 139 |
| 412 | 3300025938 | Ga0207704_10450138 | Ga0207704_104501382 | 139 |
| 413 | 3300025939 | Ga0207665_10033942 | Ga0207665_100339422 | 139 |
| 414 | 3300025939 | Ga0207665_10037908 | Ga0207665_100379082 | 139 |
| 415 | 3300025939 | Ga0207665_10044599 | Ga0207665_100445992 | 139 |
| 416 | 3300025939 | Ga0207665_10105541 | Ga0207665_101055412 | 139 |
| 417 | 3300025939 | Ga0207665_10140210 | Ga0207665_101402102 | 139 |
| 418 | 3300025939 | Ga0207665_10169394 | Ga0207665_101693942 | 139 |
| 419 | 3300025939 | Ga0207665_10201983 | Ga0207665_102019832 | 139 |
| 420 | 3300025939 | Ga0207665_11095950 | Ga0207665_110959501 | 139 |
| 421 | 3300025940 | Ga0207691_10007809 | Ga0207691_100078096 | 139 |
| 422 | 3300025940 | Ga0207691_10031554 | Ga0207691_100315543 | 139 |
| 423 | 3300025941 | Ga0207711_11555680 | Ga0207711_115556802 | 139 |
| 424 | 3300025942 | Ga0207689_10259595 | Ga0207689_102595951 | 139 |
| 425 | 3300025942 | Ga0207689_10494740 | Ga0207689_104947401 | 139 |
| 426 | 3300025944 | Ga0207661_10189109 | Ga0207661_101891091 | 139 |
| 427 | 3300025945 | Ga0207679_10071936 | Ga0207679_100719362 | 139 |
| 428 | 3300025960 | Ga0207651_10002389 | Ga0207651_100023897 | 139 |
| 429 | 3300025960 | Ga0207651_11203818 | Ga0207651_112038181 | 139 |
| 430 | 3300025961 | Ga0207712_10007194 | Ga0207712_100071947 | 139 |
| 431 | 3300025961 | Ga0207712_10120200 | Ga0207712_101202003 | 139 |
| 432 | 3300025972 | Ga0207668_10197579 | Ga0207668_101975792 | 139 |
| 433 | 3300025972 | Ga0207668_10411507 | Ga0207668_104115072 | 139 |
| 434 | 3300025972 | Ga0207668_10703360 | Ga0207668_107033601 | 139 |
| 435 | 3300025981 | Ga0207640_10297143 | Ga0207640_102971433 | 139 |
| 436 | 3300025986 | Ga0207658_10204440 | Ga0207658_102044402 | 139 |
| 437 | 3300026023 | Ga0207677_10036468 | Ga0207677_100364681 | 139 |
| 438 | 3300026035 | Ga0207703_10064701 | Ga0207703_100647011 | 139 |
| 439 | 3300026035 | Ga0207703_10219430 | Ga0207703_102194302 | 139 |
| 440 | 3300026035 | Ga0207703_11428483 | Ga0207703_114284831 | 139 |
| 441 | 3300026067 | Ga0207678_10225600 | Ga0207678_102256001 | 139 |
| 442 | 3300026067 | Ga0207678_10785970 | Ga0207678_107859702 | 139 |
| 443 | 3300026067 | Ga0207678_11124147 | Ga0207678_111241472 | 139 |
| 444 | 3300026075 | Ga0207708_10016626 | Ga0207708_100166261 | 139 |
| 445 | 3300026078 | Ga0207702_10153532 | Ga0207702_101535322 | 139 |
| 446 | 3300026088 | Ga0207641_10021172 | Ga0207641_100211728 | 139 |
| 447 | 3300026088 | Ga0207641_10068173 | Ga0207641_100681732 | 139 |
| 448 | 3300026088 | Ga0207641_10159905 | Ga0207641_101599053 | 139 |
| 449 | 3300026095 | Ga0207676_10437281 | Ga0207676_104372812 | 139 |
| 450 | 3300026095 | Ga0207676_10782792 | Ga0207676_107827922 | 139 |
| 451 | 3300026095 | Ga0207676_11771272 | Ga0207676_117712721 | 139 |
| 452 | 3300026116 | Ga0207674_12090740 | Ga0207674_120907401 | 139 |
| 453 | 3300026118 | Ga0207675_100105591 | Ga0207675_1001055911 | 139 |
| 454 | 3300026121 | Ga0207683_10006047 | Ga0207683_100060473 | 139 |
| 455 | 3300026121 | Ga0207683_10034795 | Ga0207683_100347953 | 139 |
| 456 | 3300027617 | Ga0210002_1057659 | Ga0210002_10576592 | 139 |
| 457 | 3300028379 | Ga0268266_10011660 | Ga0268266_100116604 | 139 |
| 458 | 3300028379 | Ga0268266_10323481 | Ga0268266_103234812 | 139 |
| 459 | 3300028379 | Ga0268266_10960691 | Ga0268266_109606911 | 139 |
| 460 | 3300028381 | Ga0268264_10187010 | Ga0268264_101870103 | 139 |
| 461 | 3300035111 | Ga0373923_0120469 | Ga0373923_0120469_439_858 | 139 |
| 462 | 3300035117 | Ga0373953_0514098 | Ga0373953_0514098_24_449 | 139 |
| 463 | 3300035118 | Ga0373954_0243106 | Ga0373954_0243106_423_842 | 139 |
| 464 | 3300035170 | Ga0373943_0178297 | Ga0373943_0178297_528_947 | 139 |
| 465 | 3300035170 | Ga0373943_0724070 | Ga0373943_0724070_115_534 | 139 |
| 466 | 3300035171 | Ga0373946_0158184 | Ga0373946_0158184_323_742 | 139 |
| 467 | 3300035171 | Ga0373946_0472198 | Ga0373946_0472198_105_524 | 139 |
| 468 | 3300035172 | Ga0373955_0957777 | Ga0373955_0957777_27_446 | 139 |
| 469 | 3300035410 | Ga0373924_0041031 | Ga0373924_0041031_270_689 | 139 |
| 470 | 3300035692 | Ga0373935_0377100 | Ga0373935_0377100_457_876 | 139 |
| 471 | 3300035695 | Ga0373927_0018960 | Ga0373927_0018960_1941_2360 | 139 |
| 472 | 3300035724 | Ga0373933_0226629 | Ga0373933_0226629_635_1054 | 139 |
| 473 | 3300035725 | Ga0373947_0012308 | Ga0373947_0012308_1475_1894 | 139 |
| 474 | 3300035725 | Ga0373947_0033537 | Ga0373947_0033537_2031_2450 | 139 |
| 475 | 3300035725 | Ga0373947_0236747 | Ga0373947_0236747_137_556 | 139 |
| 476 | 3300035725 | Ga0373947_0523939 | Ga0373947_0523939_216_635 | 139 |
| 477 | 3300036401 | Ga0373937_0331845 | Ga0373937_0331845_165_584 | 139 |
| 478 | 3300036401 | Ga0373937_0610467 | Ga0373937_0610467_581_1000 | 139 |
| 479 | 3300037068 | Ga0373925_0307298 | Ga0373925_0307298_267_686 | 139 |
| 480 | 3300037068 | Ga0373925_0334314 | Ga0373925_0334314_319_738 | 139 |
| 481 | 3300037068 | Ga0373925_1284742 | Ga0373925_1284742_143_562 | 139 |
| 482 | 3300037312 | Ga0395899_0371354 | Ga0395899_0371354_116_535 | 139 |
| 483 | 3300037312 | Ga0395899_0534649 | Ga0395899_0534649_276_695 | 139 |
| 484 | 3300037418 | Ga0395900_0007923 | Ga0395900_0007923_2168_2587 | 139 |
| 485 | 3300037418 | Ga0395900_0278889 | Ga0395900_0278889_118_537 | 139 |
| 486 | 3300037418 | Ga0395900_0518773 | Ga0395900_0518773_366_785 | 139 |
| 487 | 3300037418 | Ga0395900_1024403 | Ga0395900_1024403_211_630 | 139 |
| 488 | 3300037418 | Ga0395900_1079864 | Ga0395900_1079864_236_655 | 139 |
| 489 | 3300037466 | Ga0395898_0077009 | Ga0395898_0077009_1586_2005 | 139 |
| 490 | 3300037471 | Ga0395905_0203670 | Ga0395905_0203670_962_1381 | 139 |
| 491 | 3300038443 | Ga0395901_0154466 | Ga0395901_0154466_600_1019 | 139 |
| 492 | 3300038443 | Ga0395901_0660134 | Ga0395901_0660134_189_608 | 139 |
| 493 | 3300038443 | Ga0395901_0956638 | Ga0395901_0956638_372_791 | 139 |
| 494 | 3300038443 | Ga0395901_1875084 | Ga0395901_1875084_50_469 | 139 |
| 495 | 3300039438 | Ga0436360_0402730 | Ga0436360_0402730_1069_1497 | 139 |
| 496 | 3300039447 | Ga0436361_0303249 | Ga0436361_0303249_339_767 | 139 |
| 497 | 3300039447 | Ga0436361_0675134 | Ga0436361_0675134_210_638 | 139 |
| 498 | 3300039453 | Ga0436362_0977882 | Ga0436362_0977882_34_462 | 139 |
| 499 | 3300041486 | Ga0451807_0288746 | Ga0451807_0288746_202_621 | 139 |
| 500 | 3300041496 | Ga0451839_0639711 | Ga0451839_0639711_89_508 | 139 |
| 501 | 3300041512 | Ga0451853_3880816 | Ga0451853_3880816_125_544 | 139 |
| 502 | 3300042012 | Ga0439455_0036557 | Ga0439455_0036557_19_438 | 139 |
| 503 | 3300042157 | Ga0439458_0031886 | Ga0439458_0031886_113_532 | 139 |
| 504 | 3300042439 | Ga0439464_0133285 | Ga0439464_0133285_42_461 | 139 |
| 505 | 3300044706 | Ga0466964_0020842 | Ga0466964_0020842_853_1272 | 139 |
| 506 | 3300045976 | Ga0466967_0630308 | Ga0466967_0630308_61_480 | 139 |
| 507 | 3300046454 | Ga0495592_0094157 | Ga0495592_0094157_452_871 | 139 |
| 508 | 3300046455 | Ga0495603_0294268 | Ga0495603_0294268_492_911 | 139 |
| 509 | 3300046462 | Ga0495651_0177862 | Ga0495651_0177862_191_610 | 139 |
| 510 | 3300046472 | Ga0495580_0356275 | Ga0495580_0356275_101_520 | 139 |
| 511 | 3300046477 | Ga0495664_0330672 | Ga0495664_0330672_31_456 | 139 |
| 512 | 3300046491 | Ga0495584_0488180 | Ga0495584_0488180_171_590 | 139 |
| 513 | 3300046514 | Ga0495618_0128958 | Ga0495618_0128958_535_954 | 139 |
| 514 | 3300046514 | Ga0495618_0166494 | Ga0495618_0166494_180_599 | 139 |
| 515 | 3300046516 | Ga0495628_0848646 | Ga0495628_0848646_202_621 | 139 |
| 516 | 3300046517 | Ga0495630_0293699 | Ga0495630_0293699_708_1127 | 139 |
| 517 | 3300046517 | Ga0495630_0449651 | Ga0495630_0449651_449_868 | 139 |
| 518 | 3300046526 | Ga0495666_0450432 | Ga0495666_0450432_103_522 | 139 |
| 519 | 3300046529 | Ga0495652_0132881 | Ga0495652_0132881_403_822 | 139 |
| 520 | 3300046529 | Ga0495652_0149726 | Ga0495652_0149726_1017_1436 | 139 |
| 521 | 3300046533 | Ga0495640_0285760 | Ga0495640_0285760_336_755 | 139 |
| 522 | 3300046535 | Ga0495586_0799963 | Ga0495586_0799963_107_526 | 139 |
| 523 | 3300046536 | Ga0495587_0067299 | Ga0495587_0067299_446_865 | 139 |
| 524 | 3300046543 | Ga0495645_0314674 | Ga0495645_0314674_40_459 | 139 |
| 525 | 3300046559 | Ga0495667_0215407 | Ga0495667_0215407_15_434 | 139 |
| 526 | 3300046642 | Ga0495634_0008725 | Ga0495634_0008725_881_1300 | 139 |
| 527 | 3300046642 | Ga0495634_0094397 | Ga0495634_0094397_253_672 | 139 |
| 528 | 3300046642 | Ga0495634_0837337 | Ga0495634_0837337_35_454 | 139 |
| 529 | 3300046663 | Ga0495635_0799286 | Ga0495635_0799286_49_468 | 139 |
| 530 | 3300046678 | Ga0495599_0289130 | Ga0495599_0289130_433_852 | 139 |
| 531 | 3300046680 | Ga0495646_0054827 | Ga0495646_0054827_198_617 | 139 |
| 532 | 3300046681 | Ga0495647_0427619 | Ga0495647_0427619_59_478 | 139 |
| 533 | 3300046684 | Ga0495669_0190931 | Ga0495669_0190931_250_669 | 139 |
| 534 | 3300046689 | Ga0495613_0094429 | Ga0495613_0094429_64_483 | 139 |
| 535 | 3300046690 | Ga0495624_0622761 | Ga0495624_0622761_87_506 | 139 |
| 536 | 3300047315 | Ga0495581_0325631 | Ga0495581_0325631_270_689 | 139 |
| 537 | 3300047317 | Ga0495604_0369233 | Ga0495604_0369233_10_429 | 139 |
| 538 | 3300047319 | Ga0495674_0082451 | Ga0495674_0082451_589_1008 | 139 |
| 539 | 3300047321 | Ga0495676_0425230 | Ga0495676_0425230_31_450 | 139 |
| 540 | 3300047444 | Ga0495675_0366542 | Ga0495675_0366542_269_688 | 139 |
| 541 | 3300047471 | Ga0495684_0011845 | Ga0495684_0011845_6106_6525 | 139 |
| 542 | 3300048091 | Ga0495626_0343195 | Ga0495626_0343195_45_464 | 139 |
| 543 | 3300048903 | Ga0496100_0022890 | Ga0496100_0022890_814_1233 | 139 |
| 544 | 3300048903 | Ga0496100_0070022 | Ga0496100_0070022_221_664 | 139 |
| 545 | 3300048903 | Ga0496100_0540150 | Ga0496100_0540150_361_780 | 139 |
| 546 | 3300048904 | Ga0496101_0049432 | Ga0496101_0049432_806_1249 | 139 |
| 547 | 3300048904 | Ga0496101_0092567 | Ga0496101_0092567_269_688 | 139 |
| 548 | 3300048904 | Ga0496101_0116016 | Ga0496101_0116016_447_866 | 139 |
| 549 | 3300048905 | Ga0496102_0057758 | Ga0496102_0057758_1946_2365 | 139 |
| 550 | 3300048905 | Ga0496102_0087107 | Ga0496102_0087107_1079_1498 | 139 |
| 551 | 3300048905 | Ga0496102_0233602 | Ga0496102_0233602_511_930 | 139 |
| 552 | 3300048906 | Ga0496103_0096373 | Ga0496103_0096373_1008_1427 | 139 |
| 553 | 3300048906 | Ga0496103_0361681 | Ga0496103_0361681_251_670 | 139 |
| 554 | 3300048907 | Ga0496104_0075583 | Ga0496104_0075583_447_866 | 139 |
| 555 | 3300048907 | Ga0496104_0234752 | Ga0496104_0234752_459_878 | 139 |
| 556 | 3300048907 | Ga0496104_0248553 | Ga0496104_0248553_159_578 | 139 |
| 557 | 3300048907 | Ga0496104_0781579 | Ga0496104_0781579_304_741 | 139 |
| 558 | 3300048907 | Ga0496104_1058154 | Ga0496104_1058154_161_580 | 139 |
| 559 | 3300048908 | Ga0496105_0190840 | Ga0496105_0190840_957_1376 | 139 |
| 560 | 3300048908 | Ga0496105_0225263 | Ga0496105_0225263_887_1306 | 139 |
| 561 | 3300048909 | Ga0496106_0023752 | Ga0496106_0023752_3286_3705 | 139 |
| 562 | 3300048909 | Ga0496106_0267467 | Ga0496106_0267467_589_1008 | 139 |
| 563 | 3300048909 | Ga0496106_0859351 | Ga0496106_0859351_203_622 | 139 |
| 564 | 3300048910 | Ga0496107_0058247 | Ga0496107_0058247_205_624 | 139 |
| 565 | 3300048911 | Ga0496108_0072226 | Ga0496108_0072226_885_1322 | 139 |
| 566 | 3300048911 | Ga0496108_0094907 | Ga0496108_0094907_1901_2320 | 139 |
| 567 | 3300048911 | Ga0496108_0146407 | Ga0496108_0146407_963_1406 | 139 |
| 568 | 3300048911 | Ga0496108_0822476 | Ga0496108_0822476_35_454 | 139 |
| 569 | 3300048912 | Ga0496109_0025522 | Ga0496109_0025522_4331_4750 | 139 |
| 570 | 3300048912 | Ga0496109_0360706 | Ga0496109_0360706_361_780 | 139 |
| 571 | 3300048912 | Ga0496109_0976852 | Ga0496109_0976852_143_580 | 139 |
| 572 | 3300048913 | Ga0496110_0010931 | Ga0496110_0010931_1569_1988 | 139 |
| 573 | 3300048913 | Ga0496110_0785402 | Ga0496110_0785402_282_701 | 139 |
| 574 | 3300048913 | Ga0496110_1097942 | Ga0496110_1097942_155_574 | 139 |
| 575 | 3300048914 | Ga0496111_0074781 | Ga0496111_0074781_1657_2076 | 139 |
| 576 | 3300048914 | Ga0496111_0178737 | Ga0496111_0178737_265_684 | 139 |
| 577 | 3300048915 | Ga0496112_0025752 | Ga0496112_0025752_2471_2890 | 139 |
| 578 | 3300048915 | Ga0496112_0209813 | Ga0496112_0209813_52_471 | 139 |
| 579 | 3300048915 | Ga0496112_0317332 | Ga0496112_0317332_157_576 | 139 |
| 580 | 3300048915 | Ga0496112_0384537 | Ga0496112_0384537_400_819 | 139 |
| 581 | 3300048915 | Ga0496112_0533042 | Ga0496112_0533042_135_554 | 139 |
| 582 | 3300048916 | Ga0496113_0359759 | Ga0496113_0359759_24_443 | 139 |
| 583 | 3300048916 | Ga0496113_0382520 | Ga0496113_0382520_300_719 | 139 |
| 584 | 3300048916 | Ga0496113_0472160 | Ga0496113_0472160_485_904 | 139 |
| 585 | 3300048917 | Ga0496114_0029846 | Ga0496114_0029846_3973_4392 | 139 |
| 586 | 3300048917 | Ga0496114_0045336 | Ga0496114_0045336_955_1374 | 139 |
| 587 | 3300048918 | Ga0496115_0005912 | Ga0496115_0005912_7377_7796 | 139 |
| 588 | 3300048918 | Ga0496115_0023024 | Ga0496115_0023024_2358_2777 | 139 |
| 589 | 3300048918 | Ga0496115_0231002 | Ga0496115_0231002_537_956 | 139 |
| 590 | 3300048918 | Ga0496115_0361137 | Ga0496115_0361137_513_932 | 139 |
| 591 | 3300048918 | Ga0496115_0526085 | Ga0496115_0526085_482_901 | 139 |
| 592 | 3300049583 | Ga0501067_0255745 | Ga0501067_0255745_89_508 | 139 |
| 593 | 3300049744 | Ga0501083_0013400 | Ga0501083_0013400_1674_2093 | 139 |
| 594 | 3300050507 | nmdc:mga05p37_224020_c1 | nmdc:mga05p37_224020_c1_117_536 | 139 |
| 595 | 3300050507 | nmdc:mga05p37_454619_c1 | nmdc:mga05p37_454619_c1_523_966 | 139 |
| 596 | 3300050507 | nmdc:mga05p37_53994_c1 | nmdc:mga05p37_53994_c1_2895_3314 | 139 |
| 597 | 3300050512 | nmdc:mga0n895_190623_c1 | nmdc:mga0n895_190623_c1_1563_1982 | 139 |
| 598 | 3300050512 | nmdc:mga0n895_768737_c1 | nmdc:mga0n895_768737_c1_494_913 | 139 |
| 599 | 3300050513 | nmdc:mga0rr50_1411580_c1 | nmdc:mga0rr50_1411580_c1_96_515 | 139 |
| 600 | 3300050515 | nmdc:mga0a205_622459_c1 | nmdc:mga0a205_622459_c1_30_449 | 139 |
| 601 | 3300050515 | nmdc:mga0a205_634115_c1 | nmdc:mga0a205_634115_c1_192_611 | 139 |
| 602 | 3300053085 | Ga0495619_0496329 | Ga0495619_0496329_288_707 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vmf-assembly1.cif.gz_C | crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution | 0.9504 | 5 | 139 |
| 1vmh-assembly1.cif.gz_A | crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution | 0.9496 | 6 | 137 |
| 1vph-assembly2.cif.gz_E | crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution | 0.9458 | 2 | 139 |
| 2cu5-assembly1.cif.gz_C | crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 | 0.937 | 6 | 137 |
| 1ve0-assembly1.cif.gz_A | crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii | 0.9362 | 1 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vphC00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.944 | 3 | 139 | 2.60.120.460 |
| 2cu5A00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9363 | 5 | 137 | 2.60.120.460 |
| 1ve0A00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9314 | 2 | 139 | 2.60.120.460 |
| af_P0AF48_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9253 | 2 | 139 | 2.60.120.460 |
| af_O14155_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9251 | 1 | 138 | 2.60.120.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6A5S9-F1-model_v4 | YjbQ family protein | 0.9789 | 1 | 139 |
|
| AF-A0A838MZW0-F1-model_v4 | YjbQ family protein | 0.978 | 1 | 139 |
|
| AF-V5SFJ0-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9757 | 3 | 139 |
|
| AF-H1G2P0-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9752 | 1 | 139 |
|
| AF-A0A2V5S9A0-F1-model_v4 | YjbQ family protein | 0.9751 | 1 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar