F468142

General Info

Members Datasets Scaffolds Average Seq Length
602 254 602 76

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100614667|Ga0070673_1006146671
Length 90
Sequence MTIRTEYIHPERTISSMARLIRMDDTGHTTLAEWTAADEPAVEAAVTAFREQLDAGFYAVVTEGEGRARQVDELPLDAELVILRRPIAGG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 4.49
Rhizosphere 92.69
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10333507 3300003323 Bacteria 1960
2 Ga0070683_100233257 3300005329 Unclassified 1750
3 Ga0070683_100287663 3300005329 Bacteria 1563
4 Ga0068869_101276996 3300005334 Unclassified 647
5 Ga0070666_10768017 3300005335 Bacteria 709
6 Ga0070682_100154423 3300005337 Bacteria 1578
7 Ga0070682_100305137 3300005337 Bacteria 1170
8 Ga0070682_101349528 3300005337 Bacteria 608
9 Ga0070682_101588569 3300005337 Unclassified 565
10 Ga0068868_100175694 3300005338 Bacteria 1775
11 Ga0068868_100176256 3300005338 Bacteria 1772
12 Ga0068868_100239924 3300005338 Bacteria 1522
13 Ga0070660_100113264 3300005339 Bacteria 2160
14 Ga0070660_101331123 3300005339 Unclassified 610
15 Ga0070660_101472653 3300005339 Bacteria 579
16 Ga0070660_101498226 3300005339 Unclassified 574
17 Ga0070660_101696027 3300005339 Bacteria 538
18 Ga0070689_100851435 3300005340 Bacteria 804
19 Ga0070691_10158158 3300005341 Bacteria 1166
20 Ga0070691_10605189 3300005341 Bacteria 647
21 Ga0070691_10884417 3300005341 Bacteria 550
22 Ga0070687_100184666 3300005343 Unclassified 1252
23 Ga0070687_100210027 3300005343 Bacteria 1185
24 Ga0070687_101011921 3300005343 Unclassified 603
25 Ga0070661_100824447 3300005344 Bacteria 762
26 Ga0070661_101521559 3300005344 Bacteria 565
27 Ga0070692_10180965 3300005345 Bacteria 1222
28 Ga0070692_10293129 3300005345 Bacteria 991
29 Ga0070692_10403831 3300005345 Bacteria 863
30 Ga0070692_10771532 3300005345 Bacteria 654
31 Ga0070668_100295685 3300005347 Bacteria 1357
32 Ga0070668_100367106 3300005347 Bacteria 1222
33 Ga0070669_100763125 3300005353 Bacteria 820
34 Ga0070675_100864872 3300005354 Bacteria 828
35 Ga0070675_101276152 3300005354 Bacteria 677
36 Ga0070671_101353519 3300005355 Bacteria 628
37 Ga0070674_100621895 3300005356 Bacteria 915
38 Ga0070673_100614667 3300005364 Bacteria 992
39 Ga0070673_102380166 3300005364 Bacteria 503
40 Ga0070659_100390397 3300005366 Bacteria 1174
41 Ga0070659_100960899 3300005366 Bacteria 749
42 Ga0070710_10618161 3300005437 Bacteria 756
43 Ga0070701_10955119 3300005438 Bacteria 595
44 Ga0070711_100008029 3300005439 Bacteria 6443
45 Ga0070705_100189233 3300005440 Bacteria 1401
46 Ga0070705_100574918 3300005440 Unclassified 868
47 Ga0070705_101689488 3300005440 Unclassified 535
48 Ga0070705_101861195 3300005440 Bacteria 511
49 Ga0070700_100288099 3300005441 Bacteria 1193
50 Ga0070700_100940282 3300005441 Bacteria 707
51 Ga0070708_100925750 3300005445 Bacteria 818
52 Ga0070663_100128433 3300005455 Bacteria 1922
53 Ga0070663_100264277 3300005455 Bacteria 1366
54 Ga0070663_100652953 3300005455 Bacteria 890
55 Ga0070663_102128393 3300005455 Bacteria 506
56 Ga0070678_100032452 3300005456 Bacteria 3615
57 Ga0070678_100335807 3300005456 Bacteria 1295
58 Ga0070678_101389577 3300005456 Bacteria 655
59 Ga0070662_100341035 3300005457 Bacteria 1226
60 Ga0070662_100520608 3300005457 Bacteria 994
61 Ga0070662_101062227 3300005457 Bacteria 694
62 Ga0070681_10107611 3300005458 Bacteria 2728
63 Ga0070681_11264274 3300005458 Bacteria 661
64 Ga0068867_100061715 3300005459 Bacteria 2784
65 Ga0068867_100062732 3300005459 Bacteria 2762
66 Ga0068867_100955038 3300005459 Bacteria 774
67 Ga0070685_10680817 3300005466 Bacteria 748
68 Ga0070685_10683845 3300005466 Bacteria 747
69 Ga0070706_100278167 3300005467 Bacteria 1562
70 Ga0070679_101499915 3300005530 Bacteria 621
71 Ga0070679_101877429 3300005530 Unclassified 548
72 Ga0070684_100447717 3300005535 Bacteria 1193
73 Ga0070684_101478993 3300005535 Bacteria 640
74 Ga0068853_100328897 3300005539 Bacteria 1418
75 Ga0070672_101009067 3300005543 Bacteria 738
76 Ga0070672_101219448 3300005543 Bacteria 671
77 Ga0070672_101347507 3300005543 Bacteria 638
78 Ga0070686_100073861 3300005544 Bacteria 2240
79 Ga0070695_100480876 3300005545 Bacteria 957
80 Ga0070693_100405249 3300005547 Bacteria 947
81 Ga0070665_100244411 3300005548 Bacteria 1795
82 Ga0070665_100866631 3300005548 Bacteria 916
83 Ga0070704_100053691 3300005549 Bacteria 2849
84 Ga0070704_100614175 3300005549 Bacteria 957
85 Ga0070704_101808139 3300005549 Unclassified 565
86 Ga0070664_100140859 3300005564 Bacteria 2123
87 Ga0070664_101685351 3300005564 Bacteria 601
88 Ga0068857_100203811 3300005577 Bacteria 1804
89 Ga0068857_101435205 3300005577 Bacteria 672
90 Ga0068854_100235104 3300005578 Bacteria 1456
91 Ga0068854_100692911 3300005578 Bacteria 879
92 Ga0070702_100443106 3300005615 Bacteria 940
93 Ga0070702_100568135 3300005615 Bacteria 845
94 Ga0070702_100632495 3300005615 Bacteria 807
95 Ga0068852_100178067 3300005616 Bacteria 1998
96 Ga0068852_100632185 3300005616 Bacteria 1077
97 Ga0068852_102214717 3300005616 Bacteria 571
98 Ga0068852_102826375 3300005616 Bacteria 504
99 Ga0068859_100996757 3300005617 Bacteria 920
100 Ga0068864_100080512 3300005618 Bacteria 2854
101 Ga0068864_101765786 3300005618 Bacteria 624
102 Ga0068864_102415237 3300005618 Bacteria 532
103 Ga0068866_10175648 3300005718 Bacteria 1261
104 Ga0068866_10247705 3300005718 Bacteria 1088
105 Ga0068866_10431993 3300005718 Bacteria 857
106 Ga0068866_10931215 3300005718 Bacteria 613
107 Ga0068861_100056451 3300005719 Bacteria 2998
108 Ga0068861_101502755 3300005719 Bacteria 661
109 Ga0068870_10174651 3300005840 Bacteria 1285
110 Ga0068870_10238232 3300005840 Bacteria 1122
111 Ga0068870_10293941 3300005840 Bacteria 1023
112 Ga0068870_10302013 3300005840 Bacteria 1011
113 Ga0068863_101154704 3300005841 Unclassified 780
114 Ga0068858_100363732 3300005842 Bacteria 1387
115 Ga0068858_100572527 3300005842 Unclassified 1094
116 Ga0068860_100716491 3300005843 Bacteria 1011
117 Ga0081455_10171666 3300005937 Bacteria 1651
118 Ga0081455_10218560 3300005937 Bacteria 1414
119 Ga0081538_10000010 3300005981 Bacteria 164857
120 Ga0081538_10000782 3300005981 Bacteria 34716
121 Ga0081538_10001106 3300005981 Bacteria 28562
122 Ga0081538_10005959 3300005981 Bacteria 10848
123 Ga0081538_10031100 3300005981 Bacteria 3609
124 Ga0081538_10034278 3300005981 Bacteria 3358
125 Ga0081538_10080990 3300005981 Bacteria 1729
126 Ga0081538_10146118 3300005981 Bacteria 1080
127 Ga0081538_10168441 3300005981 Bacteria 960
128 Ga0081539_10004209 3300005985 Bacteria 16230
129 Ga0081539_10029416 3300005985 Bacteria 3432
130 Ga0070717_10001893 3300006028 Bacteria 14637
131 Ga0075365_10004732 3300006038 Bacteria 7260
132 Ga0075365_10021624 3300006038 Bacteria 4015
133 Ga0075364_10036804 3300006051 Bacteria 3166
134 Ga0075432_10561442 3300006058 Bacteria 517
135 Ga0070716_100234448 3300006173 Bacteria 1241
136 Ga0070712_100016970 3300006175 Bacteria 4707
137 Ga0075367_10633629 3300006178 Bacteria 680
138 Ga0097621_100479618 3300006237 Bacteria 1124
139 Ga0097621_101698862 3300006237 Bacteria 601
140 Ga0075428_100026541 3300006844 Bacteria 6411
141 Ga0075428_100696018 3300006844 Bacteria 1083
142 Ga0075428_102609958 3300006844 Bacteria 516
143 Ga0075430_100771021 3300006846 Bacteria 793
144 Ga0075431_100000718 3300006847 Bacteria 28538
145 Ga0075431_100664385 3300006847 Bacteria 1022
146 Ga0075431_101848983 3300006847 Bacteria 560
147 Ga0075433_10863256 3300006852 Bacteria 790
148 Ga0075433_10927013 3300006852 Bacteria 759
149 Ga0075434_100450650 3300006871 Bacteria 1308
150 Ga0075434_100452000 3300006871 Bacteria 1306
151 Ga0075429_101760500 3300006880 Bacteria 538
152 Ga0068865_100069528 3300006881 Bacteria 2491
153 Ga0068865_100397582 3300006881 Bacteria 1128
154 Ga0068865_101287418 3300006881 Bacteria 650
155 Ga0075436_100331083 3300006914 Bacteria 1095
156 Ga0097620_100996746 3300006931 Bacteria 920
157 Ga0075435_101257917 3300007076 Bacteria 648
158 Ga0105240_11778623 3300009093 Bacteria 642
159 Ga0111539_10006858 3300009094 Bacteria 14633
160 Ga0111539_10081910 3300009094 Bacteria 3796
161 Ga0111539_10444345 3300009094 Bacteria 1510
162 Ga0111539_10604637 3300009094 Bacteria 1277
163 Ga0111539_11112596 3300009094 Bacteria 918
164 Ga0111539_11271591 3300009094 Bacteria 854
165 Ga0111539_12826634 3300009094 Bacteria 562
166 Ga0105245_10002619 3300009098 Bacteria 16206
167 Ga0105245_10046340 3300009098 Bacteria 3885
168 Ga0105245_10124790 3300009098 Bacteria 2408
169 Ga0105247_10123331 3300009101 Bacteria 1681
170 Ga0105247_10377833 3300009101 Bacteria 1004
171 Ga0105247_11235890 3300009101 Bacteria 597
172 Ga0114129_11251418 3300009147 Unclassified 922
173 Ga0105243_10058843 3300009148 Bacteria 3064
174 Ga0105243_10143939 3300009148 Bacteria 2037
175 Ga0105243_10176276 3300009148 Bacteria 1856
176 Ga0105243_10834752 3300009148 Bacteria 911
177 Ga0105243_11497594 3300009148 Bacteria 698
178 Ga0105243_11590347 3300009148 Bacteria 680
179 Ga0105242_10080370 3300009176 Bacteria 2724
180 Ga0105242_10468908 3300009176 Bacteria 1191
181 Ga0105242_11007867 3300009176 Bacteria 841
182 Ga0105242_12704626 3300009176 Bacteria 546
183 Ga0105248_10490741 3300009177 Bacteria 1384
184 Ga0105237_11075869 3300009545 Bacteria 811
185 Ga0105238_11739644 3300009551 Bacteria 655
186 Ga0105249_10365507 3300009553 Bacteria 1465
187 Ga0105249_12584839 3300009553 Bacteria 580
188 Ga0105239_10111962 3300010375 Bacteria 3026
189 Ga0105239_11057780 3300010375 Bacteria 934
190 Ga0105239_11062540 3300010375 Unclassified 932
191 Ga0105239_11916002 3300010375 Unclassified 687
192 Ga0105246_10075007 3300011119 Bacteria 2393
193 Ga0105246_11924362 3300011119 Bacteria 568
194 Ga0105246_11975120 3300011119 Unclassified 562
195 Ga0157341_1040465 3300012494 Bacteria 538
196 Ga0157369_10911739 3300013105 Bacteria 901
197 Ga0157374_10236147 3300013296 Bacteria 1797
198 Ga0157378_10339362 3300013297 Bacteria 1465
199 Ga0157378_12879603 3300013297 Bacteria 533
200 Ga0163162_10413045 3300013306 Bacteria 1482
201 Ga0163162_10530322 3300013306 Bacteria 1307
202 Ga0157372_11524261 3300013307 Unclassified 770
203 Ga0157372_12310794 3300013307 Unclassified 618
204 Ga0157372_12675987 3300013307 Bacteria 572
205 Ga0157372_13406497 3300013307 Bacteria 506
206 Ga0157375_10134499 3300013308 Bacteria 2594
207 Ga0157375_11334397 3300013308 Bacteria 844
208 Ga0157375_11920527 3300013308 Unclassified 703
209 Ga0163163_10317158 3300014325 Bacteria 1612
210 Ga0163163_12170012 3300014325 Bacteria 615
211 Ga0157380_10543260 3300014326 Bacteria 1138
212 Ga0157380_10967145 3300014326 Bacteria 882
213 Ga0182008_10426634 3300014497 Bacteria 717
214 Ga0157377_10136351 3300014745 Unclassified 1504
215 Ga0157379_11358610 3300014968 Bacteria 688
216 Ga0157376_10695904 3300014969 Bacteria 1021
217 Ga0157376_10860262 3300014969 Bacteria 923
218 Ga0163161_11084281 3300017792 Bacteria 688
219 Ga0163161_11260956 3300017792 Bacteria 641
220 Ga0197907_10086063 3300020069 Bacteria 813
221 Ga0206356_11727012 3300020070 Bacteria 644
222 Ga0213876_10435798 3300021384 Unclassified 697
223 Ga0213875_10646476 3300021388 Unclassified 512
224 Ga0224712_10296668 3300022467 Bacteria 755
225 Ga0224712_10325422 3300022467 Unclassified 723
226 Ga0207653_10119085 3300025885 Bacteria 949
227 Ga0207692_10363199 3300025898 Bacteria 895
228 Ga0207642_10083047 3300025899 Bacteria 1561
229 Ga0207642_10122079 3300025899 Bacteria 1346
230 Ga0207642_10696455 3300025899 Bacteria 640
231 Ga0207642_11102574 3300025899 Bacteria 513
232 Ga0207710_10417382 3300025900 Bacteria 690
233 Ga0207688_10014067 3300025901 Bacteria 4351
234 Ga0207688_10029458 3300025901 Bacteria 3023
235 Ga0207680_11367069 3300025903 Bacteria 503
236 Ga0207645_10861901 3300025907 Bacteria 616
237 Ga0207643_10096696 3300025908 Bacteria 1727
238 Ga0207643_10231375 3300025908 Bacteria 1134
239 Ga0207705_10392478 3300025909 Bacteria 1073
240 Ga0207705_10429268 3300025909 Bacteria 1024
241 Ga0207654_11422715 3300025911 Bacteria 506
242 Ga0207707_11244015 3300025912 Bacteria 601
243 Ga0207693_10014737 3300025915 Bacteria 6280
244 Ga0207663_10026726 3300025916 Bacteria 3354
245 Ga0207660_10704950 3300025917 Bacteria 823
246 Ga0207660_11726806 3300025917 Bacteria 503
247 Ga0207662_10109619 3300025918 Bacteria 1720
248 Ga0207662_10235924 3300025918 Bacteria 1196
249 Ga0207662_10263559 3300025918 Bacteria 1135
250 Ga0207662_10948642 3300025918 Bacteria 610
251 Ga0207657_10078979 3300025919 Bacteria 2769
252 Ga0207657_10181447 3300025919 Bacteria 1701
253 Ga0207657_10359664 3300025919 Unclassified 1147
254 Ga0207657_10946241 3300025919 Bacteria 662
255 Ga0207657_11449889 3300025919 Bacteria 514
256 Ga0207649_10978909 3300025920 Bacteria 665
257 Ga0207652_10305021 3300025921 Bacteria 1437
258 Ga0207652_10480592 3300025921 Bacteria 1119
259 Ga0207652_11549818 3300025921 Unclassified 567
260 Ga0207646_10881393 3300025922 Bacteria 794
261 Ga0207681_10893660 3300025923 Bacteria 744
262 Ga0207687_10092674 3300025927 Bacteria 2207
263 Ga0207687_10598508 3300025927 Bacteria 929
264 Ga0207687_10677401 3300025927 Bacteria 874
265 Ga0207687_11336327 3300025927 Bacteria 616
266 Ga0207644_10446592 3300025931 Bacteria 1062
267 Ga0207644_11807589 3300025931 Bacteria 511
268 Ga0207690_11029459 3300025932 Unclassified 685
269 Ga0207690_11250238 3300025932 Bacteria 620
270 Ga0207690_11380367 3300025932 Bacteria 589
271 Ga0207706_10214064 3300025933 Bacteria 1688
272 Ga0207706_10264629 3300025933 Bacteria 1501
273 Ga0207706_10691788 3300025933 Bacteria 872
274 Ga0207706_10992076 3300025933 Bacteria 706
275 Ga0207706_11189012 3300025933 Bacteria 634
276 Ga0207686_10168770 3300025934 Bacteria 1541
277 Ga0207686_10276287 3300025934 Unclassified 1238
278 Ga0207686_10404986 3300025934 Bacteria 1040
279 Ga0207709_10034617 3300025935 Bacteria 2978
280 Ga0207709_10052158 3300025935 Bacteria 2510
281 Ga0207709_10086289 3300025935 Bacteria 2037
282 Ga0207669_10231499 3300025937 Bacteria 1363
283 Ga0207704_10202826 3300025938 Bacteria 1453
284 Ga0207665_10039404 3300025939 Bacteria 3151
285 Ga0207691_10149468 3300025940 Bacteria 2054
286 Ga0207691_10162900 3300025940 Bacteria 1955
287 Ga0207691_11662043 3300025940 Bacteria 518
288 Ga0207711_10585693 3300025941 Bacteria 1041
289 Ga0207689_10178869 3300025942 Bacteria 1749
290 Ga0207689_10514479 3300025942 Bacteria 1003
291 Ga0207661_10071790 3300025944 Bacteria 2831
292 Ga0207661_10131854 3300025944 Bacteria 2142
293 Ga0207661_10343920 3300025944 Bacteria 1345
294 Ga0207661_10592676 3300025944 Unclassified 1017
295 Ga0207661_10595554 3300025944 Bacteria 1014
296 Ga0207679_10675031 3300025945 Bacteria 936
297 Ga0207679_11689787 3300025945 Bacteria 579
298 Ga0207679_11999530 3300025945 Bacteria 528
299 Ga0207651_10967584 3300025960 Bacteria 760
300 Ga0207668_10279276 3300025972 Bacteria 1369
301 Ga0207668_10632351 3300025972 Bacteria 935
302 Ga0207677_10064634 3300026023 Bacteria 2549
303 Ga0207677_10095798 3300026023 Bacteria 2170
304 Ga0207677_10117939 3300026023 Bacteria 1990
305 Ga0207677_10132454 3300026023 Bacteria 1895
306 Ga0207677_12110330 3300026023 Bacteria 524
307 Ga0207703_10478632 3300026035 Bacteria 1166
308 Ga0207703_11836229 3300026035 Bacteria 582
309 Ga0207639_11726373 3300026041 Unclassified 586
310 Ga0207678_10138904 3300026067 Bacteria 2073
311 Ga0207678_10429770 3300026067 Bacteria 1146
312 Ga0207708_10081309 3300026075 Bacteria 2490
313 Ga0207708_10654530 3300026075 Bacteria 894
314 Ga0207708_10800563 3300026075 Bacteria 811
315 Ga0207708_11345909 3300026075 Bacteria 626
316 Ga0207641_10896161 3300026088 Bacteria 881
317 Ga0207641_11019470 3300026088 Bacteria 825
318 Ga0207648_10112472 3300026089 Bacteria 2391
319 Ga0207648_10429480 3300026089 Bacteria 1201
320 Ga0207648_10873584 3300026089 Bacteria 839
321 Ga0207648_11254459 3300026089 Bacteria 696
322 Ga0207676_11442513 3300026095 Bacteria 685
323 Ga0207676_11627937 3300026095 Unclassified 644
324 Ga0207674_10949629 3300026116 Bacteria 828
325 Ga0207674_11351541 3300026116 Unclassified 682
326 Ga0207674_11504681 3300026116 Bacteria 642
327 Ga0207674_12281796 3300026116 Bacteria 503
328 Ga0207675_100231855 3300026118 Bacteria 1781
329 Ga0207675_102260568 3300026118 Unclassified 558
330 Ga0207683_10015073 3300026121 Bacteria 6579
331 Ga0207683_10040071 3300026121 Bacteria 4086
332 Ga0207683_11768885 3300026121 Bacteria 567
333 Ga0207698_10326451 3300026142 Unclassified 1440
334 Ga0207698_10568728 3300026142 Bacteria 1113
335 Ga0207698_10702790 3300026142 Bacteria 1006
336 Ga0207698_10957573 3300026142 Bacteria 865
337 Ga0207698_11038774 3300026142 Bacteria 831
338 Ga0207428_10041239 3300027907 Bacteria 3738
339 Ga0207428_10126061 3300027907 Bacteria 1961
340 Ga0207428_10923100 3300027907 Bacteria 616
341 Ga0268265_10257360 3300028380 Bacteria 1550
342 Ga0268265_10622042 3300028380 Unclassified 1035
343 Ga0268264_10263126 3300028381 Unclassified 1608
344 Ga0307408_100587949 3300031548 Bacteria 987
345 Ga0307405_10065663 3300031731 Bacteria 2311
346 Ga0307405_10173247 3300031731 Bacteria 1541
347 Ga0307405_10205494 3300031731 Bacteria 1434
348 Ga0307405_10990548 3300031731 Bacteria 716
349 Ga0307405_11879886 3300031731 Bacteria 534
350 Ga0307413_10001054 3300031824 Bacteria 10012
351 Ga0307413_10462902 3300031824 Bacteria 1009
352 Ga0307413_10744303 3300031824 Bacteria 819
353 Ga0307413_11316927 3300031824 Bacteria 632
354 Ga0307413_11679990 3300031824 Bacteria 566
355 Ga0307413_11772130 3300031824 Bacteria 552
356 Ga0307413_11899157 3300031824 Bacteria 535
357 Ga0307410_10015235 3300031852 Bacteria 4554
358 Ga0307410_10047592 3300031852 Bacteria 2867
359 Ga0307410_10139899 3300031852 Bacteria 1789
360 Ga0307410_10387369 3300031852 Unclassified 1126
361 Ga0307410_10481713 3300031852 Unclassified 1018
362 Ga0307410_10870641 3300031852 Bacteria 770
363 Ga0307410_11172754 3300031852 Unclassified 668
364 Ga0307410_11729496 3300031852 Bacteria 554
365 Ga0307406_10187802 3300031901 Unclassified 1510
366 Ga0307406_10217302 3300031901 Unclassified 1418
367 Ga0307406_10261312 3300031901 Bacteria 1310
368 Ga0307406_10505694 3300031901 Bacteria 980
369 Ga0307406_10688304 3300031901 Bacteria 852
370 Ga0307406_10707754 3300031901 Bacteria 842
371 Ga0307406_10932554 3300031901 Bacteria 741
372 Ga0307407_10058721 3300031903 Bacteria 2237
373 Ga0307407_10379307 3300031903 Bacteria 1009
374 Ga0307407_11019568 3300031903 Bacteria 640
375 Ga0307412_10142793 3300031911 Bacteria 1756
376 Ga0307409_100001468 3300031995 Bacteria 11612
377 Ga0307409_100004528 3300031995 Bacteria 7828
378 Ga0307409_100250705 3300031995 Unclassified 1618
379 Ga0307409_100403793 3300031995 Bacteria 1306
380 Ga0307409_100428458 3300031995 Bacteria 1271
381 Ga0307409_100589489 3300031995 Bacteria 1097
382 Ga0307409_101542280 3300031995 Bacteria 692
383 Ga0307409_101837620 3300031995 Bacteria 635
384 Ga0307409_101997875 3300031995 Bacteria 609
385 Ga0307416_100041040 3300032002 Bacteria 3601
386 Ga0307416_100278960 3300032002 Unclassified 1646
387 Ga0307416_100297717 3300032002 Bacteria 1601
388 Ga0307416_100375097 3300032002 Unclassified 1450
389 Ga0307416_100748374 3300032002 Bacteria 1070
390 Ga0307416_100764904 3300032002 Bacteria 1059
391 Ga0307416_101361206 3300032002 Bacteria 816
392 Ga0307416_101524913 3300032002 Bacteria 774
393 Ga0307416_103240962 3300032002 Unclassified 545
394 Ga0307416_103838555 3300032002 Bacteria 503
395 Ga0307414_10142776 3300032004 Bacteria 1877
396 Ga0307414_11390381 3300032004 Bacteria 652
397 Ga0307414_11431121 3300032004 Bacteria 643
398 Ga0307411_10066859 3300032005 Bacteria 2416
399 Ga0307411_10105341 3300032005 Bacteria 2005
400 Ga0307411_10357531 3300032005 Unclassified 1193
401 Ga0307411_11126596 3300032005 Bacteria 708
402 Ga0307415_100000559 3300032126 Bacteria 16315
403 Ga0307415_100004456 3300032126 Bacteria 7267
404 Ga0307415_100163603 3300032126 Bacteria 1727
405 Ga0307415_100234074 3300032126 Bacteria 1481
406 Ga0307415_100432166 3300032126 Bacteria 1133
407 Ga0307415_100754348 3300032126 Bacteria 884
408 Ga0307415_101382224 3300032126 Bacteria 670
409 Ga0373935_1259015 3300035692 Unclassified 552
410 Ga0395899_0159368 3300037312 Bacteria 1595
411 Ga0395899_0786795 3300037312 Bacteria 589
412 Ga0395900_0008987 3300037418 Bacteria 10244
413 Ga0395900_0466286 3300037418 Bacteria 1217
414 Ga0395898_0005459 3300037466 Bacteria 13736
415 Ga0395898_0007457 3300037466 Bacteria 11612
416 Ga0395898_0271427 3300037466 Bacteria 1618
417 Ga0395905_0009527 3300037471 Bacteria 9487
418 Ga0395905_1301417 3300037471 Unclassified 631
419 Ga0436364_0769744 3300037853 Bacteria 805
420 Ga0436364_0813757 3300037853 Bacteria 931
421 Ga0395901_0011239 3300038443 Bacteria 9069
422 Ga0395901_0134862 3300038443 Bacteria 2595
423 Ga0395901_0173174 3300038443 Bacteria 2264
424 Ga0436365_0503126 3300039437 Bacteria 901
425 Ga0436363_0750576 3300039450 Bacteria 1639
426 Ga0436362_0334836 3300039453 Bacteria 614
427 Ga0451791_0280188 3300041451 Unclassified 605
428 Ga0466965_0628569 3300044683 Bacteria 612
429 Ga0466965_0936490 3300044683 Bacteria 507
430 Ga0466966_0887433 3300044684 Bacteria 538
431 Ga0466961_0440911 3300044693 Bacteria 788
432 Ga0466963_0015311 3300044694 Bacteria 4745
433 Ga0466963_0146577 3300044694 Bacteria 1638
434 Ga0466963_0200683 3300044694 Bacteria 1395
435 Ga0466963_0314584 3300044694 Bacteria 1102
436 Ga0466963_0558542 3300044694 Bacteria 808
437 Ga0466964_0014898 3300044706 Bacteria 2961
438 Ga0466964_0123576 3300044706 Bacteria 1170
439 Ga0466971_0252296 3300044719 Unclassified 841
440 Ga0466971_0455659 3300044719 Bacteria 628
441 Ga0466957_0039228 3300044842 Bacteria 2857
442 Ga0466957_0107665 3300044842 Bacteria 1765
443 Ga0466957_0579313 3300044842 Bacteria 784
444 Ga0466957_0589536 3300044842 Bacteria 777
445 Ga0466960_0277209 3300044901 Bacteria 939
446 Ga0466960_0342900 3300044901 Bacteria 850
447 Ga0466960_1042253 3300044901 Bacteria 504
448 Ga0466958_0693596 3300045836 Bacteria 663
449 Ga0466958_1020646 3300045836 Bacteria 540
450 Ga0466967_0028548 3300045976 Bacteria 4659
451 Ga0466967_0034138 3300045976 Bacteria 4314
452 Ga0466967_0081682 3300045976 Bacteria 2920
453 Ga0466967_0145748 3300045976 Bacteria 2209
454 Ga0466967_0148288 3300045976 Bacteria 2190
455 Ga0466967_0317607 3300045976 Bacteria 1501
456 Ga0466967_0336240 3300045976 Bacteria 1459
457 Ga0466967_0630299 3300045976 Bacteria 1059
458 Ga0466967_0722281 3300045976 Bacteria 987
459 Ga0466967_0769300 3300045976 Bacteria 955
460 Ga0466967_0847130 3300045976 Bacteria 908
461 Ga0466967_1128104 3300045976 Bacteria 781
462 Ga0466967_1438650 3300045976 Bacteria 687
463 Ga0466967_1963959 3300045976 Unclassified 582
464 Ga0466967_2066351 3300045976 Bacteria 566
465 Ga0466967_2374720 3300045976 Bacteria 526
466 Ga0466967_2462377 3300045976 Bacteria 515
467 Ga0495590_0168587 3300046457 Bacteria 798
468 Ga0495641_0011740 3300046461 Bacteria 4959
469 Ga0495582_0787491 3300046473 Unclassified 550
470 Ga0495659_0399491 3300046664 Unclassified 593
471 Ga0495658_0365388 3300046683 Bacteria 918
472 Ga0496100_0004548 3300048903 Bacteria 7370
473 Ga0496101_0058462 3300048904 Bacteria 2792
474 Ga0496101_1133733 3300048904 Bacteria 614
475 Ga0496102_0001933 3300048905 Bacteria 17833
476 Ga0496102_1087246 3300048905 Bacteria 720
477 Ga0496103_0006552 3300048906 Bacteria 6947
478 Ga0496104_0018692 3300048907 Bacteria 6326
479 Ga0496105_0026513 3300048908 Bacteria 4728
480 Ga0496106_0321251 3300048909 Bacteria 1242
481 Ga0496107_0458486 3300048910 Bacteria 947
482 Ga0496108_0010015 3300048911 Bacteria 7685
483 Ga0496109_0067503 3300048912 Bacteria 3276
484 Ga0496109_0328758 3300048912 Bacteria 1443
485 Ga0496109_0654205 3300048912 Bacteria 988
486 Ga0496110_0011341 3300048913 Bacteria 7290
487 Ga0496110_0548394 3300048913 Bacteria 1051
488 Ga0496110_0891008 3300048913 Bacteria 796
489 Ga0496111_0090499 3300048914 Bacteria 2241
490 Ga0496111_0132243 3300048914 Bacteria 1847
491 Ga0496112_0433001 3300048915 Bacteria 1253
492 Ga0496112_0624683 3300048915 Bacteria 1008
493 Ga0496113_0027471 3300048916 Bacteria 4080
494 Ga0496114_0000754 3300048917 Bacteria 24111
495 Ga0496114_0579167 3300048917 Bacteria 991
496 Ga0496114_0954993 3300048917 Bacteria 740
497 Ga0496115_0003151 3300048918 Bacteria 11862
498 Ga0496126_0485631 3300048929 Unclassified 989
499 Ga0501031_0106607 3300049568 Bacteria 1829
500 Ga0501031_0266241 3300049568 Bacteria 1113
501 Ga0501031_0760673 3300049568 Bacteria 621
502 Ga0501032_0520606 3300049569 Bacteria 759
503 Ga0501032_0527879 3300049569 Bacteria 753
504 Ga0501033_0279375 3300049570 Bacteria 1179
505 Ga0501033_0538278 3300049570 Bacteria 805
506 Ga0501034_0608284 3300049571 Bacteria 998
507 Ga0501036_0198551 3300049572 Bacteria 1687
508 Ga0501036_0408149 3300049572 Bacteria 1133
509 Ga0501036_1359377 3300049572 Unclassified 576
510 Ga0501037_0379891 3300049573 Bacteria 971
511 Ga0501038_0039903 3300049574 Bacteria 4104
512 Ga0501038_0951603 3300049574 Bacteria 632
513 Ga0501039_0032723 3300049575 Bacteria 4009
514 Ga0501039_0190840 3300049575 Bacteria 1611
515 Ga0501039_0814284 3300049575 Bacteria 728
516 Ga0501039_1598811 3300049575 Bacteria 500
517 Ga0501040_0112262 3300049576 Bacteria 1906
518 Ga0501040_0145870 3300049576 Bacteria 1668
519 Ga0501040_0768086 3300049576 Bacteria 697
520 Ga0501040_0952594 3300049576 Bacteria 622
521 Ga0501041_0265354 3300049577 Bacteria 1080
522 Ga0501042_0009829 3300049578 Bacteria 6390
523 Ga0501042_0321786 3300049578 Bacteria 1117
524 Ga0501042_0465587 3300049578 Unclassified 917
525 Ga0501042_0745177 3300049578 Unclassified 712
526 Ga0501043_0785389 3300049579 Bacteria 690
527 Ga0501043_0876861 3300049579 Unclassified 645
528 Ga0501043_0923264 3300049579 Bacteria 625
529 Ga0501046_0314461 3300049580 Bacteria 1142
530 Ga0501046_0404340 3300049580 Bacteria 986
531 Ga0501047_0000016 3300049581 Bacteria 284621
532 Ga0501048_0049622 3300049582 Bacteria 2991
533 Ga0501048_0290238 3300049582 Bacteria 1163
534 Ga0501048_0746860 3300049582 Unclassified 703
535 Ga0501048_1005937 3300049582 Archaea 600
536 Ga0501048_1192598 3300049582 Bacteria 547
537 Ga0501067_0114231 3300049583 Bacteria 1502
538 Ga0501067_0297363 3300049583 Bacteria 899
539 Ga0501067_0590282 3300049583 Bacteria 623
540 Ga0501068_0387017 3300049584 Bacteria 901
541 Ga0501070_0273250 3300049586 Bacteria 1380
542 Ga0501071_0070983 3300049587 Bacteria 2538
543 Ga0501071_0084897 3300049587 Bacteria 2321
544 Ga0501071_0231740 3300049587 Bacteria 1391
545 Ga0501071_0430947 3300049587 Bacteria 1008
546 Ga0501072_0070590 3300049588 Bacteria 2759
547 Ga0501072_0464139 3300049588 Bacteria 1002
548 Ga0501073_0295930 3300049589 Bacteria 1117
549 Ga0501075_0093989 3300049591 Bacteria 2276
550 Ga0501075_0157762 3300049591 Bacteria 1730
551 Ga0501076_0103061 3300049592 Bacteria 2301
552 Ga0501076_0151714 3300049592 Bacteria 1885
553 Ga0501076_1063955 3300049592 Bacteria 666
554 Ga0501076_1701555 3300049592 Bacteria 517
555 Ga0501077_0096211 3300049593 Bacteria 1877
556 Ga0501077_0351802 3300049593 Bacteria 940
557 Ga0501077_0567834 3300049593 Bacteria 728
558 Ga0501079_0187706 3300049741 Bacteria 1613
559 Ga0501079_0746296 3300049741 Bacteria 770
560 Ga0501079_0983201 3300049741 Bacteria 665
561 Ga0501079_1339805 3300049741 Bacteria 563
562 Ga0501080_0389323 3300049742 Bacteria 1255
563 Ga0501080_1521696 3300049742 Bacteria 568
564 Ga0501083_0178806 3300049744 Bacteria 1386
565 Ga0501035_0163227 3300049822 Bacteria 1928
566 Ga0501035_0177960 3300049822 Bacteria 1834
567 Ga0501035_0798986 3300049822 Bacteria 754
568 Ga0501045_0887451 3300049824 Bacteria 655
569 Ga0501045_0904117 3300049824 Bacteria 648
570 Ga0501045_1096278 3300049824 Bacteria 582
571 nmdc:mga00v17_338032_c1 3300050491 Bacteria 979
572 nmdc:mga0yw44_233893_c1 3300050492 Bacteria 1220
573 nmdc:mga0yw44_23725_c1 3300050492 Bacteria 3461
574 nmdc:mga0yw44_482068_c1 3300050492 Bacteria 841
575 nmdc:mga0yw44_5408_c1 3300050492 Bacteria 6029
576 nmdc:mga09592_593698_c1 3300050508 Bacteria 949
577 nmdc:mga09592_731910_c1 3300050508 Bacteria 840
578 nmdc:mga06r32_1075476_c1 3300050510 Bacteria 754
579 nmdc:mga06r32_2046_c1 3300050510 Bacteria 18043
580 nmdc:mga08y16_1199980_c1 3300050511 Bacteria 729
581 nmdc:mga08y16_177347_c1 3300050511 Bacteria 2213
582 nmdc:mga08y16_2166705_c1 3300050511 Bacteria 503
583 nmdc:mga08y16_308016_c1 3300050511 Bacteria 1631
584 nmdc:mga08y16_507572_c1 3300050511 Bacteria 1224
585 nmdc:mga08y16_71164_c1 3300050511 Bacteria 3625
586 nmdc:mga0n895_431677_c1 3300050512 Bacteria 1331
587 nmdc:mga0n895_98099_c1 3300050512 Bacteria 2937
588 nmdc:mga0rr50_1020725_c1 3300050513 Bacteria 704
589 nmdc:mga0rr50_432696_c1 3300050513 Bacteria 1114
590 nmdc:mga0a205_321543_c1 3300050515 Bacteria 1418
591 nmdc:mga0a205_610816_c1 3300050515 Bacteria 943
592 Ga0501084_0285262 3300054114 Bacteria 1394
593 Ga0501084_1068263 3300054114 Bacteria 678
594 Ga0501082_0246983 3300060353 Bacteria 1553
595 Ga0501082_0814752 3300060353 Bacteria 817
596 Ga0501082_1918501 3300060353 Unclassified 516
597 Ga0466962_0041964 3300061719 Unclassified 2189
598 Ga0466962_0278093 3300061719 Bacteria 826
599 Ga0530510_0653316 3300061734 Bacteria 801
600 Ga0530510_0807635 3300061734 Bacteria 716
601 Ga0530510_1451847 3300061734 Bacteria 526
602 Ga0530510_1541203 3300061734 Unclassified 510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100295685 Ga0070668_1002956851 73
2 3300005457 Ga0070662_101062227 Ga0070662_1010622271 73
3 3300005985 Ga0081539_10029416 Ga0081539_100294163 73
4 3300006852 Ga0075433_10927013 Ga0075433_109270131 73
5 3300006871 Ga0075434_100452000 Ga0075434_1004520001 73
6 3300009094 Ga0111539_11271591 Ga0111539_112715912 73
7 3300025933 Ga0207706_10691788 Ga0207706_106917882 73
8 3300025972 Ga0207668_10279276 Ga0207668_102792763 73
9 3300049583 Ga0501067_0590282 Ga0501067_0590282_135_356 73
10 3300050511 nmdc:mga08y16_2166705_c1 nmdc:mga08y16_2166705_c1_29_250 73
11 3300050512 nmdc:mga0n895_431677_c1 nmdc:mga0n895_431677_c1_43_264 73
12 3300050515 nmdc:mga0a205_610816_c1 nmdc:mga0a205_610816_c1_214_435 73
13 3300061734 Ga0530510_1541203 Ga0530510_1541203_262_483 73
14 3300003323 rootH1_10333507 rootH1_103335072 74
15 3300005329 Ga0070683_100233257 Ga0070683_1002332572 74
16 3300005329 Ga0070683_100287663 Ga0070683_1002876631 74
17 3300005334 Ga0068869_101276996 Ga0068869_1012769961 74
18 3300005335 Ga0070666_10768017 Ga0070666_107680172 74
19 3300005337 Ga0070682_100154423 Ga0070682_1001544232 74
20 3300005337 Ga0070682_100305137 Ga0070682_1003051372 74
21 3300005337 Ga0070682_101349528 Ga0070682_1013495282 74
22 3300005337 Ga0070682_101588569 Ga0070682_1015885691 74
23 3300005338 Ga0068868_100175694 Ga0068868_1001756943 74
24 3300005338 Ga0068868_100176256 Ga0068868_1001762562 74
25 3300005338 Ga0068868_100239924 Ga0068868_1002399242 74
26 3300005339 Ga0070660_100113264 Ga0070660_1001132644 74
27 3300005339 Ga0070660_101331123 Ga0070660_1013311232 74
28 3300005339 Ga0070660_101472653 Ga0070660_1014726531 74
29 3300005339 Ga0070660_101498226 Ga0070660_1014982262 74
30 3300005339 Ga0070660_101696027 Ga0070660_1016960272 74
31 3300005340 Ga0070689_100851435 Ga0070689_1008514351 74
32 3300005341 Ga0070691_10158158 Ga0070691_101581582 74
33 3300005341 Ga0070691_10605189 Ga0070691_106051891 74
34 3300005341 Ga0070691_10884417 Ga0070691_108844172 74
35 3300005343 Ga0070687_100184666 Ga0070687_1001846662 74
36 3300005343 Ga0070687_100210027 Ga0070687_1002100272 74
37 3300005343 Ga0070687_101011921 Ga0070687_1010119212 74
38 3300005344 Ga0070661_100824447 Ga0070661_1008244472 74
39 3300005344 Ga0070661_101521559 Ga0070661_1015215592 74
40 3300005345 Ga0070692_10180965 Ga0070692_101809652 74
41 3300005345 Ga0070692_10293129 Ga0070692_102931292 74
42 3300005345 Ga0070692_10403831 Ga0070692_104038312 74
43 3300005345 Ga0070692_10771532 Ga0070692_107715321 74
44 3300005347 Ga0070668_100367106 Ga0070668_1003671062 74
45 3300005353 Ga0070669_100763125 Ga0070669_1007631252 74
46 3300005354 Ga0070675_100864872 Ga0070675_1008648721 74
47 3300005354 Ga0070675_101276152 Ga0070675_1012761522 74
48 3300005355 Ga0070671_101353519 Ga0070671_1013535192 74
49 3300005356 Ga0070674_100621895 Ga0070674_1006218952 74
50 3300005364 Ga0070673_100614667 Ga0070673_1006146671 74
51 3300005364 Ga0070673_102380166 Ga0070673_1023801662 74
52 3300005366 Ga0070659_100390397 Ga0070659_1003903972 74
53 3300005366 Ga0070659_100960899 Ga0070659_1009608992 74
54 3300005437 Ga0070710_10618161 Ga0070710_106181612 74
55 3300005438 Ga0070701_10955119 Ga0070701_109551191 74
56 3300005439 Ga0070711_100008029 Ga0070711_1000080292 74
57 3300005440 Ga0070705_100189233 Ga0070705_1001892332 74
58 3300005440 Ga0070705_100574918 Ga0070705_1005749182 74
59 3300005440 Ga0070705_101689488 Ga0070705_1016894881 74
60 3300005440 Ga0070705_101861195 Ga0070705_1018611952 74
61 3300005441 Ga0070700_100288099 Ga0070700_1002880992 74
62 3300005441 Ga0070700_100940282 Ga0070700_1009402821 74
63 3300005445 Ga0070708_100925750 Ga0070708_1009257502 74
64 3300005455 Ga0070663_100128433 Ga0070663_1001284332 74
65 3300005455 Ga0070663_100264277 Ga0070663_1002642772 74
66 3300005455 Ga0070663_100652953 Ga0070663_1006529531 74
67 3300005455 Ga0070663_102128393 Ga0070663_1021283932 74
68 3300005456 Ga0070678_100032452 Ga0070678_1000324522 74
69 3300005456 Ga0070678_100335807 Ga0070678_1003358072 74
70 3300005456 Ga0070678_101389577 Ga0070678_1013895772 74
71 3300005457 Ga0070662_100341035 Ga0070662_1003410352 74
72 3300005457 Ga0070662_100520608 Ga0070662_1005206083 74
73 3300005458 Ga0070681_10107611 Ga0070681_101076113 74
74 3300005458 Ga0070681_11264274 Ga0070681_112642742 74
75 3300005459 Ga0068867_100061715 Ga0068867_1000617152 74
76 3300005459 Ga0068867_100062732 Ga0068867_1000627322 74
77 3300005459 Ga0068867_100955038 Ga0068867_1009550381 74
78 3300005466 Ga0070685_10680817 Ga0070685_106808172 74
79 3300005466 Ga0070685_10683845 Ga0070685_106838452 74
80 3300005467 Ga0070706_100278167 Ga0070706_1002781672 74
81 3300005530 Ga0070679_101499915 Ga0070679_1014999151 74
82 3300005530 Ga0070679_101877429 Ga0070679_1018774291 74
83 3300005535 Ga0070684_100447717 Ga0070684_1004477172 74
84 3300005535 Ga0070684_101478993 Ga0070684_1014789932 74
85 3300005539 Ga0068853_100328897 Ga0068853_1003288972 74
86 3300005543 Ga0070672_101009067 Ga0070672_1010090672 74
87 3300005543 Ga0070672_101219448 Ga0070672_1012194482 74
88 3300005543 Ga0070672_101347507 Ga0070672_1013475072 74
89 3300005544 Ga0070686_100073861 Ga0070686_1000738614 74
90 3300005545 Ga0070695_100480876 Ga0070695_1004808762 74
91 3300005547 Ga0070693_100405249 Ga0070693_1004052493 74
92 3300005548 Ga0070665_100244411 Ga0070665_1002444113 74
93 3300005548 Ga0070665_100866631 Ga0070665_1008666311 74
94 3300005549 Ga0070704_100053691 Ga0070704_1000536912 74
95 3300005549 Ga0070704_100614175 Ga0070704_1006141752 74
96 3300005549 Ga0070704_101808139 Ga0070704_1018081392 74
97 3300005564 Ga0070664_100140859 Ga0070664_1001408592 74
98 3300005564 Ga0070664_101685351 Ga0070664_1016853511 74
99 3300005577 Ga0068857_100203811 Ga0068857_1002038112 74
100 3300005577 Ga0068857_101435205 Ga0068857_1014352052 74
101 3300005578 Ga0068854_100235104 Ga0068854_1002351042 74
102 3300005578 Ga0068854_100692911 Ga0068854_1006929112 74
103 3300005615 Ga0070702_100443106 Ga0070702_1004431062 74
104 3300005615 Ga0070702_100568135 Ga0070702_1005681352 74
105 3300005615 Ga0070702_100632495 Ga0070702_1006324952 74
106 3300005616 Ga0068852_100178067 Ga0068852_1001780675 74
107 3300005616 Ga0068852_100632185 Ga0068852_1006321852 74
108 3300005616 Ga0068852_102214717 Ga0068852_1022147172 74
109 3300005616 Ga0068852_102826375 Ga0068852_1028263752 74
110 3300005617 Ga0068859_100996757 Ga0068859_1009967572 74
111 3300005618 Ga0068864_100080512 Ga0068864_1000805121 74
112 3300005618 Ga0068864_101765786 Ga0068864_1017657862 74
113 3300005618 Ga0068864_102415237 Ga0068864_1024152372 74
114 3300005718 Ga0068866_10175648 Ga0068866_101756483 74
115 3300005718 Ga0068866_10247705 Ga0068866_102477052 74
116 3300005718 Ga0068866_10431993 Ga0068866_104319931 74
117 3300005718 Ga0068866_10931215 Ga0068866_109312152 74
118 3300005719 Ga0068861_100056451 Ga0068861_1000564512 74
119 3300005719 Ga0068861_101502755 Ga0068861_1015027551 74
120 3300005840 Ga0068870_10174651 Ga0068870_101746512 74
121 3300005840 Ga0068870_10238232 Ga0068870_102382323 74
122 3300005840 Ga0068870_10293941 Ga0068870_102939412 74
123 3300005840 Ga0068870_10302013 Ga0068870_103020132 74
124 3300005841 Ga0068863_101154704 Ga0068863_1011547042 74
125 3300005842 Ga0068858_100363732 Ga0068858_1003637322 74
126 3300005842 Ga0068858_100572527 Ga0068858_1005725272 74
127 3300005843 Ga0068860_100716491 Ga0068860_1007164912 74
128 3300005937 Ga0081455_10171666 Ga0081455_101716662 74
129 3300005937 Ga0081455_10218560 Ga0081455_102185602 74
130 3300005981 Ga0081538_10000010 Ga0081538_10000010101 74
131 3300005981 Ga0081538_10000782 Ga0081538_1000078211 74
132 3300005981 Ga0081538_10001106 Ga0081538_1000110613 74
133 3300005981 Ga0081538_10005959 Ga0081538_100059599 74
134 3300005981 Ga0081538_10031100 Ga0081538_100311004 74
135 3300005981 Ga0081538_10034278 Ga0081538_100342783 74
136 3300005981 Ga0081538_10080990 Ga0081538_100809902 74
137 3300005981 Ga0081538_10146118 Ga0081538_101461182 74
138 3300005981 Ga0081538_10168441 Ga0081538_101684412 74
139 3300005985 Ga0081539_10004209 Ga0081539_100042095 74
140 3300006028 Ga0070717_10001893 Ga0070717_100018938 74
141 3300006038 Ga0075365_10004732 Ga0075365_100047327 74
142 3300006038 Ga0075365_10021624 Ga0075365_100216242 74
143 3300006051 Ga0075364_10036804 Ga0075364_100368042 74
144 3300006058 Ga0075432_10561442 Ga0075432_105614422 74
145 3300006173 Ga0070716_100234448 Ga0070716_1002344482 74
146 3300006175 Ga0070712_100016970 Ga0070712_1000169702 74
147 3300006178 Ga0075367_10633629 Ga0075367_106336291 74
148 3300006237 Ga0097621_100479618 Ga0097621_1004796182 74
149 3300006237 Ga0097621_101698862 Ga0097621_1016988622 74
150 3300006844 Ga0075428_100026541 Ga0075428_1000265415 74
151 3300006844 Ga0075428_100696018 Ga0075428_1006960182 74
152 3300006844 Ga0075428_102609958 Ga0075428_1026099582 74
153 3300006846 Ga0075430_100771021 Ga0075430_1007710212 74
154 3300006847 Ga0075431_100000718 Ga0075431_10000071833 74
155 3300006847 Ga0075431_100664385 Ga0075431_1006643852 74
156 3300006847 Ga0075431_101848983 Ga0075431_1018489831 74
157 3300006852 Ga0075433_10863256 Ga0075433_108632562 74
158 3300006871 Ga0075434_100450650 Ga0075434_1004506502 74
159 3300006880 Ga0075429_101760500 Ga0075429_1017605002 74
160 3300006881 Ga0068865_100069528 Ga0068865_1000695282 74
161 3300006881 Ga0068865_100397582 Ga0068865_1003975823 74
162 3300006881 Ga0068865_101287418 Ga0068865_1012874182 74
163 3300006914 Ga0075436_100331083 Ga0075436_1003310832 74
164 3300006931 Ga0097620_100996746 Ga0097620_1009967462 74
165 3300007076 Ga0075435_101257917 Ga0075435_1012579172 74
166 3300009093 Ga0105240_11778623 Ga0105240_117786232 74
167 3300009094 Ga0111539_10006858 Ga0111539_1000685816 74
168 3300009094 Ga0111539_10081910 Ga0111539_100819103 74
169 3300009094 Ga0111539_10444345 Ga0111539_104443452 74
170 3300009094 Ga0111539_10604637 Ga0111539_106046372 74
171 3300009094 Ga0111539_11112596 Ga0111539_111125962 74
172 3300009094 Ga0111539_12826634 Ga0111539_128266341 74
173 3300009098 Ga0105245_10002619 Ga0105245_100026197 74
174 3300009098 Ga0105245_10046340 Ga0105245_100463406 74
175 3300009098 Ga0105245_10124790 Ga0105245_101247903 74
176 3300009101 Ga0105247_10123331 Ga0105247_101233313 74
177 3300009101 Ga0105247_10377833 Ga0105247_103778332 74
178 3300009101 Ga0105247_11235890 Ga0105247_112358901 74
179 3300009147 Ga0114129_11251418 Ga0114129_112514182 74
180 3300009148 Ga0105243_10058843 Ga0105243_100588433 74
181 3300009148 Ga0105243_10143939 Ga0105243_101439392 74
182 3300009148 Ga0105243_10176276 Ga0105243_101762763 74
183 3300009148 Ga0105243_10834752 Ga0105243_108347522 74
184 3300009148 Ga0105243_11497594 Ga0105243_114975942 74
185 3300009148 Ga0105243_11590347 Ga0105243_115903472 74
186 3300009176 Ga0105242_10080370 Ga0105242_100803702 74
187 3300009176 Ga0105242_10468908 Ga0105242_104689082 74
188 3300009176 Ga0105242_11007867 Ga0105242_110078672 74
189 3300009176 Ga0105242_12704626 Ga0105242_127046261 74
190 3300009177 Ga0105248_10490741 Ga0105248_104907411 74
191 3300009545 Ga0105237_11075869 Ga0105237_110758692 74
192 3300009551 Ga0105238_11739644 Ga0105238_117396442 74
193 3300009553 Ga0105249_10365507 Ga0105249_103655072 74
194 3300009553 Ga0105249_12584839 Ga0105249_125848392 74
195 3300010375 Ga0105239_10111962 Ga0105239_101119625 74
196 3300010375 Ga0105239_11057780 Ga0105239_110577802 74
197 3300010375 Ga0105239_11062540 Ga0105239_110625402 74
198 3300010375 Ga0105239_11916002 Ga0105239_119160022 74
199 3300011119 Ga0105246_10075007 Ga0105246_100750074 74
200 3300011119 Ga0105246_11924362 Ga0105246_119243622 74
201 3300011119 Ga0105246_11975120 Ga0105246_119751202 74
202 3300012494 Ga0157341_1040465 Ga0157341_10404651 74
203 3300013105 Ga0157369_10911739 Ga0157369_109117392 74
204 3300013296 Ga0157374_10236147 Ga0157374_102361472 74
205 3300013297 Ga0157378_10339362 Ga0157378_103393622 74
206 3300013297 Ga0157378_12879603 Ga0157378_128796031 74
207 3300013306 Ga0163162_10413045 Ga0163162_104130452 74
208 3300013306 Ga0163162_10530322 Ga0163162_105303222 74
209 3300013307 Ga0157372_11524261 Ga0157372_115242612 74
210 3300013307 Ga0157372_12310794 Ga0157372_123107941 74
211 3300013307 Ga0157372_12675987 Ga0157372_126759872 74
212 3300013307 Ga0157372_13406497 Ga0157372_134064971 74
213 3300013308 Ga0157375_10134499 Ga0157375_101344992 74
214 3300013308 Ga0157375_11334397 Ga0157375_113343972 74
215 3300013308 Ga0157375_11920527 Ga0157375_119205272 74
216 3300014325 Ga0163163_10317158 Ga0163163_103171582 74
217 3300014325 Ga0163163_12170012 Ga0163163_121700122 74
218 3300014326 Ga0157380_10543260 Ga0157380_105432602 74
219 3300014326 Ga0157380_10967145 Ga0157380_109671452 74
220 3300014497 Ga0182008_10426634 Ga0182008_104266342 74
221 3300014745 Ga0157377_10136351 Ga0157377_101363513 74
222 3300014968 Ga0157379_11358610 Ga0157379_113586102 74
223 3300014969 Ga0157376_10695904 Ga0157376_106959042 74
224 3300014969 Ga0157376_10860262 Ga0157376_108602622 74
225 3300017792 Ga0163161_11084281 Ga0163161_110842812 74
226 3300017792 Ga0163161_11260956 Ga0163161_112609562 74
227 3300020069 Ga0197907_10086063 Ga0197907_100860632 74
228 3300020070 Ga0206356_11727012 Ga0206356_117270121 74
229 3300021384 Ga0213876_10435798 Ga0213876_104357982 74
230 3300021388 Ga0213875_10646476 Ga0213875_106464761 74
231 3300022467 Ga0224712_10296668 Ga0224712_102966681 74
232 3300022467 Ga0224712_10325422 Ga0224712_103254222 74
233 3300025885 Ga0207653_10119085 Ga0207653_101190851 74
234 3300025898 Ga0207692_10363199 Ga0207692_103631992 74
235 3300025899 Ga0207642_10083047 Ga0207642_100830472 74
236 3300025899 Ga0207642_10122079 Ga0207642_101220793 74
237 3300025899 Ga0207642_10696455 Ga0207642_106964552 74
238 3300025899 Ga0207642_11102574 Ga0207642_111025741 74
239 3300025900 Ga0207710_10417382 Ga0207710_104173822 74
240 3300025901 Ga0207688_10014067 Ga0207688_100140672 74
241 3300025901 Ga0207688_10029458 Ga0207688_100294583 74
242 3300025903 Ga0207680_11367069 Ga0207680_113670692 74
243 3300025907 Ga0207645_10861901 Ga0207645_108619012 74
244 3300025908 Ga0207643_10096696 Ga0207643_100966962 74
245 3300025908 Ga0207643_10231375 Ga0207643_102313752 74
246 3300025909 Ga0207705_10392478 Ga0207705_103924782 74
247 3300025909 Ga0207705_10429268 Ga0207705_104292682 74
248 3300025911 Ga0207654_11422715 Ga0207654_114227151 74
249 3300025912 Ga0207707_11244015 Ga0207707_112440152 74
250 3300025915 Ga0207693_10014737 Ga0207693_100147372 74
251 3300025916 Ga0207663_10026726 Ga0207663_100267263 74
252 3300025917 Ga0207660_10704950 Ga0207660_107049502 74
253 3300025917 Ga0207660_11726806 Ga0207660_117268062 74
254 3300025918 Ga0207662_10109619 Ga0207662_101096192 74
255 3300025918 Ga0207662_10235924 Ga0207662_102359242 74
256 3300025918 Ga0207662_10263559 Ga0207662_102635592 74
257 3300025918 Ga0207662_10948642 Ga0207662_109486421 74
258 3300025919 Ga0207657_10078979 Ga0207657_100789794 74
259 3300025919 Ga0207657_10181447 Ga0207657_101814472 74
260 3300025919 Ga0207657_10359664 Ga0207657_103596643 74
261 3300025919 Ga0207657_10946241 Ga0207657_109462412 74
262 3300025919 Ga0207657_11449889 Ga0207657_114498892 74
263 3300025920 Ga0207649_10978909 Ga0207649_109789091 74
264 3300025921 Ga0207652_10305021 Ga0207652_103050212 74
265 3300025921 Ga0207652_10480592 Ga0207652_104805923 74
266 3300025921 Ga0207652_11549818 Ga0207652_115498182 74
267 3300025922 Ga0207646_10881393 Ga0207646_108813932 74
268 3300025923 Ga0207681_10893660 Ga0207681_108936602 74
269 3300025927 Ga0207687_10092674 Ga0207687_100926742 74
270 3300025927 Ga0207687_10598508 Ga0207687_105985083 74
271 3300025927 Ga0207687_10677401 Ga0207687_106774012 74
272 3300025927 Ga0207687_11336327 Ga0207687_113363272 74
273 3300025931 Ga0207644_10446592 Ga0207644_104465922 74
274 3300025931 Ga0207644_11807589 Ga0207644_118075891 74
275 3300025932 Ga0207690_11029459 Ga0207690_110294592 74
276 3300025932 Ga0207690_11250238 Ga0207690_112502382 74
277 3300025932 Ga0207690_11380367 Ga0207690_113803672 74
278 3300025933 Ga0207706_10214064 Ga0207706_102140643 74
279 3300025933 Ga0207706_10264629 Ga0207706_102646292 74
280 3300025933 Ga0207706_10992076 Ga0207706_109920762 74
281 3300025933 Ga0207706_11189012 Ga0207706_111890122 74
282 3300025934 Ga0207686_10168770 Ga0207686_101687702 74
283 3300025934 Ga0207686_10276287 Ga0207686_102762871 74
284 3300025934 Ga0207686_10404986 Ga0207686_104049862 74
285 3300025935 Ga0207709_10034617 Ga0207709_100346172 74
286 3300025935 Ga0207709_10052158 Ga0207709_100521583 74
287 3300025935 Ga0207709_10086289 Ga0207709_100862892 74
288 3300025937 Ga0207669_10231499 Ga0207669_102314992 74
289 3300025938 Ga0207704_10202826 Ga0207704_102028262 74
290 3300025939 Ga0207665_10039404 Ga0207665_100394045 74
291 3300025940 Ga0207691_10149468 Ga0207691_101494683 74
292 3300025940 Ga0207691_10162900 Ga0207691_101629002 74
293 3300025940 Ga0207691_11662043 Ga0207691_116620432 74
294 3300025941 Ga0207711_10585693 Ga0207711_105856932 74
295 3300025942 Ga0207689_10178869 Ga0207689_101788692 74
296 3300025942 Ga0207689_10514479 Ga0207689_105144792 74
297 3300025944 Ga0207661_10071790 Ga0207661_100717902 74
298 3300025944 Ga0207661_10131854 Ga0207661_101318542 74
299 3300025944 Ga0207661_10343920 Ga0207661_103439202 74
300 3300025944 Ga0207661_10592676 Ga0207661_105926761 74
301 3300025944 Ga0207661_10595554 Ga0207661_105955541 74
302 3300025945 Ga0207679_10675031 Ga0207679_106750312 74
303 3300025945 Ga0207679_11689787 Ga0207679_116897872 74
304 3300025945 Ga0207679_11999530 Ga0207679_119995302 74
305 3300025960 Ga0207651_10967584 Ga0207651_109675842 74
306 3300025972 Ga0207668_10632351 Ga0207668_106323512 74
307 3300026023 Ga0207677_10064634 Ga0207677_100646344 74
308 3300026023 Ga0207677_10095798 Ga0207677_100957982 74
309 3300026023 Ga0207677_10117939 Ga0207677_101179392 74
310 3300026023 Ga0207677_10132454 Ga0207677_101324542 74
311 3300026023 Ga0207677_12110330 Ga0207677_121103302 74
312 3300026035 Ga0207703_10478632 Ga0207703_104786322 74
313 3300026035 Ga0207703_11836229 Ga0207703_118362292 74
314 3300026041 Ga0207639_11726373 Ga0207639_117263732 74
315 3300026067 Ga0207678_10138904 Ga0207678_101389042 74
316 3300026067 Ga0207678_10429770 Ga0207678_104297702 74
317 3300026075 Ga0207708_10081309 Ga0207708_100813092 74
318 3300026075 Ga0207708_10654530 Ga0207708_106545301 74
319 3300026075 Ga0207708_10800563 Ga0207708_108005631 74
320 3300026075 Ga0207708_11345909 Ga0207708_113459091 74
321 3300026088 Ga0207641_10896161 Ga0207641_108961612 74
322 3300026088 Ga0207641_11019470 Ga0207641_110194702 74
323 3300026089 Ga0207648_10112472 Ga0207648_101124726 74
324 3300026089 Ga0207648_10429480 Ga0207648_104294803 74
325 3300026089 Ga0207648_10873584 Ga0207648_108735842 74
326 3300026089 Ga0207648_11254459 Ga0207648_112544592 74
327 3300026095 Ga0207676_11442513 Ga0207676_114425132 74
328 3300026095 Ga0207676_11627937 Ga0207676_116279372 74
329 3300026116 Ga0207674_10949629 Ga0207674_109496292 74
330 3300026116 Ga0207674_11351541 Ga0207674_113515411 74
331 3300026116 Ga0207674_11504681 Ga0207674_115046811 74
332 3300026116 Ga0207674_12281796 Ga0207674_122817962 74
333 3300026118 Ga0207675_100231855 Ga0207675_1002318554 74
334 3300026118 Ga0207675_102260568 Ga0207675_1022605682 74
335 3300026121 Ga0207683_10015073 Ga0207683_100150738 74
336 3300026121 Ga0207683_10040071 Ga0207683_100400712 74
337 3300026121 Ga0207683_11768885 Ga0207683_117688851 74
338 3300026142 Ga0207698_10326451 Ga0207698_103264511 74
339 3300026142 Ga0207698_10568728 Ga0207698_105687282 74
340 3300026142 Ga0207698_10702790 Ga0207698_107027902 74
341 3300026142 Ga0207698_10957573 Ga0207698_109575732 74
342 3300026142 Ga0207698_11038774 Ga0207698_110387742 74
343 3300027907 Ga0207428_10041239 Ga0207428_100412392 74
344 3300027907 Ga0207428_10126061 Ga0207428_101260613 74
345 3300027907 Ga0207428_10923100 Ga0207428_109231002 74
346 3300028380 Ga0268265_10257360 Ga0268265_102573603 74
347 3300028380 Ga0268265_10622042 Ga0268265_106220422 74
348 3300028381 Ga0268264_10263126 Ga0268264_102631262 74
349 3300031548 Ga0307408_100587949 Ga0307408_1005879492 74
350 3300031731 Ga0307405_10065663 Ga0307405_100656634 74
351 3300031731 Ga0307405_10173247 Ga0307405_101732472 74
352 3300031731 Ga0307405_10205494 Ga0307405_102054942 74
353 3300031731 Ga0307405_10990548 Ga0307405_109905482 74
354 3300031731 Ga0307405_11879886 Ga0307405_118798862 74
355 3300031824 Ga0307413_10001054 Ga0307413_100010542 74
356 3300031824 Ga0307413_10462902 Ga0307413_104629022 74
357 3300031824 Ga0307413_10744303 Ga0307413_107443032 74
358 3300031824 Ga0307413_11316927 Ga0307413_113169272 74
359 3300031824 Ga0307413_11679990 Ga0307413_116799902 74
360 3300031824 Ga0307413_11772130 Ga0307413_117721301 74
361 3300031824 Ga0307413_11899157 Ga0307413_118991572 74
362 3300031852 Ga0307410_10015235 Ga0307410_100152353 74
363 3300031852 Ga0307410_10047592 Ga0307410_100475923 74
364 3300031852 Ga0307410_10139899 Ga0307410_101398991 74
365 3300031852 Ga0307410_10387369 Ga0307410_103873691 74
366 3300031852 Ga0307410_10481713 Ga0307410_104817131 74
367 3300031852 Ga0307410_10870641 Ga0307410_108706411 74
368 3300031852 Ga0307410_11172754 Ga0307410_111727542 74
369 3300031852 Ga0307410_11729496 Ga0307410_117294962 74
370 3300031901 Ga0307406_10187802 Ga0307406_101878021 74
371 3300031901 Ga0307406_10217302 Ga0307406_102173022 74
372 3300031901 Ga0307406_10261312 Ga0307406_102613122 74
373 3300031901 Ga0307406_10505694 Ga0307406_105056943 74
374 3300031901 Ga0307406_10688304 Ga0307406_106883041 74
375 3300031901 Ga0307406_10707754 Ga0307406_107077541 74
376 3300031901 Ga0307406_10932554 Ga0307406_109325542 74
377 3300031903 Ga0307407_10058721 Ga0307407_100587213 74
378 3300031903 Ga0307407_10379307 Ga0307407_103793072 74
379 3300031903 Ga0307407_11019568 Ga0307407_110195681 74
380 3300031911 Ga0307412_10142793 Ga0307412_101427934 74
381 3300031995 Ga0307409_100001468 Ga0307409_1000014689 74
382 3300031995 Ga0307409_100004528 Ga0307409_10000452811 74
383 3300031995 Ga0307409_100250705 Ga0307409_1002507052 74
384 3300031995 Ga0307409_100403793 Ga0307409_1004037932 74
385 3300031995 Ga0307409_100428458 Ga0307409_1004284581 74
386 3300031995 Ga0307409_100589489 Ga0307409_1005894891 74
387 3300031995 Ga0307409_101542280 Ga0307409_1015422801 74
388 3300031995 Ga0307409_101837620 Ga0307409_1018376202 74
389 3300031995 Ga0307409_101997875 Ga0307409_1019978752 74
390 3300032002 Ga0307416_100041040 Ga0307416_1000410403 74
391 3300032002 Ga0307416_100278960 Ga0307416_1002789602 74
392 3300032002 Ga0307416_100297717 Ga0307416_1002977171 74
393 3300032002 Ga0307416_100375097 Ga0307416_1003750972 74
394 3300032002 Ga0307416_100748374 Ga0307416_1007483742 74
395 3300032002 Ga0307416_100764904 Ga0307416_1007649042 74
396 3300032002 Ga0307416_101361206 Ga0307416_1013612061 74
397 3300032002 Ga0307416_101524913 Ga0307416_1015249132 74
398 3300032002 Ga0307416_103240962 Ga0307416_1032409621 74
399 3300032002 Ga0307416_103838555 Ga0307416_1038385552 74
400 3300032004 Ga0307414_10142776 Ga0307414_101427764 74
401 3300032004 Ga0307414_11390381 Ga0307414_113903812 74
402 3300032004 Ga0307414_11431121 Ga0307414_114311211 74
403 3300032005 Ga0307411_10066859 Ga0307411_100668593 74
404 3300032005 Ga0307411_10105341 Ga0307411_101053413 74
405 3300032005 Ga0307411_10357531 Ga0307411_103575312 74
406 3300032005 Ga0307411_11126596 Ga0307411_111265962 74
407 3300032126 Ga0307415_100000559 Ga0307415_1000005592 74
408 3300032126 Ga0307415_100004456 Ga0307415_1000044566 74
409 3300032126 Ga0307415_100163603 Ga0307415_1001636033 74
410 3300032126 Ga0307415_100234074 Ga0307415_1002340743 74
411 3300032126 Ga0307415_100432166 Ga0307415_1004321662 74
412 3300032126 Ga0307415_100754348 Ga0307415_1007543482 74
413 3300032126 Ga0307415_101382224 Ga0307415_1013822242 74
414 3300035692 Ga0373935_1259015 Ga0373935_1259015_303_527 74
415 3300037312 Ga0395899_0159368 Ga0395899_0159368_1038_1262 74
416 3300037312 Ga0395899_0786795 Ga0395899_0786795_129_353 74
417 3300037418 Ga0395900_0008987 Ga0395900_0008987_2244_2468 74
418 3300037418 Ga0395900_0466286 Ga0395900_0466286_390_614 74
419 3300037466 Ga0395898_0005459 Ga0395898_0005459_4986_5210 74
420 3300037466 Ga0395898_0007457 Ga0395898_0007457_2499_2723 74
421 3300037466 Ga0395898_0271427 Ga0395898_0271427_588_812 74
422 3300037471 Ga0395905_0009527 Ga0395905_0009527_5130_5354 74
423 3300037471 Ga0395905_1301417 Ga0395905_1301417_93_317 74
424 3300037853 Ga0436364_0769744 Ga0436364_0769744_438_662 74
425 3300037853 Ga0436364_0813757 Ga0436364_0813757_108_332 74
426 3300038443 Ga0395901_0011239 Ga0395901_0011239_5694_5918 74
427 3300038443 Ga0395901_0134862 Ga0395901_0134862_1129_1353 74
428 3300038443 Ga0395901_0173174 Ga0395901_0173174_627_851 74
429 3300039437 Ga0436365_0503126 Ga0436365_0503126_244_468 74
430 3300039450 Ga0436363_0750576 Ga0436363_0750576_1216_1440 74
431 3300039453 Ga0436362_0334836 Ga0436362_0334836_94_318 74
432 3300041451 Ga0451791_0280188 Ga0451791_0280188_367_591 74
433 3300044683 Ga0466965_0628569 Ga0466965_0628569_306_530 74
434 3300044683 Ga0466965_0936490 Ga0466965_0936490_39_263 74
435 3300044684 Ga0466966_0887433 Ga0466966_0887433_295_519 74
436 3300044693 Ga0466961_0440911 Ga0466961_0440911_490_717 74
437 3300044694 Ga0466963_0015311 Ga0466963_0015311_1701_1925 74
438 3300044694 Ga0466963_0146577 Ga0466963_0146577_1247_1471 74
439 3300044694 Ga0466963_0200683 Ga0466963_0200683_1079_1303 74
440 3300044694 Ga0466963_0314584 Ga0466963_0314584_603_827 74
441 3300044694 Ga0466963_0558542 Ga0466963_0558542_310_534 74
442 3300044706 Ga0466964_0014898 Ga0466964_0014898_140_364 74
443 3300044706 Ga0466964_0123576 Ga0466964_0123576_383_607 74
444 3300044719 Ga0466971_0252296 Ga0466971_0252296_526_750 74
445 3300044719 Ga0466971_0455659 Ga0466971_0455659_146_373 74
446 3300044842 Ga0466957_0039228 Ga0466957_0039228_618_842 74
447 3300044842 Ga0466957_0107665 Ga0466957_0107665_1284_1508 74
448 3300044842 Ga0466957_0579313 Ga0466957_0579313_171_395 74
449 3300044842 Ga0466957_0589536 Ga0466957_0589536_513_737 74
450 3300044901 Ga0466960_0277209 Ga0466960_0277209_548_772 74
451 3300044901 Ga0466960_0342900 Ga0466960_0342900_63_287 74
452 3300044901 Ga0466960_1042253 Ga0466960_1042253_14_238 74
453 3300045836 Ga0466958_0693596 Ga0466958_0693596_409_633 74
454 3300045836 Ga0466958_1020646 Ga0466958_1020646_117_341 74
455 3300045976 Ga0466967_0028548 Ga0466967_0028548_2628_2852 74
456 3300045976 Ga0466967_0034138 Ga0466967_0034138_2395_2619 74
457 3300045976 Ga0466967_0081682 Ga0466967_0081682_811_1035 74
458 3300045976 Ga0466967_0145748 Ga0466967_0145748_801_1025 74
459 3300045976 Ga0466967_0148288 Ga0466967_0148288_350_574 74
460 3300045976 Ga0466967_0317607 Ga0466967_0317607_1114_1338 74
461 3300045976 Ga0466967_0336240 Ga0466967_0336240_321_545 74
462 3300045976 Ga0466967_0630299 Ga0466967_0630299_296_520 74
463 3300045976 Ga0466967_0722281 Ga0466967_0722281_75_299 74
464 3300045976 Ga0466967_0769300 Ga0466967_0769300_663_887 74
465 3300045976 Ga0466967_0847130 Ga0466967_0847130_228_452 74
466 3300045976 Ga0466967_1128104 Ga0466967_1128104_81_305 74
467 3300045976 Ga0466967_1438650 Ga0466967_1438650_54_281 74
468 3300045976 Ga0466967_1963959 Ga0466967_1963959_151_375 74
469 3300045976 Ga0466967_2066351 Ga0466967_2066351_197_421 74
470 3300045976 Ga0466967_2374720 Ga0466967_2374720_41_268 74
471 3300045976 Ga0466967_2462377 Ga0466967_2462377_167_391 74
472 3300046457 Ga0495590_0168587 Ga0495590_0168587_234_458 74
473 3300046461 Ga0495641_0011740 Ga0495641_0011740_413_637 74
474 3300046473 Ga0495582_0787491 Ga0495582_0787491_303_527 74
475 3300046664 Ga0495659_0399491 Ga0495659_0399491_56_280 74
476 3300046683 Ga0495658_0365388 Ga0495658_0365388_363_587 74
477 3300048903 Ga0496100_0004548 Ga0496100_0004548_6479_6703 74
478 3300048904 Ga0496101_0058462 Ga0496101_0058462_1085_1309 74
479 3300048904 Ga0496101_1133733 Ga0496101_1133733_242_466 74
480 3300048905 Ga0496102_0001933 Ga0496102_0001933_477_701 74
481 3300048905 Ga0496102_1087246 Ga0496102_1087246_170_394 74
482 3300048906 Ga0496103_0006552 Ga0496103_0006552_5189_5413 74
483 3300048907 Ga0496104_0018692 Ga0496104_0018692_5169_5393 74
484 3300048908 Ga0496105_0026513 Ga0496105_0026513_1712_1936 74
485 3300048909 Ga0496106_0321251 Ga0496106_0321251_37_261 74
486 3300048910 Ga0496107_0458486 Ga0496107_0458486_352_576 74
487 3300048911 Ga0496108_0010015 Ga0496108_0010015_6188_6412 74
488 3300048912 Ga0496109_0067503 Ga0496109_0067503_994_1218 74
489 3300048912 Ga0496109_0328758 Ga0496109_0328758_635_859 74
490 3300048912 Ga0496109_0654205 Ga0496109_0654205_615_839 74
491 3300048913 Ga0496110_0011341 Ga0496110_0011341_2225_2449 74
492 3300048913 Ga0496110_0548394 Ga0496110_0548394_38_262 74
493 3300048913 Ga0496110_0891008 Ga0496110_0891008_186_410 74
494 3300048914 Ga0496111_0090499 Ga0496111_0090499_1413_1637 74
495 3300048914 Ga0496111_0132243 Ga0496111_0132243_350_574 74
496 3300048915 Ga0496112_0433001 Ga0496112_0433001_111_335 74
497 3300048915 Ga0496112_0624683 Ga0496112_0624683_331_555 74
498 3300048916 Ga0496113_0027471 Ga0496113_0027471_1995_2219 74
499 3300048917 Ga0496114_0000754 Ga0496114_0000754_3916_4140 74
500 3300048917 Ga0496114_0579167 Ga0496114_0579167_341_565 74
501 3300048917 Ga0496114_0954993 Ga0496114_0954993_201_425 74
502 3300048918 Ga0496115_0003151 Ga0496115_0003151_9256_9480 74
503 3300048929 Ga0496126_0485631 Ga0496126_0485631_424_648 74
504 3300049568 Ga0501031_0106607 Ga0501031_0106607_429_653 74
505 3300049568 Ga0501031_0266241 Ga0501031_0266241_289_513 74
506 3300049568 Ga0501031_0760673 Ga0501031_0760673_159_383 74
507 3300049569 Ga0501032_0520606 Ga0501032_0520606_429_653 74
508 3300049569 Ga0501032_0527879 Ga0501032_0527879_431_655 74
509 3300049570 Ga0501033_0279375 Ga0501033_0279375_387_611 74
510 3300049570 Ga0501033_0538278 Ga0501033_0538278_298_522 74
511 3300049571 Ga0501034_0608284 Ga0501034_0608284_560_784 74
512 3300049572 Ga0501036_0198551 Ga0501036_0198551_410_634 74
513 3300049572 Ga0501036_0408149 Ga0501036_0408149_182_406 74
514 3300049572 Ga0501036_1359377 Ga0501036_1359377_159_383 74
515 3300049573 Ga0501037_0379891 Ga0501037_0379891_14_238 74
516 3300049574 Ga0501038_0039903 Ga0501038_0039903_1654_1878 74
517 3300049574 Ga0501038_0951603 Ga0501038_0951603_62_286 74
518 3300049575 Ga0501039_0032723 Ga0501039_0032723_1925_2149 74
519 3300049575 Ga0501039_0190840 Ga0501039_0190840_1149_1373 74
520 3300049575 Ga0501039_0814284 Ga0501039_0814284_89_313 74
521 3300049575 Ga0501039_1598811 Ga0501039_1598811_252_476 74
522 3300049576 Ga0501040_0112262 Ga0501040_0112262_664_888 74
523 3300049576 Ga0501040_0145870 Ga0501040_0145870_696_920 74
524 3300049576 Ga0501040_0768086 Ga0501040_0768086_280_504 74
525 3300049576 Ga0501040_0952594 Ga0501040_0952594_212_481 74
526 3300049577 Ga0501041_0265354 Ga0501041_0265354_320_544 74
527 3300049578 Ga0501042_0009829 Ga0501042_0009829_5589_5813 74
528 3300049578 Ga0501042_0321786 Ga0501042_0321786_229_453 74
529 3300049578 Ga0501042_0465587 Ga0501042_0465587_462_686 74
530 3300049578 Ga0501042_0745177 Ga0501042_0745177_278_502 74
531 3300049579 Ga0501043_0785389 Ga0501043_0785389_61_285 74
532 3300049579 Ga0501043_0876861 Ga0501043_0876861_21_245 74
533 3300049579 Ga0501043_0923264 Ga0501043_0923264_186_410 74
534 3300049580 Ga0501046_0314461 Ga0501046_0314461_387_611 74
535 3300049580 Ga0501046_0404340 Ga0501046_0404340_141_365 74
536 3300049581 Ga0501047_0000016 Ga0501047_0000016_79419_79643 74
537 3300049582 Ga0501048_0049622 Ga0501048_0049622_1663_1887 74
538 3300049582 Ga0501048_0290238 Ga0501048_0290238_883_1107 74
539 3300049582 Ga0501048_0746860 Ga0501048_0746860_334_558 74
540 3300049582 Ga0501048_1005937 Ga0501048_1005937_228_452 74
541 3300049582 Ga0501048_1192598 Ga0501048_1192598_55_279 74
542 3300049583 Ga0501067_0114231 Ga0501067_0114231_303_527 74
543 3300049583 Ga0501067_0297363 Ga0501067_0297363_186_410 74
544 3300049584 Ga0501068_0387017 Ga0501068_0387017_495_719 74
545 3300049586 Ga0501070_0273250 Ga0501070_0273250_228_452 74
546 3300049587 Ga0501071_0070983 Ga0501071_0070983_1955_2179 74
547 3300049587 Ga0501071_0084897 Ga0501071_0084897_1287_1511 74
548 3300049587 Ga0501071_0231740 Ga0501071_0231740_648_872 74
549 3300049587 Ga0501071_0430947 Ga0501071_0430947_341_565 74
550 3300049588 Ga0501072_0070590 Ga0501072_0070590_1613_1837 74
551 3300049588 Ga0501072_0464139 Ga0501072_0464139_255_479 74
552 3300049589 Ga0501073_0295930 Ga0501073_0295930_369_593 74
553 3300049591 Ga0501075_0093989 Ga0501075_0093989_684_908 74
554 3300049591 Ga0501075_0157762 Ga0501075_0157762_1147_1371 74
555 3300049592 Ga0501076_0103061 Ga0501076_0103061_1130_1354 74
556 3300049592 Ga0501076_0151714 Ga0501076_0151714_1512_1736 74
557 3300049592 Ga0501076_1063955 Ga0501076_1063955_261_485 74
558 3300049592 Ga0501076_1701555 Ga0501076_1701555_63_287 74
559 3300049593 Ga0501077_0096211 Ga0501077_0096211_1434_1658 74
560 3300049593 Ga0501077_0351802 Ga0501077_0351802_132_356 74
561 3300049593 Ga0501077_0567834 Ga0501077_0567834_75_299 74
562 3300049741 Ga0501079_0187706 Ga0501079_0187706_539_763 74
563 3300049741 Ga0501079_0746296 Ga0501079_0746296_143_367 74
564 3300049741 Ga0501079_0983201 Ga0501079_0983201_143_367 74
565 3300049741 Ga0501079_1339805 Ga0501079_1339805_151_375 74
566 3300049742 Ga0501080_0389323 Ga0501080_0389323_684_908 74
567 3300049742 Ga0501080_1521696 Ga0501080_1521696_312_536 74
568 3300049744 Ga0501083_0178806 Ga0501083_0178806_826_1050 74
569 3300049822 Ga0501035_0163227 Ga0501035_0163227_1271_1495 74
570 3300049822 Ga0501035_0177960 Ga0501035_0177960_657_881 74
571 3300049822 Ga0501035_0798986 Ga0501035_0798986_519_743 74
572 3300049824 Ga0501045_0887451 Ga0501045_0887451_89_313 74
573 3300049824 Ga0501045_0904117 Ga0501045_0904117_216_440 74
574 3300049824 Ga0501045_1096278 Ga0501045_1096278_308_532 74
575 3300050491 nmdc:mga00v17_338032_c1 nmdc:mga00v17_338032_c1_215_439 74
576 3300050492 nmdc:mga0yw44_233893_c1 nmdc:mga0yw44_233893_c1_195_419 74
577 3300050492 nmdc:mga0yw44_23725_c1 nmdc:mga0yw44_23725_c1_3179_3403 74
578 3300050492 nmdc:mga0yw44_482068_c1 nmdc:mga0yw44_482068_c1_196_420 74
579 3300050492 nmdc:mga0yw44_5408_c1 nmdc:mga0yw44_5408_c1_5315_5539 74
580 3300050508 nmdc:mga09592_593698_c1 nmdc:mga09592_593698_c1_110_379 74
581 3300050508 nmdc:mga09592_731910_c1 nmdc:mga09592_731910_c1_51_275 74
582 3300050510 nmdc:mga06r32_1075476_c1 nmdc:mga06r32_1075476_c1_113_382 74
583 3300050510 nmdc:mga06r32_2046_c1 nmdc:mga06r32_2046_c1_17660_17884 74
584 3300050511 nmdc:mga08y16_1199980_c1 nmdc:mga08y16_1199980_c1_367_591 74
585 3300050511 nmdc:mga08y16_177347_c1 nmdc:mga08y16_177347_c1_960_1184 74
586 3300050511 nmdc:mga08y16_308016_c1 nmdc:mga08y16_308016_c1_1095_1319 74
587 3300050511 nmdc:mga08y16_507572_c1 nmdc:mga08y16_507572_c1_395_619 74
588 3300050511 nmdc:mga08y16_71164_c1 nmdc:mga08y16_71164_c1_2845_3114 74
589 3300050512 nmdc:mga0n895_98099_c1 nmdc:mga0n895_98099_c1_492_716 74
590 3300050513 nmdc:mga0rr50_1020725_c1 nmdc:mga0rr50_1020725_c1_311_535 74
591 3300050513 nmdc:mga0rr50_432696_c1 nmdc:mga0rr50_432696_c1_10_234 74
592 3300050515 nmdc:mga0a205_321543_c1 nmdc:mga0a205_321543_c1_652_876 74
593 3300054114 Ga0501084_0285262 Ga0501084_0285262_934_1158 74
594 3300054114 Ga0501084_1068263 Ga0501084_1068263_12_236 74
595 3300060353 Ga0501082_0246983 Ga0501082_0246983_1112_1336 74
596 3300060353 Ga0501082_0814752 Ga0501082_0814752_349_573 74
597 3300060353 Ga0501082_1918501 Ga0501082_1918501_158_382 74
598 3300061719 Ga0466962_0041964 Ga0466962_0041964_1922_2155 74
599 3300061719 Ga0466962_0278093 Ga0466962_0278093_418_642 74
600 3300061734 Ga0530510_0653316 Ga0530510_0653316_427_651 74
601 3300061734 Ga0530510_0807635 Ga0530510_0807635_184_408 74
602 3300061734 Ga0530510_1451847 Ga0530510_1451847_219_443 74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mkv-assembly1.cif.gz_S structure of pisum sativum rubisco with aba 0.5892 27 55
3axk-assembly1.cif.gz_S structure of rice rubisco in complex with nadp(h) 0.5556 22 53
2o5h-assembly1.cif.gz_A uncharacterized protein conserved in bacteria, cog3792 from neisseria meningitidis 0.5547 21 55
1wmh-assembly1.cif.gz_A crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha 0.5495 1 67
1oey-assembly1.cif.gz_A heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase 0.5159 2 69
ID Description Score Start End Superfamily
af_A4HYW3_368_509_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7353 21 51 3.90.70.10
af_Q4DJS8_372_526_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.726 21 51 3.90.70.10
af_G5EEZ6_321_454_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6775 22 50 3.90.70.10
af_Q2FYJ0_45_287_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6622 41 68 3.40.50.300
af_A0A0G2KAS0_736_870_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6293 22 53 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A537ZWT6-F1-model_v4 GNAT family N-acetyltransferase 0.9552 1 74
AF-A0A317H9H7-F1-model_v4 Uncharacterized protein 0.9223 2 74
AF-A0A7Y4GSS0-F1-model_v4 Uncharacterized protein 0.922 1 74
AF-A0A6J4RNN7-F1-model_v4 Uncharacterized protein 0.9217 1 74
AF-A0A1U7CWG1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9129 1 74

Feature Viewer

pLDDT pTM Quality
91.57 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map