F468142
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 602 | 254 | 602 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_100614667|Ga0070673_1006146671 |
| Length | 90 |
| Sequence | MTIRTEYIHPERTISSMARLIRMDDTGHTTLAEWTAADEPAVEAAVTAFREQLDAGFYAVVTEGEGRARQVDELPLDAELVILRRPIAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 200 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 244 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 254 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.5 |
| Nodule | 0 |
| Rhizoplane | 4.49 |
| Rhizosphere | 92.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10333507 | 3300003323 | Bacteria | 1960 |
| 2 | Ga0070683_100233257 | 3300005329 | Unclassified | 1750 |
| 3 | Ga0070683_100287663 | 3300005329 | Bacteria | 1563 |
| 4 | Ga0068869_101276996 | 3300005334 | Unclassified | 647 |
| 5 | Ga0070666_10768017 | 3300005335 | Bacteria | 709 |
| 6 | Ga0070682_100154423 | 3300005337 | Bacteria | 1578 |
| 7 | Ga0070682_100305137 | 3300005337 | Bacteria | 1170 |
| 8 | Ga0070682_101349528 | 3300005337 | Bacteria | 608 |
| 9 | Ga0070682_101588569 | 3300005337 | Unclassified | 565 |
| 10 | Ga0068868_100175694 | 3300005338 | Bacteria | 1775 |
| 11 | Ga0068868_100176256 | 3300005338 | Bacteria | 1772 |
| 12 | Ga0068868_100239924 | 3300005338 | Bacteria | 1522 |
| 13 | Ga0070660_100113264 | 3300005339 | Bacteria | 2160 |
| 14 | Ga0070660_101331123 | 3300005339 | Unclassified | 610 |
| 15 | Ga0070660_101472653 | 3300005339 | Bacteria | 579 |
| 16 | Ga0070660_101498226 | 3300005339 | Unclassified | 574 |
| 17 | Ga0070660_101696027 | 3300005339 | Bacteria | 538 |
| 18 | Ga0070689_100851435 | 3300005340 | Bacteria | 804 |
| 19 | Ga0070691_10158158 | 3300005341 | Bacteria | 1166 |
| 20 | Ga0070691_10605189 | 3300005341 | Bacteria | 647 |
| 21 | Ga0070691_10884417 | 3300005341 | Bacteria | 550 |
| 22 | Ga0070687_100184666 | 3300005343 | Unclassified | 1252 |
| 23 | Ga0070687_100210027 | 3300005343 | Bacteria | 1185 |
| 24 | Ga0070687_101011921 | 3300005343 | Unclassified | 603 |
| 25 | Ga0070661_100824447 | 3300005344 | Bacteria | 762 |
| 26 | Ga0070661_101521559 | 3300005344 | Bacteria | 565 |
| 27 | Ga0070692_10180965 | 3300005345 | Bacteria | 1222 |
| 28 | Ga0070692_10293129 | 3300005345 | Bacteria | 991 |
| 29 | Ga0070692_10403831 | 3300005345 | Bacteria | 863 |
| 30 | Ga0070692_10771532 | 3300005345 | Bacteria | 654 |
| 31 | Ga0070668_100295685 | 3300005347 | Bacteria | 1357 |
| 32 | Ga0070668_100367106 | 3300005347 | Bacteria | 1222 |
| 33 | Ga0070669_100763125 | 3300005353 | Bacteria | 820 |
| 34 | Ga0070675_100864872 | 3300005354 | Bacteria | 828 |
| 35 | Ga0070675_101276152 | 3300005354 | Bacteria | 677 |
| 36 | Ga0070671_101353519 | 3300005355 | Bacteria | 628 |
| 37 | Ga0070674_100621895 | 3300005356 | Bacteria | 915 |
| 38 | Ga0070673_100614667 | 3300005364 | Bacteria | 992 |
| 39 | Ga0070673_102380166 | 3300005364 | Bacteria | 503 |
| 40 | Ga0070659_100390397 | 3300005366 | Bacteria | 1174 |
| 41 | Ga0070659_100960899 | 3300005366 | Bacteria | 749 |
| 42 | Ga0070710_10618161 | 3300005437 | Bacteria | 756 |
| 43 | Ga0070701_10955119 | 3300005438 | Bacteria | 595 |
| 44 | Ga0070711_100008029 | 3300005439 | Bacteria | 6443 |
| 45 | Ga0070705_100189233 | 3300005440 | Bacteria | 1401 |
| 46 | Ga0070705_100574918 | 3300005440 | Unclassified | 868 |
| 47 | Ga0070705_101689488 | 3300005440 | Unclassified | 535 |
| 48 | Ga0070705_101861195 | 3300005440 | Bacteria | 511 |
| 49 | Ga0070700_100288099 | 3300005441 | Bacteria | 1193 |
| 50 | Ga0070700_100940282 | 3300005441 | Bacteria | 707 |
| 51 | Ga0070708_100925750 | 3300005445 | Bacteria | 818 |
| 52 | Ga0070663_100128433 | 3300005455 | Bacteria | 1922 |
| 53 | Ga0070663_100264277 | 3300005455 | Bacteria | 1366 |
| 54 | Ga0070663_100652953 | 3300005455 | Bacteria | 890 |
| 55 | Ga0070663_102128393 | 3300005455 | Bacteria | 506 |
| 56 | Ga0070678_100032452 | 3300005456 | Bacteria | 3615 |
| 57 | Ga0070678_100335807 | 3300005456 | Bacteria | 1295 |
| 58 | Ga0070678_101389577 | 3300005456 | Bacteria | 655 |
| 59 | Ga0070662_100341035 | 3300005457 | Bacteria | 1226 |
| 60 | Ga0070662_100520608 | 3300005457 | Bacteria | 994 |
| 61 | Ga0070662_101062227 | 3300005457 | Bacteria | 694 |
| 62 | Ga0070681_10107611 | 3300005458 | Bacteria | 2728 |
| 63 | Ga0070681_11264274 | 3300005458 | Bacteria | 661 |
| 64 | Ga0068867_100061715 | 3300005459 | Bacteria | 2784 |
| 65 | Ga0068867_100062732 | 3300005459 | Bacteria | 2762 |
| 66 | Ga0068867_100955038 | 3300005459 | Bacteria | 774 |
| 67 | Ga0070685_10680817 | 3300005466 | Bacteria | 748 |
| 68 | Ga0070685_10683845 | 3300005466 | Bacteria | 747 |
| 69 | Ga0070706_100278167 | 3300005467 | Bacteria | 1562 |
| 70 | Ga0070679_101499915 | 3300005530 | Bacteria | 621 |
| 71 | Ga0070679_101877429 | 3300005530 | Unclassified | 548 |
| 72 | Ga0070684_100447717 | 3300005535 | Bacteria | 1193 |
| 73 | Ga0070684_101478993 | 3300005535 | Bacteria | 640 |
| 74 | Ga0068853_100328897 | 3300005539 | Bacteria | 1418 |
| 75 | Ga0070672_101009067 | 3300005543 | Bacteria | 738 |
| 76 | Ga0070672_101219448 | 3300005543 | Bacteria | 671 |
| 77 | Ga0070672_101347507 | 3300005543 | Bacteria | 638 |
| 78 | Ga0070686_100073861 | 3300005544 | Bacteria | 2240 |
| 79 | Ga0070695_100480876 | 3300005545 | Bacteria | 957 |
| 80 | Ga0070693_100405249 | 3300005547 | Bacteria | 947 |
| 81 | Ga0070665_100244411 | 3300005548 | Bacteria | 1795 |
| 82 | Ga0070665_100866631 | 3300005548 | Bacteria | 916 |
| 83 | Ga0070704_100053691 | 3300005549 | Bacteria | 2849 |
| 84 | Ga0070704_100614175 | 3300005549 | Bacteria | 957 |
| 85 | Ga0070704_101808139 | 3300005549 | Unclassified | 565 |
| 86 | Ga0070664_100140859 | 3300005564 | Bacteria | 2123 |
| 87 | Ga0070664_101685351 | 3300005564 | Bacteria | 601 |
| 88 | Ga0068857_100203811 | 3300005577 | Bacteria | 1804 |
| 89 | Ga0068857_101435205 | 3300005577 | Bacteria | 672 |
| 90 | Ga0068854_100235104 | 3300005578 | Bacteria | 1456 |
| 91 | Ga0068854_100692911 | 3300005578 | Bacteria | 879 |
| 92 | Ga0070702_100443106 | 3300005615 | Bacteria | 940 |
| 93 | Ga0070702_100568135 | 3300005615 | Bacteria | 845 |
| 94 | Ga0070702_100632495 | 3300005615 | Bacteria | 807 |
| 95 | Ga0068852_100178067 | 3300005616 | Bacteria | 1998 |
| 96 | Ga0068852_100632185 | 3300005616 | Bacteria | 1077 |
| 97 | Ga0068852_102214717 | 3300005616 | Bacteria | 571 |
| 98 | Ga0068852_102826375 | 3300005616 | Bacteria | 504 |
| 99 | Ga0068859_100996757 | 3300005617 | Bacteria | 920 |
| 100 | Ga0068864_100080512 | 3300005618 | Bacteria | 2854 |
| 101 | Ga0068864_101765786 | 3300005618 | Bacteria | 624 |
| 102 | Ga0068864_102415237 | 3300005618 | Bacteria | 532 |
| 103 | Ga0068866_10175648 | 3300005718 | Bacteria | 1261 |
| 104 | Ga0068866_10247705 | 3300005718 | Bacteria | 1088 |
| 105 | Ga0068866_10431993 | 3300005718 | Bacteria | 857 |
| 106 | Ga0068866_10931215 | 3300005718 | Bacteria | 613 |
| 107 | Ga0068861_100056451 | 3300005719 | Bacteria | 2998 |
| 108 | Ga0068861_101502755 | 3300005719 | Bacteria | 661 |
| 109 | Ga0068870_10174651 | 3300005840 | Bacteria | 1285 |
| 110 | Ga0068870_10238232 | 3300005840 | Bacteria | 1122 |
| 111 | Ga0068870_10293941 | 3300005840 | Bacteria | 1023 |
| 112 | Ga0068870_10302013 | 3300005840 | Bacteria | 1011 |
| 113 | Ga0068863_101154704 | 3300005841 | Unclassified | 780 |
| 114 | Ga0068858_100363732 | 3300005842 | Bacteria | 1387 |
| 115 | Ga0068858_100572527 | 3300005842 | Unclassified | 1094 |
| 116 | Ga0068860_100716491 | 3300005843 | Bacteria | 1011 |
| 117 | Ga0081455_10171666 | 3300005937 | Bacteria | 1651 |
| 118 | Ga0081455_10218560 | 3300005937 | Bacteria | 1414 |
| 119 | Ga0081538_10000010 | 3300005981 | Bacteria | 164857 |
| 120 | Ga0081538_10000782 | 3300005981 | Bacteria | 34716 |
| 121 | Ga0081538_10001106 | 3300005981 | Bacteria | 28562 |
| 122 | Ga0081538_10005959 | 3300005981 | Bacteria | 10848 |
| 123 | Ga0081538_10031100 | 3300005981 | Bacteria | 3609 |
| 124 | Ga0081538_10034278 | 3300005981 | Bacteria | 3358 |
| 125 | Ga0081538_10080990 | 3300005981 | Bacteria | 1729 |
| 126 | Ga0081538_10146118 | 3300005981 | Bacteria | 1080 |
| 127 | Ga0081538_10168441 | 3300005981 | Bacteria | 960 |
| 128 | Ga0081539_10004209 | 3300005985 | Bacteria | 16230 |
| 129 | Ga0081539_10029416 | 3300005985 | Bacteria | 3432 |
| 130 | Ga0070717_10001893 | 3300006028 | Bacteria | 14637 |
| 131 | Ga0075365_10004732 | 3300006038 | Bacteria | 7260 |
| 132 | Ga0075365_10021624 | 3300006038 | Bacteria | 4015 |
| 133 | Ga0075364_10036804 | 3300006051 | Bacteria | 3166 |
| 134 | Ga0075432_10561442 | 3300006058 | Bacteria | 517 |
| 135 | Ga0070716_100234448 | 3300006173 | Bacteria | 1241 |
| 136 | Ga0070712_100016970 | 3300006175 | Bacteria | 4707 |
| 137 | Ga0075367_10633629 | 3300006178 | Bacteria | 680 |
| 138 | Ga0097621_100479618 | 3300006237 | Bacteria | 1124 |
| 139 | Ga0097621_101698862 | 3300006237 | Bacteria | 601 |
| 140 | Ga0075428_100026541 | 3300006844 | Bacteria | 6411 |
| 141 | Ga0075428_100696018 | 3300006844 | Bacteria | 1083 |
| 142 | Ga0075428_102609958 | 3300006844 | Bacteria | 516 |
| 143 | Ga0075430_100771021 | 3300006846 | Bacteria | 793 |
| 144 | Ga0075431_100000718 | 3300006847 | Bacteria | 28538 |
| 145 | Ga0075431_100664385 | 3300006847 | Bacteria | 1022 |
| 146 | Ga0075431_101848983 | 3300006847 | Bacteria | 560 |
| 147 | Ga0075433_10863256 | 3300006852 | Bacteria | 790 |
| 148 | Ga0075433_10927013 | 3300006852 | Bacteria | 759 |
| 149 | Ga0075434_100450650 | 3300006871 | Bacteria | 1308 |
| 150 | Ga0075434_100452000 | 3300006871 | Bacteria | 1306 |
| 151 | Ga0075429_101760500 | 3300006880 | Bacteria | 538 |
| 152 | Ga0068865_100069528 | 3300006881 | Bacteria | 2491 |
| 153 | Ga0068865_100397582 | 3300006881 | Bacteria | 1128 |
| 154 | Ga0068865_101287418 | 3300006881 | Bacteria | 650 |
| 155 | Ga0075436_100331083 | 3300006914 | Bacteria | 1095 |
| 156 | Ga0097620_100996746 | 3300006931 | Bacteria | 920 |
| 157 | Ga0075435_101257917 | 3300007076 | Bacteria | 648 |
| 158 | Ga0105240_11778623 | 3300009093 | Bacteria | 642 |
| 159 | Ga0111539_10006858 | 3300009094 | Bacteria | 14633 |
| 160 | Ga0111539_10081910 | 3300009094 | Bacteria | 3796 |
| 161 | Ga0111539_10444345 | 3300009094 | Bacteria | 1510 |
| 162 | Ga0111539_10604637 | 3300009094 | Bacteria | 1277 |
| 163 | Ga0111539_11112596 | 3300009094 | Bacteria | 918 |
| 164 | Ga0111539_11271591 | 3300009094 | Bacteria | 854 |
| 165 | Ga0111539_12826634 | 3300009094 | Bacteria | 562 |
| 166 | Ga0105245_10002619 | 3300009098 | Bacteria | 16206 |
| 167 | Ga0105245_10046340 | 3300009098 | Bacteria | 3885 |
| 168 | Ga0105245_10124790 | 3300009098 | Bacteria | 2408 |
| 169 | Ga0105247_10123331 | 3300009101 | Bacteria | 1681 |
| 170 | Ga0105247_10377833 | 3300009101 | Bacteria | 1004 |
| 171 | Ga0105247_11235890 | 3300009101 | Bacteria | 597 |
| 172 | Ga0114129_11251418 | 3300009147 | Unclassified | 922 |
| 173 | Ga0105243_10058843 | 3300009148 | Bacteria | 3064 |
| 174 | Ga0105243_10143939 | 3300009148 | Bacteria | 2037 |
| 175 | Ga0105243_10176276 | 3300009148 | Bacteria | 1856 |
| 176 | Ga0105243_10834752 | 3300009148 | Bacteria | 911 |
| 177 | Ga0105243_11497594 | 3300009148 | Bacteria | 698 |
| 178 | Ga0105243_11590347 | 3300009148 | Bacteria | 680 |
| 179 | Ga0105242_10080370 | 3300009176 | Bacteria | 2724 |
| 180 | Ga0105242_10468908 | 3300009176 | Bacteria | 1191 |
| 181 | Ga0105242_11007867 | 3300009176 | Bacteria | 841 |
| 182 | Ga0105242_12704626 | 3300009176 | Bacteria | 546 |
| 183 | Ga0105248_10490741 | 3300009177 | Bacteria | 1384 |
| 184 | Ga0105237_11075869 | 3300009545 | Bacteria | 811 |
| 185 | Ga0105238_11739644 | 3300009551 | Bacteria | 655 |
| 186 | Ga0105249_10365507 | 3300009553 | Bacteria | 1465 |
| 187 | Ga0105249_12584839 | 3300009553 | Bacteria | 580 |
| 188 | Ga0105239_10111962 | 3300010375 | Bacteria | 3026 |
| 189 | Ga0105239_11057780 | 3300010375 | Bacteria | 934 |
| 190 | Ga0105239_11062540 | 3300010375 | Unclassified | 932 |
| 191 | Ga0105239_11916002 | 3300010375 | Unclassified | 687 |
| 192 | Ga0105246_10075007 | 3300011119 | Bacteria | 2393 |
| 193 | Ga0105246_11924362 | 3300011119 | Bacteria | 568 |
| 194 | Ga0105246_11975120 | 3300011119 | Unclassified | 562 |
| 195 | Ga0157341_1040465 | 3300012494 | Bacteria | 538 |
| 196 | Ga0157369_10911739 | 3300013105 | Bacteria | 901 |
| 197 | Ga0157374_10236147 | 3300013296 | Bacteria | 1797 |
| 198 | Ga0157378_10339362 | 3300013297 | Bacteria | 1465 |
| 199 | Ga0157378_12879603 | 3300013297 | Bacteria | 533 |
| 200 | Ga0163162_10413045 | 3300013306 | Bacteria | 1482 |
| 201 | Ga0163162_10530322 | 3300013306 | Bacteria | 1307 |
| 202 | Ga0157372_11524261 | 3300013307 | Unclassified | 770 |
| 203 | Ga0157372_12310794 | 3300013307 | Unclassified | 618 |
| 204 | Ga0157372_12675987 | 3300013307 | Bacteria | 572 |
| 205 | Ga0157372_13406497 | 3300013307 | Bacteria | 506 |
| 206 | Ga0157375_10134499 | 3300013308 | Bacteria | 2594 |
| 207 | Ga0157375_11334397 | 3300013308 | Bacteria | 844 |
| 208 | Ga0157375_11920527 | 3300013308 | Unclassified | 703 |
| 209 | Ga0163163_10317158 | 3300014325 | Bacteria | 1612 |
| 210 | Ga0163163_12170012 | 3300014325 | Bacteria | 615 |
| 211 | Ga0157380_10543260 | 3300014326 | Bacteria | 1138 |
| 212 | Ga0157380_10967145 | 3300014326 | Bacteria | 882 |
| 213 | Ga0182008_10426634 | 3300014497 | Bacteria | 717 |
| 214 | Ga0157377_10136351 | 3300014745 | Unclassified | 1504 |
| 215 | Ga0157379_11358610 | 3300014968 | Bacteria | 688 |
| 216 | Ga0157376_10695904 | 3300014969 | Bacteria | 1021 |
| 217 | Ga0157376_10860262 | 3300014969 | Bacteria | 923 |
| 218 | Ga0163161_11084281 | 3300017792 | Bacteria | 688 |
| 219 | Ga0163161_11260956 | 3300017792 | Bacteria | 641 |
| 220 | Ga0197907_10086063 | 3300020069 | Bacteria | 813 |
| 221 | Ga0206356_11727012 | 3300020070 | Bacteria | 644 |
| 222 | Ga0213876_10435798 | 3300021384 | Unclassified | 697 |
| 223 | Ga0213875_10646476 | 3300021388 | Unclassified | 512 |
| 224 | Ga0224712_10296668 | 3300022467 | Bacteria | 755 |
| 225 | Ga0224712_10325422 | 3300022467 | Unclassified | 723 |
| 226 | Ga0207653_10119085 | 3300025885 | Bacteria | 949 |
| 227 | Ga0207692_10363199 | 3300025898 | Bacteria | 895 |
| 228 | Ga0207642_10083047 | 3300025899 | Bacteria | 1561 |
| 229 | Ga0207642_10122079 | 3300025899 | Bacteria | 1346 |
| 230 | Ga0207642_10696455 | 3300025899 | Bacteria | 640 |
| 231 | Ga0207642_11102574 | 3300025899 | Bacteria | 513 |
| 232 | Ga0207710_10417382 | 3300025900 | Bacteria | 690 |
| 233 | Ga0207688_10014067 | 3300025901 | Bacteria | 4351 |
| 234 | Ga0207688_10029458 | 3300025901 | Bacteria | 3023 |
| 235 | Ga0207680_11367069 | 3300025903 | Bacteria | 503 |
| 236 | Ga0207645_10861901 | 3300025907 | Bacteria | 616 |
| 237 | Ga0207643_10096696 | 3300025908 | Bacteria | 1727 |
| 238 | Ga0207643_10231375 | 3300025908 | Bacteria | 1134 |
| 239 | Ga0207705_10392478 | 3300025909 | Bacteria | 1073 |
| 240 | Ga0207705_10429268 | 3300025909 | Bacteria | 1024 |
| 241 | Ga0207654_11422715 | 3300025911 | Bacteria | 506 |
| 242 | Ga0207707_11244015 | 3300025912 | Bacteria | 601 |
| 243 | Ga0207693_10014737 | 3300025915 | Bacteria | 6280 |
| 244 | Ga0207663_10026726 | 3300025916 | Bacteria | 3354 |
| 245 | Ga0207660_10704950 | 3300025917 | Bacteria | 823 |
| 246 | Ga0207660_11726806 | 3300025917 | Bacteria | 503 |
| 247 | Ga0207662_10109619 | 3300025918 | Bacteria | 1720 |
| 248 | Ga0207662_10235924 | 3300025918 | Bacteria | 1196 |
| 249 | Ga0207662_10263559 | 3300025918 | Bacteria | 1135 |
| 250 | Ga0207662_10948642 | 3300025918 | Bacteria | 610 |
| 251 | Ga0207657_10078979 | 3300025919 | Bacteria | 2769 |
| 252 | Ga0207657_10181447 | 3300025919 | Bacteria | 1701 |
| 253 | Ga0207657_10359664 | 3300025919 | Unclassified | 1147 |
| 254 | Ga0207657_10946241 | 3300025919 | Bacteria | 662 |
| 255 | Ga0207657_11449889 | 3300025919 | Bacteria | 514 |
| 256 | Ga0207649_10978909 | 3300025920 | Bacteria | 665 |
| 257 | Ga0207652_10305021 | 3300025921 | Bacteria | 1437 |
| 258 | Ga0207652_10480592 | 3300025921 | Bacteria | 1119 |
| 259 | Ga0207652_11549818 | 3300025921 | Unclassified | 567 |
| 260 | Ga0207646_10881393 | 3300025922 | Bacteria | 794 |
| 261 | Ga0207681_10893660 | 3300025923 | Bacteria | 744 |
| 262 | Ga0207687_10092674 | 3300025927 | Bacteria | 2207 |
| 263 | Ga0207687_10598508 | 3300025927 | Bacteria | 929 |
| 264 | Ga0207687_10677401 | 3300025927 | Bacteria | 874 |
| 265 | Ga0207687_11336327 | 3300025927 | Bacteria | 616 |
| 266 | Ga0207644_10446592 | 3300025931 | Bacteria | 1062 |
| 267 | Ga0207644_11807589 | 3300025931 | Bacteria | 511 |
| 268 | Ga0207690_11029459 | 3300025932 | Unclassified | 685 |
| 269 | Ga0207690_11250238 | 3300025932 | Bacteria | 620 |
| 270 | Ga0207690_11380367 | 3300025932 | Bacteria | 589 |
| 271 | Ga0207706_10214064 | 3300025933 | Bacteria | 1688 |
| 272 | Ga0207706_10264629 | 3300025933 | Bacteria | 1501 |
| 273 | Ga0207706_10691788 | 3300025933 | Bacteria | 872 |
| 274 | Ga0207706_10992076 | 3300025933 | Bacteria | 706 |
| 275 | Ga0207706_11189012 | 3300025933 | Bacteria | 634 |
| 276 | Ga0207686_10168770 | 3300025934 | Bacteria | 1541 |
| 277 | Ga0207686_10276287 | 3300025934 | Unclassified | 1238 |
| 278 | Ga0207686_10404986 | 3300025934 | Bacteria | 1040 |
| 279 | Ga0207709_10034617 | 3300025935 | Bacteria | 2978 |
| 280 | Ga0207709_10052158 | 3300025935 | Bacteria | 2510 |
| 281 | Ga0207709_10086289 | 3300025935 | Bacteria | 2037 |
| 282 | Ga0207669_10231499 | 3300025937 | Bacteria | 1363 |
| 283 | Ga0207704_10202826 | 3300025938 | Bacteria | 1453 |
| 284 | Ga0207665_10039404 | 3300025939 | Bacteria | 3151 |
| 285 | Ga0207691_10149468 | 3300025940 | Bacteria | 2054 |
| 286 | Ga0207691_10162900 | 3300025940 | Bacteria | 1955 |
| 287 | Ga0207691_11662043 | 3300025940 | Bacteria | 518 |
| 288 | Ga0207711_10585693 | 3300025941 | Bacteria | 1041 |
| 289 | Ga0207689_10178869 | 3300025942 | Bacteria | 1749 |
| 290 | Ga0207689_10514479 | 3300025942 | Bacteria | 1003 |
| 291 | Ga0207661_10071790 | 3300025944 | Bacteria | 2831 |
| 292 | Ga0207661_10131854 | 3300025944 | Bacteria | 2142 |
| 293 | Ga0207661_10343920 | 3300025944 | Bacteria | 1345 |
| 294 | Ga0207661_10592676 | 3300025944 | Unclassified | 1017 |
| 295 | Ga0207661_10595554 | 3300025944 | Bacteria | 1014 |
| 296 | Ga0207679_10675031 | 3300025945 | Bacteria | 936 |
| 297 | Ga0207679_11689787 | 3300025945 | Bacteria | 579 |
| 298 | Ga0207679_11999530 | 3300025945 | Bacteria | 528 |
| 299 | Ga0207651_10967584 | 3300025960 | Bacteria | 760 |
| 300 | Ga0207668_10279276 | 3300025972 | Bacteria | 1369 |
| 301 | Ga0207668_10632351 | 3300025972 | Bacteria | 935 |
| 302 | Ga0207677_10064634 | 3300026023 | Bacteria | 2549 |
| 303 | Ga0207677_10095798 | 3300026023 | Bacteria | 2170 |
| 304 | Ga0207677_10117939 | 3300026023 | Bacteria | 1990 |
| 305 | Ga0207677_10132454 | 3300026023 | Bacteria | 1895 |
| 306 | Ga0207677_12110330 | 3300026023 | Bacteria | 524 |
| 307 | Ga0207703_10478632 | 3300026035 | Bacteria | 1166 |
| 308 | Ga0207703_11836229 | 3300026035 | Bacteria | 582 |
| 309 | Ga0207639_11726373 | 3300026041 | Unclassified | 586 |
| 310 | Ga0207678_10138904 | 3300026067 | Bacteria | 2073 |
| 311 | Ga0207678_10429770 | 3300026067 | Bacteria | 1146 |
| 312 | Ga0207708_10081309 | 3300026075 | Bacteria | 2490 |
| 313 | Ga0207708_10654530 | 3300026075 | Bacteria | 894 |
| 314 | Ga0207708_10800563 | 3300026075 | Bacteria | 811 |
| 315 | Ga0207708_11345909 | 3300026075 | Bacteria | 626 |
| 316 | Ga0207641_10896161 | 3300026088 | Bacteria | 881 |
| 317 | Ga0207641_11019470 | 3300026088 | Bacteria | 825 |
| 318 | Ga0207648_10112472 | 3300026089 | Bacteria | 2391 |
| 319 | Ga0207648_10429480 | 3300026089 | Bacteria | 1201 |
| 320 | Ga0207648_10873584 | 3300026089 | Bacteria | 839 |
| 321 | Ga0207648_11254459 | 3300026089 | Bacteria | 696 |
| 322 | Ga0207676_11442513 | 3300026095 | Bacteria | 685 |
| 323 | Ga0207676_11627937 | 3300026095 | Unclassified | 644 |
| 324 | Ga0207674_10949629 | 3300026116 | Bacteria | 828 |
| 325 | Ga0207674_11351541 | 3300026116 | Unclassified | 682 |
| 326 | Ga0207674_11504681 | 3300026116 | Bacteria | 642 |
| 327 | Ga0207674_12281796 | 3300026116 | Bacteria | 503 |
| 328 | Ga0207675_100231855 | 3300026118 | Bacteria | 1781 |
| 329 | Ga0207675_102260568 | 3300026118 | Unclassified | 558 |
| 330 | Ga0207683_10015073 | 3300026121 | Bacteria | 6579 |
| 331 | Ga0207683_10040071 | 3300026121 | Bacteria | 4086 |
| 332 | Ga0207683_11768885 | 3300026121 | Bacteria | 567 |
| 333 | Ga0207698_10326451 | 3300026142 | Unclassified | 1440 |
| 334 | Ga0207698_10568728 | 3300026142 | Bacteria | 1113 |
| 335 | Ga0207698_10702790 | 3300026142 | Bacteria | 1006 |
| 336 | Ga0207698_10957573 | 3300026142 | Bacteria | 865 |
| 337 | Ga0207698_11038774 | 3300026142 | Bacteria | 831 |
| 338 | Ga0207428_10041239 | 3300027907 | Bacteria | 3738 |
| 339 | Ga0207428_10126061 | 3300027907 | Bacteria | 1961 |
| 340 | Ga0207428_10923100 | 3300027907 | Bacteria | 616 |
| 341 | Ga0268265_10257360 | 3300028380 | Bacteria | 1550 |
| 342 | Ga0268265_10622042 | 3300028380 | Unclassified | 1035 |
| 343 | Ga0268264_10263126 | 3300028381 | Unclassified | 1608 |
| 344 | Ga0307408_100587949 | 3300031548 | Bacteria | 987 |
| 345 | Ga0307405_10065663 | 3300031731 | Bacteria | 2311 |
| 346 | Ga0307405_10173247 | 3300031731 | Bacteria | 1541 |
| 347 | Ga0307405_10205494 | 3300031731 | Bacteria | 1434 |
| 348 | Ga0307405_10990548 | 3300031731 | Bacteria | 716 |
| 349 | Ga0307405_11879886 | 3300031731 | Bacteria | 534 |
| 350 | Ga0307413_10001054 | 3300031824 | Bacteria | 10012 |
| 351 | Ga0307413_10462902 | 3300031824 | Bacteria | 1009 |
| 352 | Ga0307413_10744303 | 3300031824 | Bacteria | 819 |
| 353 | Ga0307413_11316927 | 3300031824 | Bacteria | 632 |
| 354 | Ga0307413_11679990 | 3300031824 | Bacteria | 566 |
| 355 | Ga0307413_11772130 | 3300031824 | Bacteria | 552 |
| 356 | Ga0307413_11899157 | 3300031824 | Bacteria | 535 |
| 357 | Ga0307410_10015235 | 3300031852 | Bacteria | 4554 |
| 358 | Ga0307410_10047592 | 3300031852 | Bacteria | 2867 |
| 359 | Ga0307410_10139899 | 3300031852 | Bacteria | 1789 |
| 360 | Ga0307410_10387369 | 3300031852 | Unclassified | 1126 |
| 361 | Ga0307410_10481713 | 3300031852 | Unclassified | 1018 |
| 362 | Ga0307410_10870641 | 3300031852 | Bacteria | 770 |
| 363 | Ga0307410_11172754 | 3300031852 | Unclassified | 668 |
| 364 | Ga0307410_11729496 | 3300031852 | Bacteria | 554 |
| 365 | Ga0307406_10187802 | 3300031901 | Unclassified | 1510 |
| 366 | Ga0307406_10217302 | 3300031901 | Unclassified | 1418 |
| 367 | Ga0307406_10261312 | 3300031901 | Bacteria | 1310 |
| 368 | Ga0307406_10505694 | 3300031901 | Bacteria | 980 |
| 369 | Ga0307406_10688304 | 3300031901 | Bacteria | 852 |
| 370 | Ga0307406_10707754 | 3300031901 | Bacteria | 842 |
| 371 | Ga0307406_10932554 | 3300031901 | Bacteria | 741 |
| 372 | Ga0307407_10058721 | 3300031903 | Bacteria | 2237 |
| 373 | Ga0307407_10379307 | 3300031903 | Bacteria | 1009 |
| 374 | Ga0307407_11019568 | 3300031903 | Bacteria | 640 |
| 375 | Ga0307412_10142793 | 3300031911 | Bacteria | 1756 |
| 376 | Ga0307409_100001468 | 3300031995 | Bacteria | 11612 |
| 377 | Ga0307409_100004528 | 3300031995 | Bacteria | 7828 |
| 378 | Ga0307409_100250705 | 3300031995 | Unclassified | 1618 |
| 379 | Ga0307409_100403793 | 3300031995 | Bacteria | 1306 |
| 380 | Ga0307409_100428458 | 3300031995 | Bacteria | 1271 |
| 381 | Ga0307409_100589489 | 3300031995 | Bacteria | 1097 |
| 382 | Ga0307409_101542280 | 3300031995 | Bacteria | 692 |
| 383 | Ga0307409_101837620 | 3300031995 | Bacteria | 635 |
| 384 | Ga0307409_101997875 | 3300031995 | Bacteria | 609 |
| 385 | Ga0307416_100041040 | 3300032002 | Bacteria | 3601 |
| 386 | Ga0307416_100278960 | 3300032002 | Unclassified | 1646 |
| 387 | Ga0307416_100297717 | 3300032002 | Bacteria | 1601 |
| 388 | Ga0307416_100375097 | 3300032002 | Unclassified | 1450 |
| 389 | Ga0307416_100748374 | 3300032002 | Bacteria | 1070 |
| 390 | Ga0307416_100764904 | 3300032002 | Bacteria | 1059 |
| 391 | Ga0307416_101361206 | 3300032002 | Bacteria | 816 |
| 392 | Ga0307416_101524913 | 3300032002 | Bacteria | 774 |
| 393 | Ga0307416_103240962 | 3300032002 | Unclassified | 545 |
| 394 | Ga0307416_103838555 | 3300032002 | Bacteria | 503 |
| 395 | Ga0307414_10142776 | 3300032004 | Bacteria | 1877 |
| 396 | Ga0307414_11390381 | 3300032004 | Bacteria | 652 |
| 397 | Ga0307414_11431121 | 3300032004 | Bacteria | 643 |
| 398 | Ga0307411_10066859 | 3300032005 | Bacteria | 2416 |
| 399 | Ga0307411_10105341 | 3300032005 | Bacteria | 2005 |
| 400 | Ga0307411_10357531 | 3300032005 | Unclassified | 1193 |
| 401 | Ga0307411_11126596 | 3300032005 | Bacteria | 708 |
| 402 | Ga0307415_100000559 | 3300032126 | Bacteria | 16315 |
| 403 | Ga0307415_100004456 | 3300032126 | Bacteria | 7267 |
| 404 | Ga0307415_100163603 | 3300032126 | Bacteria | 1727 |
| 405 | Ga0307415_100234074 | 3300032126 | Bacteria | 1481 |
| 406 | Ga0307415_100432166 | 3300032126 | Bacteria | 1133 |
| 407 | Ga0307415_100754348 | 3300032126 | Bacteria | 884 |
| 408 | Ga0307415_101382224 | 3300032126 | Bacteria | 670 |
| 409 | Ga0373935_1259015 | 3300035692 | Unclassified | 552 |
| 410 | Ga0395899_0159368 | 3300037312 | Bacteria | 1595 |
| 411 | Ga0395899_0786795 | 3300037312 | Bacteria | 589 |
| 412 | Ga0395900_0008987 | 3300037418 | Bacteria | 10244 |
| 413 | Ga0395900_0466286 | 3300037418 | Bacteria | 1217 |
| 414 | Ga0395898_0005459 | 3300037466 | Bacteria | 13736 |
| 415 | Ga0395898_0007457 | 3300037466 | Bacteria | 11612 |
| 416 | Ga0395898_0271427 | 3300037466 | Bacteria | 1618 |
| 417 | Ga0395905_0009527 | 3300037471 | Bacteria | 9487 |
| 418 | Ga0395905_1301417 | 3300037471 | Unclassified | 631 |
| 419 | Ga0436364_0769744 | 3300037853 | Bacteria | 805 |
| 420 | Ga0436364_0813757 | 3300037853 | Bacteria | 931 |
| 421 | Ga0395901_0011239 | 3300038443 | Bacteria | 9069 |
| 422 | Ga0395901_0134862 | 3300038443 | Bacteria | 2595 |
| 423 | Ga0395901_0173174 | 3300038443 | Bacteria | 2264 |
| 424 | Ga0436365_0503126 | 3300039437 | Bacteria | 901 |
| 425 | Ga0436363_0750576 | 3300039450 | Bacteria | 1639 |
| 426 | Ga0436362_0334836 | 3300039453 | Bacteria | 614 |
| 427 | Ga0451791_0280188 | 3300041451 | Unclassified | 605 |
| 428 | Ga0466965_0628569 | 3300044683 | Bacteria | 612 |
| 429 | Ga0466965_0936490 | 3300044683 | Bacteria | 507 |
| 430 | Ga0466966_0887433 | 3300044684 | Bacteria | 538 |
| 431 | Ga0466961_0440911 | 3300044693 | Bacteria | 788 |
| 432 | Ga0466963_0015311 | 3300044694 | Bacteria | 4745 |
| 433 | Ga0466963_0146577 | 3300044694 | Bacteria | 1638 |
| 434 | Ga0466963_0200683 | 3300044694 | Bacteria | 1395 |
| 435 | Ga0466963_0314584 | 3300044694 | Bacteria | 1102 |
| 436 | Ga0466963_0558542 | 3300044694 | Bacteria | 808 |
| 437 | Ga0466964_0014898 | 3300044706 | Bacteria | 2961 |
| 438 | Ga0466964_0123576 | 3300044706 | Bacteria | 1170 |
| 439 | Ga0466971_0252296 | 3300044719 | Unclassified | 841 |
| 440 | Ga0466971_0455659 | 3300044719 | Bacteria | 628 |
| 441 | Ga0466957_0039228 | 3300044842 | Bacteria | 2857 |
| 442 | Ga0466957_0107665 | 3300044842 | Bacteria | 1765 |
| 443 | Ga0466957_0579313 | 3300044842 | Bacteria | 784 |
| 444 | Ga0466957_0589536 | 3300044842 | Bacteria | 777 |
| 445 | Ga0466960_0277209 | 3300044901 | Bacteria | 939 |
| 446 | Ga0466960_0342900 | 3300044901 | Bacteria | 850 |
| 447 | Ga0466960_1042253 | 3300044901 | Bacteria | 504 |
| 448 | Ga0466958_0693596 | 3300045836 | Bacteria | 663 |
| 449 | Ga0466958_1020646 | 3300045836 | Bacteria | 540 |
| 450 | Ga0466967_0028548 | 3300045976 | Bacteria | 4659 |
| 451 | Ga0466967_0034138 | 3300045976 | Bacteria | 4314 |
| 452 | Ga0466967_0081682 | 3300045976 | Bacteria | 2920 |
| 453 | Ga0466967_0145748 | 3300045976 | Bacteria | 2209 |
| 454 | Ga0466967_0148288 | 3300045976 | Bacteria | 2190 |
| 455 | Ga0466967_0317607 | 3300045976 | Bacteria | 1501 |
| 456 | Ga0466967_0336240 | 3300045976 | Bacteria | 1459 |
| 457 | Ga0466967_0630299 | 3300045976 | Bacteria | 1059 |
| 458 | Ga0466967_0722281 | 3300045976 | Bacteria | 987 |
| 459 | Ga0466967_0769300 | 3300045976 | Bacteria | 955 |
| 460 | Ga0466967_0847130 | 3300045976 | Bacteria | 908 |
| 461 | Ga0466967_1128104 | 3300045976 | Bacteria | 781 |
| 462 | Ga0466967_1438650 | 3300045976 | Bacteria | 687 |
| 463 | Ga0466967_1963959 | 3300045976 | Unclassified | 582 |
| 464 | Ga0466967_2066351 | 3300045976 | Bacteria | 566 |
| 465 | Ga0466967_2374720 | 3300045976 | Bacteria | 526 |
| 466 | Ga0466967_2462377 | 3300045976 | Bacteria | 515 |
| 467 | Ga0495590_0168587 | 3300046457 | Bacteria | 798 |
| 468 | Ga0495641_0011740 | 3300046461 | Bacteria | 4959 |
| 469 | Ga0495582_0787491 | 3300046473 | Unclassified | 550 |
| 470 | Ga0495659_0399491 | 3300046664 | Unclassified | 593 |
| 471 | Ga0495658_0365388 | 3300046683 | Bacteria | 918 |
| 472 | Ga0496100_0004548 | 3300048903 | Bacteria | 7370 |
| 473 | Ga0496101_0058462 | 3300048904 | Bacteria | 2792 |
| 474 | Ga0496101_1133733 | 3300048904 | Bacteria | 614 |
| 475 | Ga0496102_0001933 | 3300048905 | Bacteria | 17833 |
| 476 | Ga0496102_1087246 | 3300048905 | Bacteria | 720 |
| 477 | Ga0496103_0006552 | 3300048906 | Bacteria | 6947 |
| 478 | Ga0496104_0018692 | 3300048907 | Bacteria | 6326 |
| 479 | Ga0496105_0026513 | 3300048908 | Bacteria | 4728 |
| 480 | Ga0496106_0321251 | 3300048909 | Bacteria | 1242 |
| 481 | Ga0496107_0458486 | 3300048910 | Bacteria | 947 |
| 482 | Ga0496108_0010015 | 3300048911 | Bacteria | 7685 |
| 483 | Ga0496109_0067503 | 3300048912 | Bacteria | 3276 |
| 484 | Ga0496109_0328758 | 3300048912 | Bacteria | 1443 |
| 485 | Ga0496109_0654205 | 3300048912 | Bacteria | 988 |
| 486 | Ga0496110_0011341 | 3300048913 | Bacteria | 7290 |
| 487 | Ga0496110_0548394 | 3300048913 | Bacteria | 1051 |
| 488 | Ga0496110_0891008 | 3300048913 | Bacteria | 796 |
| 489 | Ga0496111_0090499 | 3300048914 | Bacteria | 2241 |
| 490 | Ga0496111_0132243 | 3300048914 | Bacteria | 1847 |
| 491 | Ga0496112_0433001 | 3300048915 | Bacteria | 1253 |
| 492 | Ga0496112_0624683 | 3300048915 | Bacteria | 1008 |
| 493 | Ga0496113_0027471 | 3300048916 | Bacteria | 4080 |
| 494 | Ga0496114_0000754 | 3300048917 | Bacteria | 24111 |
| 495 | Ga0496114_0579167 | 3300048917 | Bacteria | 991 |
| 496 | Ga0496114_0954993 | 3300048917 | Bacteria | 740 |
| 497 | Ga0496115_0003151 | 3300048918 | Bacteria | 11862 |
| 498 | Ga0496126_0485631 | 3300048929 | Unclassified | 989 |
| 499 | Ga0501031_0106607 | 3300049568 | Bacteria | 1829 |
| 500 | Ga0501031_0266241 | 3300049568 | Bacteria | 1113 |
| 501 | Ga0501031_0760673 | 3300049568 | Bacteria | 621 |
| 502 | Ga0501032_0520606 | 3300049569 | Bacteria | 759 |
| 503 | Ga0501032_0527879 | 3300049569 | Bacteria | 753 |
| 504 | Ga0501033_0279375 | 3300049570 | Bacteria | 1179 |
| 505 | Ga0501033_0538278 | 3300049570 | Bacteria | 805 |
| 506 | Ga0501034_0608284 | 3300049571 | Bacteria | 998 |
| 507 | Ga0501036_0198551 | 3300049572 | Bacteria | 1687 |
| 508 | Ga0501036_0408149 | 3300049572 | Bacteria | 1133 |
| 509 | Ga0501036_1359377 | 3300049572 | Unclassified | 576 |
| 510 | Ga0501037_0379891 | 3300049573 | Bacteria | 971 |
| 511 | Ga0501038_0039903 | 3300049574 | Bacteria | 4104 |
| 512 | Ga0501038_0951603 | 3300049574 | Bacteria | 632 |
| 513 | Ga0501039_0032723 | 3300049575 | Bacteria | 4009 |
| 514 | Ga0501039_0190840 | 3300049575 | Bacteria | 1611 |
| 515 | Ga0501039_0814284 | 3300049575 | Bacteria | 728 |
| 516 | Ga0501039_1598811 | 3300049575 | Bacteria | 500 |
| 517 | Ga0501040_0112262 | 3300049576 | Bacteria | 1906 |
| 518 | Ga0501040_0145870 | 3300049576 | Bacteria | 1668 |
| 519 | Ga0501040_0768086 | 3300049576 | Bacteria | 697 |
| 520 | Ga0501040_0952594 | 3300049576 | Bacteria | 622 |
| 521 | Ga0501041_0265354 | 3300049577 | Bacteria | 1080 |
| 522 | Ga0501042_0009829 | 3300049578 | Bacteria | 6390 |
| 523 | Ga0501042_0321786 | 3300049578 | Bacteria | 1117 |
| 524 | Ga0501042_0465587 | 3300049578 | Unclassified | 917 |
| 525 | Ga0501042_0745177 | 3300049578 | Unclassified | 712 |
| 526 | Ga0501043_0785389 | 3300049579 | Bacteria | 690 |
| 527 | Ga0501043_0876861 | 3300049579 | Unclassified | 645 |
| 528 | Ga0501043_0923264 | 3300049579 | Bacteria | 625 |
| 529 | Ga0501046_0314461 | 3300049580 | Bacteria | 1142 |
| 530 | Ga0501046_0404340 | 3300049580 | Bacteria | 986 |
| 531 | Ga0501047_0000016 | 3300049581 | Bacteria | 284621 |
| 532 | Ga0501048_0049622 | 3300049582 | Bacteria | 2991 |
| 533 | Ga0501048_0290238 | 3300049582 | Bacteria | 1163 |
| 534 | Ga0501048_0746860 | 3300049582 | Unclassified | 703 |
| 535 | Ga0501048_1005937 | 3300049582 | Archaea | 600 |
| 536 | Ga0501048_1192598 | 3300049582 | Bacteria | 547 |
| 537 | Ga0501067_0114231 | 3300049583 | Bacteria | 1502 |
| 538 | Ga0501067_0297363 | 3300049583 | Bacteria | 899 |
| 539 | Ga0501067_0590282 | 3300049583 | Bacteria | 623 |
| 540 | Ga0501068_0387017 | 3300049584 | Bacteria | 901 |
| 541 | Ga0501070_0273250 | 3300049586 | Bacteria | 1380 |
| 542 | Ga0501071_0070983 | 3300049587 | Bacteria | 2538 |
| 543 | Ga0501071_0084897 | 3300049587 | Bacteria | 2321 |
| 544 | Ga0501071_0231740 | 3300049587 | Bacteria | 1391 |
| 545 | Ga0501071_0430947 | 3300049587 | Bacteria | 1008 |
| 546 | Ga0501072_0070590 | 3300049588 | Bacteria | 2759 |
| 547 | Ga0501072_0464139 | 3300049588 | Bacteria | 1002 |
| 548 | Ga0501073_0295930 | 3300049589 | Bacteria | 1117 |
| 549 | Ga0501075_0093989 | 3300049591 | Bacteria | 2276 |
| 550 | Ga0501075_0157762 | 3300049591 | Bacteria | 1730 |
| 551 | Ga0501076_0103061 | 3300049592 | Bacteria | 2301 |
| 552 | Ga0501076_0151714 | 3300049592 | Bacteria | 1885 |
| 553 | Ga0501076_1063955 | 3300049592 | Bacteria | 666 |
| 554 | Ga0501076_1701555 | 3300049592 | Bacteria | 517 |
| 555 | Ga0501077_0096211 | 3300049593 | Bacteria | 1877 |
| 556 | Ga0501077_0351802 | 3300049593 | Bacteria | 940 |
| 557 | Ga0501077_0567834 | 3300049593 | Bacteria | 728 |
| 558 | Ga0501079_0187706 | 3300049741 | Bacteria | 1613 |
| 559 | Ga0501079_0746296 | 3300049741 | Bacteria | 770 |
| 560 | Ga0501079_0983201 | 3300049741 | Bacteria | 665 |
| 561 | Ga0501079_1339805 | 3300049741 | Bacteria | 563 |
| 562 | Ga0501080_0389323 | 3300049742 | Bacteria | 1255 |
| 563 | Ga0501080_1521696 | 3300049742 | Bacteria | 568 |
| 564 | Ga0501083_0178806 | 3300049744 | Bacteria | 1386 |
| 565 | Ga0501035_0163227 | 3300049822 | Bacteria | 1928 |
| 566 | Ga0501035_0177960 | 3300049822 | Bacteria | 1834 |
| 567 | Ga0501035_0798986 | 3300049822 | Bacteria | 754 |
| 568 | Ga0501045_0887451 | 3300049824 | Bacteria | 655 |
| 569 | Ga0501045_0904117 | 3300049824 | Bacteria | 648 |
| 570 | Ga0501045_1096278 | 3300049824 | Bacteria | 582 |
| 571 | nmdc:mga00v17_338032_c1 | 3300050491 | Bacteria | 979 |
| 572 | nmdc:mga0yw44_233893_c1 | 3300050492 | Bacteria | 1220 |
| 573 | nmdc:mga0yw44_23725_c1 | 3300050492 | Bacteria | 3461 |
| 574 | nmdc:mga0yw44_482068_c1 | 3300050492 | Bacteria | 841 |
| 575 | nmdc:mga0yw44_5408_c1 | 3300050492 | Bacteria | 6029 |
| 576 | nmdc:mga09592_593698_c1 | 3300050508 | Bacteria | 949 |
| 577 | nmdc:mga09592_731910_c1 | 3300050508 | Bacteria | 840 |
| 578 | nmdc:mga06r32_1075476_c1 | 3300050510 | Bacteria | 754 |
| 579 | nmdc:mga06r32_2046_c1 | 3300050510 | Bacteria | 18043 |
| 580 | nmdc:mga08y16_1199980_c1 | 3300050511 | Bacteria | 729 |
| 581 | nmdc:mga08y16_177347_c1 | 3300050511 | Bacteria | 2213 |
| 582 | nmdc:mga08y16_2166705_c1 | 3300050511 | Bacteria | 503 |
| 583 | nmdc:mga08y16_308016_c1 | 3300050511 | Bacteria | 1631 |
| 584 | nmdc:mga08y16_507572_c1 | 3300050511 | Bacteria | 1224 |
| 585 | nmdc:mga08y16_71164_c1 | 3300050511 | Bacteria | 3625 |
| 586 | nmdc:mga0n895_431677_c1 | 3300050512 | Bacteria | 1331 |
| 587 | nmdc:mga0n895_98099_c1 | 3300050512 | Bacteria | 2937 |
| 588 | nmdc:mga0rr50_1020725_c1 | 3300050513 | Bacteria | 704 |
| 589 | nmdc:mga0rr50_432696_c1 | 3300050513 | Bacteria | 1114 |
| 590 | nmdc:mga0a205_321543_c1 | 3300050515 | Bacteria | 1418 |
| 591 | nmdc:mga0a205_610816_c1 | 3300050515 | Bacteria | 943 |
| 592 | Ga0501084_0285262 | 3300054114 | Bacteria | 1394 |
| 593 | Ga0501084_1068263 | 3300054114 | Bacteria | 678 |
| 594 | Ga0501082_0246983 | 3300060353 | Bacteria | 1553 |
| 595 | Ga0501082_0814752 | 3300060353 | Bacteria | 817 |
| 596 | Ga0501082_1918501 | 3300060353 | Unclassified | 516 |
| 597 | Ga0466962_0041964 | 3300061719 | Unclassified | 2189 |
| 598 | Ga0466962_0278093 | 3300061719 | Bacteria | 826 |
| 599 | Ga0530510_0653316 | 3300061734 | Bacteria | 801 |
| 600 | Ga0530510_0807635 | 3300061734 | Bacteria | 716 |
| 601 | Ga0530510_1451847 | 3300061734 | Bacteria | 526 |
| 602 | Ga0530510_1541203 | 3300061734 | Unclassified | 510 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100295685 | Ga0070668_1002956851 | 73 |
| 2 | 3300005457 | Ga0070662_101062227 | Ga0070662_1010622271 | 73 |
| 3 | 3300005985 | Ga0081539_10029416 | Ga0081539_100294163 | 73 |
| 4 | 3300006852 | Ga0075433_10927013 | Ga0075433_109270131 | 73 |
| 5 | 3300006871 | Ga0075434_100452000 | Ga0075434_1004520001 | 73 |
| 6 | 3300009094 | Ga0111539_11271591 | Ga0111539_112715912 | 73 |
| 7 | 3300025933 | Ga0207706_10691788 | Ga0207706_106917882 | 73 |
| 8 | 3300025972 | Ga0207668_10279276 | Ga0207668_102792763 | 73 |
| 9 | 3300049583 | Ga0501067_0590282 | Ga0501067_0590282_135_356 | 73 |
| 10 | 3300050511 | nmdc:mga08y16_2166705_c1 | nmdc:mga08y16_2166705_c1_29_250 | 73 |
| 11 | 3300050512 | nmdc:mga0n895_431677_c1 | nmdc:mga0n895_431677_c1_43_264 | 73 |
| 12 | 3300050515 | nmdc:mga0a205_610816_c1 | nmdc:mga0a205_610816_c1_214_435 | 73 |
| 13 | 3300061734 | Ga0530510_1541203 | Ga0530510_1541203_262_483 | 73 |
| 14 | 3300003323 | rootH1_10333507 | rootH1_103335072 | 74 |
| 15 | 3300005329 | Ga0070683_100233257 | Ga0070683_1002332572 | 74 |
| 16 | 3300005329 | Ga0070683_100287663 | Ga0070683_1002876631 | 74 |
| 17 | 3300005334 | Ga0068869_101276996 | Ga0068869_1012769961 | 74 |
| 18 | 3300005335 | Ga0070666_10768017 | Ga0070666_107680172 | 74 |
| 19 | 3300005337 | Ga0070682_100154423 | Ga0070682_1001544232 | 74 |
| 20 | 3300005337 | Ga0070682_100305137 | Ga0070682_1003051372 | 74 |
| 21 | 3300005337 | Ga0070682_101349528 | Ga0070682_1013495282 | 74 |
| 22 | 3300005337 | Ga0070682_101588569 | Ga0070682_1015885691 | 74 |
| 23 | 3300005338 | Ga0068868_100175694 | Ga0068868_1001756943 | 74 |
| 24 | 3300005338 | Ga0068868_100176256 | Ga0068868_1001762562 | 74 |
| 25 | 3300005338 | Ga0068868_100239924 | Ga0068868_1002399242 | 74 |
| 26 | 3300005339 | Ga0070660_100113264 | Ga0070660_1001132644 | 74 |
| 27 | 3300005339 | Ga0070660_101331123 | Ga0070660_1013311232 | 74 |
| 28 | 3300005339 | Ga0070660_101472653 | Ga0070660_1014726531 | 74 |
| 29 | 3300005339 | Ga0070660_101498226 | Ga0070660_1014982262 | 74 |
| 30 | 3300005339 | Ga0070660_101696027 | Ga0070660_1016960272 | 74 |
| 31 | 3300005340 | Ga0070689_100851435 | Ga0070689_1008514351 | 74 |
| 32 | 3300005341 | Ga0070691_10158158 | Ga0070691_101581582 | 74 |
| 33 | 3300005341 | Ga0070691_10605189 | Ga0070691_106051891 | 74 |
| 34 | 3300005341 | Ga0070691_10884417 | Ga0070691_108844172 | 74 |
| 35 | 3300005343 | Ga0070687_100184666 | Ga0070687_1001846662 | 74 |
| 36 | 3300005343 | Ga0070687_100210027 | Ga0070687_1002100272 | 74 |
| 37 | 3300005343 | Ga0070687_101011921 | Ga0070687_1010119212 | 74 |
| 38 | 3300005344 | Ga0070661_100824447 | Ga0070661_1008244472 | 74 |
| 39 | 3300005344 | Ga0070661_101521559 | Ga0070661_1015215592 | 74 |
| 40 | 3300005345 | Ga0070692_10180965 | Ga0070692_101809652 | 74 |
| 41 | 3300005345 | Ga0070692_10293129 | Ga0070692_102931292 | 74 |
| 42 | 3300005345 | Ga0070692_10403831 | Ga0070692_104038312 | 74 |
| 43 | 3300005345 | Ga0070692_10771532 | Ga0070692_107715321 | 74 |
| 44 | 3300005347 | Ga0070668_100367106 | Ga0070668_1003671062 | 74 |
| 45 | 3300005353 | Ga0070669_100763125 | Ga0070669_1007631252 | 74 |
| 46 | 3300005354 | Ga0070675_100864872 | Ga0070675_1008648721 | 74 |
| 47 | 3300005354 | Ga0070675_101276152 | Ga0070675_1012761522 | 74 |
| 48 | 3300005355 | Ga0070671_101353519 | Ga0070671_1013535192 | 74 |
| 49 | 3300005356 | Ga0070674_100621895 | Ga0070674_1006218952 | 74 |
| 50 | 3300005364 | Ga0070673_100614667 | Ga0070673_1006146671 | 74 |
| 51 | 3300005364 | Ga0070673_102380166 | Ga0070673_1023801662 | 74 |
| 52 | 3300005366 | Ga0070659_100390397 | Ga0070659_1003903972 | 74 |
| 53 | 3300005366 | Ga0070659_100960899 | Ga0070659_1009608992 | 74 |
| 54 | 3300005437 | Ga0070710_10618161 | Ga0070710_106181612 | 74 |
| 55 | 3300005438 | Ga0070701_10955119 | Ga0070701_109551191 | 74 |
| 56 | 3300005439 | Ga0070711_100008029 | Ga0070711_1000080292 | 74 |
| 57 | 3300005440 | Ga0070705_100189233 | Ga0070705_1001892332 | 74 |
| 58 | 3300005440 | Ga0070705_100574918 | Ga0070705_1005749182 | 74 |
| 59 | 3300005440 | Ga0070705_101689488 | Ga0070705_1016894881 | 74 |
| 60 | 3300005440 | Ga0070705_101861195 | Ga0070705_1018611952 | 74 |
| 61 | 3300005441 | Ga0070700_100288099 | Ga0070700_1002880992 | 74 |
| 62 | 3300005441 | Ga0070700_100940282 | Ga0070700_1009402821 | 74 |
| 63 | 3300005445 | Ga0070708_100925750 | Ga0070708_1009257502 | 74 |
| 64 | 3300005455 | Ga0070663_100128433 | Ga0070663_1001284332 | 74 |
| 65 | 3300005455 | Ga0070663_100264277 | Ga0070663_1002642772 | 74 |
| 66 | 3300005455 | Ga0070663_100652953 | Ga0070663_1006529531 | 74 |
| 67 | 3300005455 | Ga0070663_102128393 | Ga0070663_1021283932 | 74 |
| 68 | 3300005456 | Ga0070678_100032452 | Ga0070678_1000324522 | 74 |
| 69 | 3300005456 | Ga0070678_100335807 | Ga0070678_1003358072 | 74 |
| 70 | 3300005456 | Ga0070678_101389577 | Ga0070678_1013895772 | 74 |
| 71 | 3300005457 | Ga0070662_100341035 | Ga0070662_1003410352 | 74 |
| 72 | 3300005457 | Ga0070662_100520608 | Ga0070662_1005206083 | 74 |
| 73 | 3300005458 | Ga0070681_10107611 | Ga0070681_101076113 | 74 |
| 74 | 3300005458 | Ga0070681_11264274 | Ga0070681_112642742 | 74 |
| 75 | 3300005459 | Ga0068867_100061715 | Ga0068867_1000617152 | 74 |
| 76 | 3300005459 | Ga0068867_100062732 | Ga0068867_1000627322 | 74 |
| 77 | 3300005459 | Ga0068867_100955038 | Ga0068867_1009550381 | 74 |
| 78 | 3300005466 | Ga0070685_10680817 | Ga0070685_106808172 | 74 |
| 79 | 3300005466 | Ga0070685_10683845 | Ga0070685_106838452 | 74 |
| 80 | 3300005467 | Ga0070706_100278167 | Ga0070706_1002781672 | 74 |
| 81 | 3300005530 | Ga0070679_101499915 | Ga0070679_1014999151 | 74 |
| 82 | 3300005530 | Ga0070679_101877429 | Ga0070679_1018774291 | 74 |
| 83 | 3300005535 | Ga0070684_100447717 | Ga0070684_1004477172 | 74 |
| 84 | 3300005535 | Ga0070684_101478993 | Ga0070684_1014789932 | 74 |
| 85 | 3300005539 | Ga0068853_100328897 | Ga0068853_1003288972 | 74 |
| 86 | 3300005543 | Ga0070672_101009067 | Ga0070672_1010090672 | 74 |
| 87 | 3300005543 | Ga0070672_101219448 | Ga0070672_1012194482 | 74 |
| 88 | 3300005543 | Ga0070672_101347507 | Ga0070672_1013475072 | 74 |
| 89 | 3300005544 | Ga0070686_100073861 | Ga0070686_1000738614 | 74 |
| 90 | 3300005545 | Ga0070695_100480876 | Ga0070695_1004808762 | 74 |
| 91 | 3300005547 | Ga0070693_100405249 | Ga0070693_1004052493 | 74 |
| 92 | 3300005548 | Ga0070665_100244411 | Ga0070665_1002444113 | 74 |
| 93 | 3300005548 | Ga0070665_100866631 | Ga0070665_1008666311 | 74 |
| 94 | 3300005549 | Ga0070704_100053691 | Ga0070704_1000536912 | 74 |
| 95 | 3300005549 | Ga0070704_100614175 | Ga0070704_1006141752 | 74 |
| 96 | 3300005549 | Ga0070704_101808139 | Ga0070704_1018081392 | 74 |
| 97 | 3300005564 | Ga0070664_100140859 | Ga0070664_1001408592 | 74 |
| 98 | 3300005564 | Ga0070664_101685351 | Ga0070664_1016853511 | 74 |
| 99 | 3300005577 | Ga0068857_100203811 | Ga0068857_1002038112 | 74 |
| 100 | 3300005577 | Ga0068857_101435205 | Ga0068857_1014352052 | 74 |
| 101 | 3300005578 | Ga0068854_100235104 | Ga0068854_1002351042 | 74 |
| 102 | 3300005578 | Ga0068854_100692911 | Ga0068854_1006929112 | 74 |
| 103 | 3300005615 | Ga0070702_100443106 | Ga0070702_1004431062 | 74 |
| 104 | 3300005615 | Ga0070702_100568135 | Ga0070702_1005681352 | 74 |
| 105 | 3300005615 | Ga0070702_100632495 | Ga0070702_1006324952 | 74 |
| 106 | 3300005616 | Ga0068852_100178067 | Ga0068852_1001780675 | 74 |
| 107 | 3300005616 | Ga0068852_100632185 | Ga0068852_1006321852 | 74 |
| 108 | 3300005616 | Ga0068852_102214717 | Ga0068852_1022147172 | 74 |
| 109 | 3300005616 | Ga0068852_102826375 | Ga0068852_1028263752 | 74 |
| 110 | 3300005617 | Ga0068859_100996757 | Ga0068859_1009967572 | 74 |
| 111 | 3300005618 | Ga0068864_100080512 | Ga0068864_1000805121 | 74 |
| 112 | 3300005618 | Ga0068864_101765786 | Ga0068864_1017657862 | 74 |
| 113 | 3300005618 | Ga0068864_102415237 | Ga0068864_1024152372 | 74 |
| 114 | 3300005718 | Ga0068866_10175648 | Ga0068866_101756483 | 74 |
| 115 | 3300005718 | Ga0068866_10247705 | Ga0068866_102477052 | 74 |
| 116 | 3300005718 | Ga0068866_10431993 | Ga0068866_104319931 | 74 |
| 117 | 3300005718 | Ga0068866_10931215 | Ga0068866_109312152 | 74 |
| 118 | 3300005719 | Ga0068861_100056451 | Ga0068861_1000564512 | 74 |
| 119 | 3300005719 | Ga0068861_101502755 | Ga0068861_1015027551 | 74 |
| 120 | 3300005840 | Ga0068870_10174651 | Ga0068870_101746512 | 74 |
| 121 | 3300005840 | Ga0068870_10238232 | Ga0068870_102382323 | 74 |
| 122 | 3300005840 | Ga0068870_10293941 | Ga0068870_102939412 | 74 |
| 123 | 3300005840 | Ga0068870_10302013 | Ga0068870_103020132 | 74 |
| 124 | 3300005841 | Ga0068863_101154704 | Ga0068863_1011547042 | 74 |
| 125 | 3300005842 | Ga0068858_100363732 | Ga0068858_1003637322 | 74 |
| 126 | 3300005842 | Ga0068858_100572527 | Ga0068858_1005725272 | 74 |
| 127 | 3300005843 | Ga0068860_100716491 | Ga0068860_1007164912 | 74 |
| 128 | 3300005937 | Ga0081455_10171666 | Ga0081455_101716662 | 74 |
| 129 | 3300005937 | Ga0081455_10218560 | Ga0081455_102185602 | 74 |
| 130 | 3300005981 | Ga0081538_10000010 | Ga0081538_10000010101 | 74 |
| 131 | 3300005981 | Ga0081538_10000782 | Ga0081538_1000078211 | 74 |
| 132 | 3300005981 | Ga0081538_10001106 | Ga0081538_1000110613 | 74 |
| 133 | 3300005981 | Ga0081538_10005959 | Ga0081538_100059599 | 74 |
| 134 | 3300005981 | Ga0081538_10031100 | Ga0081538_100311004 | 74 |
| 135 | 3300005981 | Ga0081538_10034278 | Ga0081538_100342783 | 74 |
| 136 | 3300005981 | Ga0081538_10080990 | Ga0081538_100809902 | 74 |
| 137 | 3300005981 | Ga0081538_10146118 | Ga0081538_101461182 | 74 |
| 138 | 3300005981 | Ga0081538_10168441 | Ga0081538_101684412 | 74 |
| 139 | 3300005985 | Ga0081539_10004209 | Ga0081539_100042095 | 74 |
| 140 | 3300006028 | Ga0070717_10001893 | Ga0070717_100018938 | 74 |
| 141 | 3300006038 | Ga0075365_10004732 | Ga0075365_100047327 | 74 |
| 142 | 3300006038 | Ga0075365_10021624 | Ga0075365_100216242 | 74 |
| 143 | 3300006051 | Ga0075364_10036804 | Ga0075364_100368042 | 74 |
| 144 | 3300006058 | Ga0075432_10561442 | Ga0075432_105614422 | 74 |
| 145 | 3300006173 | Ga0070716_100234448 | Ga0070716_1002344482 | 74 |
| 146 | 3300006175 | Ga0070712_100016970 | Ga0070712_1000169702 | 74 |
| 147 | 3300006178 | Ga0075367_10633629 | Ga0075367_106336291 | 74 |
| 148 | 3300006237 | Ga0097621_100479618 | Ga0097621_1004796182 | 74 |
| 149 | 3300006237 | Ga0097621_101698862 | Ga0097621_1016988622 | 74 |
| 150 | 3300006844 | Ga0075428_100026541 | Ga0075428_1000265415 | 74 |
| 151 | 3300006844 | Ga0075428_100696018 | Ga0075428_1006960182 | 74 |
| 152 | 3300006844 | Ga0075428_102609958 | Ga0075428_1026099582 | 74 |
| 153 | 3300006846 | Ga0075430_100771021 | Ga0075430_1007710212 | 74 |
| 154 | 3300006847 | Ga0075431_100000718 | Ga0075431_10000071833 | 74 |
| 155 | 3300006847 | Ga0075431_100664385 | Ga0075431_1006643852 | 74 |
| 156 | 3300006847 | Ga0075431_101848983 | Ga0075431_1018489831 | 74 |
| 157 | 3300006852 | Ga0075433_10863256 | Ga0075433_108632562 | 74 |
| 158 | 3300006871 | Ga0075434_100450650 | Ga0075434_1004506502 | 74 |
| 159 | 3300006880 | Ga0075429_101760500 | Ga0075429_1017605002 | 74 |
| 160 | 3300006881 | Ga0068865_100069528 | Ga0068865_1000695282 | 74 |
| 161 | 3300006881 | Ga0068865_100397582 | Ga0068865_1003975823 | 74 |
| 162 | 3300006881 | Ga0068865_101287418 | Ga0068865_1012874182 | 74 |
| 163 | 3300006914 | Ga0075436_100331083 | Ga0075436_1003310832 | 74 |
| 164 | 3300006931 | Ga0097620_100996746 | Ga0097620_1009967462 | 74 |
| 165 | 3300007076 | Ga0075435_101257917 | Ga0075435_1012579172 | 74 |
| 166 | 3300009093 | Ga0105240_11778623 | Ga0105240_117786232 | 74 |
| 167 | 3300009094 | Ga0111539_10006858 | Ga0111539_1000685816 | 74 |
| 168 | 3300009094 | Ga0111539_10081910 | Ga0111539_100819103 | 74 |
| 169 | 3300009094 | Ga0111539_10444345 | Ga0111539_104443452 | 74 |
| 170 | 3300009094 | Ga0111539_10604637 | Ga0111539_106046372 | 74 |
| 171 | 3300009094 | Ga0111539_11112596 | Ga0111539_111125962 | 74 |
| 172 | 3300009094 | Ga0111539_12826634 | Ga0111539_128266341 | 74 |
| 173 | 3300009098 | Ga0105245_10002619 | Ga0105245_100026197 | 74 |
| 174 | 3300009098 | Ga0105245_10046340 | Ga0105245_100463406 | 74 |
| 175 | 3300009098 | Ga0105245_10124790 | Ga0105245_101247903 | 74 |
| 176 | 3300009101 | Ga0105247_10123331 | Ga0105247_101233313 | 74 |
| 177 | 3300009101 | Ga0105247_10377833 | Ga0105247_103778332 | 74 |
| 178 | 3300009101 | Ga0105247_11235890 | Ga0105247_112358901 | 74 |
| 179 | 3300009147 | Ga0114129_11251418 | Ga0114129_112514182 | 74 |
| 180 | 3300009148 | Ga0105243_10058843 | Ga0105243_100588433 | 74 |
| 181 | 3300009148 | Ga0105243_10143939 | Ga0105243_101439392 | 74 |
| 182 | 3300009148 | Ga0105243_10176276 | Ga0105243_101762763 | 74 |
| 183 | 3300009148 | Ga0105243_10834752 | Ga0105243_108347522 | 74 |
| 184 | 3300009148 | Ga0105243_11497594 | Ga0105243_114975942 | 74 |
| 185 | 3300009148 | Ga0105243_11590347 | Ga0105243_115903472 | 74 |
| 186 | 3300009176 | Ga0105242_10080370 | Ga0105242_100803702 | 74 |
| 187 | 3300009176 | Ga0105242_10468908 | Ga0105242_104689082 | 74 |
| 188 | 3300009176 | Ga0105242_11007867 | Ga0105242_110078672 | 74 |
| 189 | 3300009176 | Ga0105242_12704626 | Ga0105242_127046261 | 74 |
| 190 | 3300009177 | Ga0105248_10490741 | Ga0105248_104907411 | 74 |
| 191 | 3300009545 | Ga0105237_11075869 | Ga0105237_110758692 | 74 |
| 192 | 3300009551 | Ga0105238_11739644 | Ga0105238_117396442 | 74 |
| 193 | 3300009553 | Ga0105249_10365507 | Ga0105249_103655072 | 74 |
| 194 | 3300009553 | Ga0105249_12584839 | Ga0105249_125848392 | 74 |
| 195 | 3300010375 | Ga0105239_10111962 | Ga0105239_101119625 | 74 |
| 196 | 3300010375 | Ga0105239_11057780 | Ga0105239_110577802 | 74 |
| 197 | 3300010375 | Ga0105239_11062540 | Ga0105239_110625402 | 74 |
| 198 | 3300010375 | Ga0105239_11916002 | Ga0105239_119160022 | 74 |
| 199 | 3300011119 | Ga0105246_10075007 | Ga0105246_100750074 | 74 |
| 200 | 3300011119 | Ga0105246_11924362 | Ga0105246_119243622 | 74 |
| 201 | 3300011119 | Ga0105246_11975120 | Ga0105246_119751202 | 74 |
| 202 | 3300012494 | Ga0157341_1040465 | Ga0157341_10404651 | 74 |
| 203 | 3300013105 | Ga0157369_10911739 | Ga0157369_109117392 | 74 |
| 204 | 3300013296 | Ga0157374_10236147 | Ga0157374_102361472 | 74 |
| 205 | 3300013297 | Ga0157378_10339362 | Ga0157378_103393622 | 74 |
| 206 | 3300013297 | Ga0157378_12879603 | Ga0157378_128796031 | 74 |
| 207 | 3300013306 | Ga0163162_10413045 | Ga0163162_104130452 | 74 |
| 208 | 3300013306 | Ga0163162_10530322 | Ga0163162_105303222 | 74 |
| 209 | 3300013307 | Ga0157372_11524261 | Ga0157372_115242612 | 74 |
| 210 | 3300013307 | Ga0157372_12310794 | Ga0157372_123107941 | 74 |
| 211 | 3300013307 | Ga0157372_12675987 | Ga0157372_126759872 | 74 |
| 212 | 3300013307 | Ga0157372_13406497 | Ga0157372_134064971 | 74 |
| 213 | 3300013308 | Ga0157375_10134499 | Ga0157375_101344992 | 74 |
| 214 | 3300013308 | Ga0157375_11334397 | Ga0157375_113343972 | 74 |
| 215 | 3300013308 | Ga0157375_11920527 | Ga0157375_119205272 | 74 |
| 216 | 3300014325 | Ga0163163_10317158 | Ga0163163_103171582 | 74 |
| 217 | 3300014325 | Ga0163163_12170012 | Ga0163163_121700122 | 74 |
| 218 | 3300014326 | Ga0157380_10543260 | Ga0157380_105432602 | 74 |
| 219 | 3300014326 | Ga0157380_10967145 | Ga0157380_109671452 | 74 |
| 220 | 3300014497 | Ga0182008_10426634 | Ga0182008_104266342 | 74 |
| 221 | 3300014745 | Ga0157377_10136351 | Ga0157377_101363513 | 74 |
| 222 | 3300014968 | Ga0157379_11358610 | Ga0157379_113586102 | 74 |
| 223 | 3300014969 | Ga0157376_10695904 | Ga0157376_106959042 | 74 |
| 224 | 3300014969 | Ga0157376_10860262 | Ga0157376_108602622 | 74 |
| 225 | 3300017792 | Ga0163161_11084281 | Ga0163161_110842812 | 74 |
| 226 | 3300017792 | Ga0163161_11260956 | Ga0163161_112609562 | 74 |
| 227 | 3300020069 | Ga0197907_10086063 | Ga0197907_100860632 | 74 |
| 228 | 3300020070 | Ga0206356_11727012 | Ga0206356_117270121 | 74 |
| 229 | 3300021384 | Ga0213876_10435798 | Ga0213876_104357982 | 74 |
| 230 | 3300021388 | Ga0213875_10646476 | Ga0213875_106464761 | 74 |
| 231 | 3300022467 | Ga0224712_10296668 | Ga0224712_102966681 | 74 |
| 232 | 3300022467 | Ga0224712_10325422 | Ga0224712_103254222 | 74 |
| 233 | 3300025885 | Ga0207653_10119085 | Ga0207653_101190851 | 74 |
| 234 | 3300025898 | Ga0207692_10363199 | Ga0207692_103631992 | 74 |
| 235 | 3300025899 | Ga0207642_10083047 | Ga0207642_100830472 | 74 |
| 236 | 3300025899 | Ga0207642_10122079 | Ga0207642_101220793 | 74 |
| 237 | 3300025899 | Ga0207642_10696455 | Ga0207642_106964552 | 74 |
| 238 | 3300025899 | Ga0207642_11102574 | Ga0207642_111025741 | 74 |
| 239 | 3300025900 | Ga0207710_10417382 | Ga0207710_104173822 | 74 |
| 240 | 3300025901 | Ga0207688_10014067 | Ga0207688_100140672 | 74 |
| 241 | 3300025901 | Ga0207688_10029458 | Ga0207688_100294583 | 74 |
| 242 | 3300025903 | Ga0207680_11367069 | Ga0207680_113670692 | 74 |
| 243 | 3300025907 | Ga0207645_10861901 | Ga0207645_108619012 | 74 |
| 244 | 3300025908 | Ga0207643_10096696 | Ga0207643_100966962 | 74 |
| 245 | 3300025908 | Ga0207643_10231375 | Ga0207643_102313752 | 74 |
| 246 | 3300025909 | Ga0207705_10392478 | Ga0207705_103924782 | 74 |
| 247 | 3300025909 | Ga0207705_10429268 | Ga0207705_104292682 | 74 |
| 248 | 3300025911 | Ga0207654_11422715 | Ga0207654_114227151 | 74 |
| 249 | 3300025912 | Ga0207707_11244015 | Ga0207707_112440152 | 74 |
| 250 | 3300025915 | Ga0207693_10014737 | Ga0207693_100147372 | 74 |
| 251 | 3300025916 | Ga0207663_10026726 | Ga0207663_100267263 | 74 |
| 252 | 3300025917 | Ga0207660_10704950 | Ga0207660_107049502 | 74 |
| 253 | 3300025917 | Ga0207660_11726806 | Ga0207660_117268062 | 74 |
| 254 | 3300025918 | Ga0207662_10109619 | Ga0207662_101096192 | 74 |
| 255 | 3300025918 | Ga0207662_10235924 | Ga0207662_102359242 | 74 |
| 256 | 3300025918 | Ga0207662_10263559 | Ga0207662_102635592 | 74 |
| 257 | 3300025918 | Ga0207662_10948642 | Ga0207662_109486421 | 74 |
| 258 | 3300025919 | Ga0207657_10078979 | Ga0207657_100789794 | 74 |
| 259 | 3300025919 | Ga0207657_10181447 | Ga0207657_101814472 | 74 |
| 260 | 3300025919 | Ga0207657_10359664 | Ga0207657_103596643 | 74 |
| 261 | 3300025919 | Ga0207657_10946241 | Ga0207657_109462412 | 74 |
| 262 | 3300025919 | Ga0207657_11449889 | Ga0207657_114498892 | 74 |
| 263 | 3300025920 | Ga0207649_10978909 | Ga0207649_109789091 | 74 |
| 264 | 3300025921 | Ga0207652_10305021 | Ga0207652_103050212 | 74 |
| 265 | 3300025921 | Ga0207652_10480592 | Ga0207652_104805923 | 74 |
| 266 | 3300025921 | Ga0207652_11549818 | Ga0207652_115498182 | 74 |
| 267 | 3300025922 | Ga0207646_10881393 | Ga0207646_108813932 | 74 |
| 268 | 3300025923 | Ga0207681_10893660 | Ga0207681_108936602 | 74 |
| 269 | 3300025927 | Ga0207687_10092674 | Ga0207687_100926742 | 74 |
| 270 | 3300025927 | Ga0207687_10598508 | Ga0207687_105985083 | 74 |
| 271 | 3300025927 | Ga0207687_10677401 | Ga0207687_106774012 | 74 |
| 272 | 3300025927 | Ga0207687_11336327 | Ga0207687_113363272 | 74 |
| 273 | 3300025931 | Ga0207644_10446592 | Ga0207644_104465922 | 74 |
| 274 | 3300025931 | Ga0207644_11807589 | Ga0207644_118075891 | 74 |
| 275 | 3300025932 | Ga0207690_11029459 | Ga0207690_110294592 | 74 |
| 276 | 3300025932 | Ga0207690_11250238 | Ga0207690_112502382 | 74 |
| 277 | 3300025932 | Ga0207690_11380367 | Ga0207690_113803672 | 74 |
| 278 | 3300025933 | Ga0207706_10214064 | Ga0207706_102140643 | 74 |
| 279 | 3300025933 | Ga0207706_10264629 | Ga0207706_102646292 | 74 |
| 280 | 3300025933 | Ga0207706_10992076 | Ga0207706_109920762 | 74 |
| 281 | 3300025933 | Ga0207706_11189012 | Ga0207706_111890122 | 74 |
| 282 | 3300025934 | Ga0207686_10168770 | Ga0207686_101687702 | 74 |
| 283 | 3300025934 | Ga0207686_10276287 | Ga0207686_102762871 | 74 |
| 284 | 3300025934 | Ga0207686_10404986 | Ga0207686_104049862 | 74 |
| 285 | 3300025935 | Ga0207709_10034617 | Ga0207709_100346172 | 74 |
| 286 | 3300025935 | Ga0207709_10052158 | Ga0207709_100521583 | 74 |
| 287 | 3300025935 | Ga0207709_10086289 | Ga0207709_100862892 | 74 |
| 288 | 3300025937 | Ga0207669_10231499 | Ga0207669_102314992 | 74 |
| 289 | 3300025938 | Ga0207704_10202826 | Ga0207704_102028262 | 74 |
| 290 | 3300025939 | Ga0207665_10039404 | Ga0207665_100394045 | 74 |
| 291 | 3300025940 | Ga0207691_10149468 | Ga0207691_101494683 | 74 |
| 292 | 3300025940 | Ga0207691_10162900 | Ga0207691_101629002 | 74 |
| 293 | 3300025940 | Ga0207691_11662043 | Ga0207691_116620432 | 74 |
| 294 | 3300025941 | Ga0207711_10585693 | Ga0207711_105856932 | 74 |
| 295 | 3300025942 | Ga0207689_10178869 | Ga0207689_101788692 | 74 |
| 296 | 3300025942 | Ga0207689_10514479 | Ga0207689_105144792 | 74 |
| 297 | 3300025944 | Ga0207661_10071790 | Ga0207661_100717902 | 74 |
| 298 | 3300025944 | Ga0207661_10131854 | Ga0207661_101318542 | 74 |
| 299 | 3300025944 | Ga0207661_10343920 | Ga0207661_103439202 | 74 |
| 300 | 3300025944 | Ga0207661_10592676 | Ga0207661_105926761 | 74 |
| 301 | 3300025944 | Ga0207661_10595554 | Ga0207661_105955541 | 74 |
| 302 | 3300025945 | Ga0207679_10675031 | Ga0207679_106750312 | 74 |
| 303 | 3300025945 | Ga0207679_11689787 | Ga0207679_116897872 | 74 |
| 304 | 3300025945 | Ga0207679_11999530 | Ga0207679_119995302 | 74 |
| 305 | 3300025960 | Ga0207651_10967584 | Ga0207651_109675842 | 74 |
| 306 | 3300025972 | Ga0207668_10632351 | Ga0207668_106323512 | 74 |
| 307 | 3300026023 | Ga0207677_10064634 | Ga0207677_100646344 | 74 |
| 308 | 3300026023 | Ga0207677_10095798 | Ga0207677_100957982 | 74 |
| 309 | 3300026023 | Ga0207677_10117939 | Ga0207677_101179392 | 74 |
| 310 | 3300026023 | Ga0207677_10132454 | Ga0207677_101324542 | 74 |
| 311 | 3300026023 | Ga0207677_12110330 | Ga0207677_121103302 | 74 |
| 312 | 3300026035 | Ga0207703_10478632 | Ga0207703_104786322 | 74 |
| 313 | 3300026035 | Ga0207703_11836229 | Ga0207703_118362292 | 74 |
| 314 | 3300026041 | Ga0207639_11726373 | Ga0207639_117263732 | 74 |
| 315 | 3300026067 | Ga0207678_10138904 | Ga0207678_101389042 | 74 |
| 316 | 3300026067 | Ga0207678_10429770 | Ga0207678_104297702 | 74 |
| 317 | 3300026075 | Ga0207708_10081309 | Ga0207708_100813092 | 74 |
| 318 | 3300026075 | Ga0207708_10654530 | Ga0207708_106545301 | 74 |
| 319 | 3300026075 | Ga0207708_10800563 | Ga0207708_108005631 | 74 |
| 320 | 3300026075 | Ga0207708_11345909 | Ga0207708_113459091 | 74 |
| 321 | 3300026088 | Ga0207641_10896161 | Ga0207641_108961612 | 74 |
| 322 | 3300026088 | Ga0207641_11019470 | Ga0207641_110194702 | 74 |
| 323 | 3300026089 | Ga0207648_10112472 | Ga0207648_101124726 | 74 |
| 324 | 3300026089 | Ga0207648_10429480 | Ga0207648_104294803 | 74 |
| 325 | 3300026089 | Ga0207648_10873584 | Ga0207648_108735842 | 74 |
| 326 | 3300026089 | Ga0207648_11254459 | Ga0207648_112544592 | 74 |
| 327 | 3300026095 | Ga0207676_11442513 | Ga0207676_114425132 | 74 |
| 328 | 3300026095 | Ga0207676_11627937 | Ga0207676_116279372 | 74 |
| 329 | 3300026116 | Ga0207674_10949629 | Ga0207674_109496292 | 74 |
| 330 | 3300026116 | Ga0207674_11351541 | Ga0207674_113515411 | 74 |
| 331 | 3300026116 | Ga0207674_11504681 | Ga0207674_115046811 | 74 |
| 332 | 3300026116 | Ga0207674_12281796 | Ga0207674_122817962 | 74 |
| 333 | 3300026118 | Ga0207675_100231855 | Ga0207675_1002318554 | 74 |
| 334 | 3300026118 | Ga0207675_102260568 | Ga0207675_1022605682 | 74 |
| 335 | 3300026121 | Ga0207683_10015073 | Ga0207683_100150738 | 74 |
| 336 | 3300026121 | Ga0207683_10040071 | Ga0207683_100400712 | 74 |
| 337 | 3300026121 | Ga0207683_11768885 | Ga0207683_117688851 | 74 |
| 338 | 3300026142 | Ga0207698_10326451 | Ga0207698_103264511 | 74 |
| 339 | 3300026142 | Ga0207698_10568728 | Ga0207698_105687282 | 74 |
| 340 | 3300026142 | Ga0207698_10702790 | Ga0207698_107027902 | 74 |
| 341 | 3300026142 | Ga0207698_10957573 | Ga0207698_109575732 | 74 |
| 342 | 3300026142 | Ga0207698_11038774 | Ga0207698_110387742 | 74 |
| 343 | 3300027907 | Ga0207428_10041239 | Ga0207428_100412392 | 74 |
| 344 | 3300027907 | Ga0207428_10126061 | Ga0207428_101260613 | 74 |
| 345 | 3300027907 | Ga0207428_10923100 | Ga0207428_109231002 | 74 |
| 346 | 3300028380 | Ga0268265_10257360 | Ga0268265_102573603 | 74 |
| 347 | 3300028380 | Ga0268265_10622042 | Ga0268265_106220422 | 74 |
| 348 | 3300028381 | Ga0268264_10263126 | Ga0268264_102631262 | 74 |
| 349 | 3300031548 | Ga0307408_100587949 | Ga0307408_1005879492 | 74 |
| 350 | 3300031731 | Ga0307405_10065663 | Ga0307405_100656634 | 74 |
| 351 | 3300031731 | Ga0307405_10173247 | Ga0307405_101732472 | 74 |
| 352 | 3300031731 | Ga0307405_10205494 | Ga0307405_102054942 | 74 |
| 353 | 3300031731 | Ga0307405_10990548 | Ga0307405_109905482 | 74 |
| 354 | 3300031731 | Ga0307405_11879886 | Ga0307405_118798862 | 74 |
| 355 | 3300031824 | Ga0307413_10001054 | Ga0307413_100010542 | 74 |
| 356 | 3300031824 | Ga0307413_10462902 | Ga0307413_104629022 | 74 |
| 357 | 3300031824 | Ga0307413_10744303 | Ga0307413_107443032 | 74 |
| 358 | 3300031824 | Ga0307413_11316927 | Ga0307413_113169272 | 74 |
| 359 | 3300031824 | Ga0307413_11679990 | Ga0307413_116799902 | 74 |
| 360 | 3300031824 | Ga0307413_11772130 | Ga0307413_117721301 | 74 |
| 361 | 3300031824 | Ga0307413_11899157 | Ga0307413_118991572 | 74 |
| 362 | 3300031852 | Ga0307410_10015235 | Ga0307410_100152353 | 74 |
| 363 | 3300031852 | Ga0307410_10047592 | Ga0307410_100475923 | 74 |
| 364 | 3300031852 | Ga0307410_10139899 | Ga0307410_101398991 | 74 |
| 365 | 3300031852 | Ga0307410_10387369 | Ga0307410_103873691 | 74 |
| 366 | 3300031852 | Ga0307410_10481713 | Ga0307410_104817131 | 74 |
| 367 | 3300031852 | Ga0307410_10870641 | Ga0307410_108706411 | 74 |
| 368 | 3300031852 | Ga0307410_11172754 | Ga0307410_111727542 | 74 |
| 369 | 3300031852 | Ga0307410_11729496 | Ga0307410_117294962 | 74 |
| 370 | 3300031901 | Ga0307406_10187802 | Ga0307406_101878021 | 74 |
| 371 | 3300031901 | Ga0307406_10217302 | Ga0307406_102173022 | 74 |
| 372 | 3300031901 | Ga0307406_10261312 | Ga0307406_102613122 | 74 |
| 373 | 3300031901 | Ga0307406_10505694 | Ga0307406_105056943 | 74 |
| 374 | 3300031901 | Ga0307406_10688304 | Ga0307406_106883041 | 74 |
| 375 | 3300031901 | Ga0307406_10707754 | Ga0307406_107077541 | 74 |
| 376 | 3300031901 | Ga0307406_10932554 | Ga0307406_109325542 | 74 |
| 377 | 3300031903 | Ga0307407_10058721 | Ga0307407_100587213 | 74 |
| 378 | 3300031903 | Ga0307407_10379307 | Ga0307407_103793072 | 74 |
| 379 | 3300031903 | Ga0307407_11019568 | Ga0307407_110195681 | 74 |
| 380 | 3300031911 | Ga0307412_10142793 | Ga0307412_101427934 | 74 |
| 381 | 3300031995 | Ga0307409_100001468 | Ga0307409_1000014689 | 74 |
| 382 | 3300031995 | Ga0307409_100004528 | Ga0307409_10000452811 | 74 |
| 383 | 3300031995 | Ga0307409_100250705 | Ga0307409_1002507052 | 74 |
| 384 | 3300031995 | Ga0307409_100403793 | Ga0307409_1004037932 | 74 |
| 385 | 3300031995 | Ga0307409_100428458 | Ga0307409_1004284581 | 74 |
| 386 | 3300031995 | Ga0307409_100589489 | Ga0307409_1005894891 | 74 |
| 387 | 3300031995 | Ga0307409_101542280 | Ga0307409_1015422801 | 74 |
| 388 | 3300031995 | Ga0307409_101837620 | Ga0307409_1018376202 | 74 |
| 389 | 3300031995 | Ga0307409_101997875 | Ga0307409_1019978752 | 74 |
| 390 | 3300032002 | Ga0307416_100041040 | Ga0307416_1000410403 | 74 |
| 391 | 3300032002 | Ga0307416_100278960 | Ga0307416_1002789602 | 74 |
| 392 | 3300032002 | Ga0307416_100297717 | Ga0307416_1002977171 | 74 |
| 393 | 3300032002 | Ga0307416_100375097 | Ga0307416_1003750972 | 74 |
| 394 | 3300032002 | Ga0307416_100748374 | Ga0307416_1007483742 | 74 |
| 395 | 3300032002 | Ga0307416_100764904 | Ga0307416_1007649042 | 74 |
| 396 | 3300032002 | Ga0307416_101361206 | Ga0307416_1013612061 | 74 |
| 397 | 3300032002 | Ga0307416_101524913 | Ga0307416_1015249132 | 74 |
| 398 | 3300032002 | Ga0307416_103240962 | Ga0307416_1032409621 | 74 |
| 399 | 3300032002 | Ga0307416_103838555 | Ga0307416_1038385552 | 74 |
| 400 | 3300032004 | Ga0307414_10142776 | Ga0307414_101427764 | 74 |
| 401 | 3300032004 | Ga0307414_11390381 | Ga0307414_113903812 | 74 |
| 402 | 3300032004 | Ga0307414_11431121 | Ga0307414_114311211 | 74 |
| 403 | 3300032005 | Ga0307411_10066859 | Ga0307411_100668593 | 74 |
| 404 | 3300032005 | Ga0307411_10105341 | Ga0307411_101053413 | 74 |
| 405 | 3300032005 | Ga0307411_10357531 | Ga0307411_103575312 | 74 |
| 406 | 3300032005 | Ga0307411_11126596 | Ga0307411_111265962 | 74 |
| 407 | 3300032126 | Ga0307415_100000559 | Ga0307415_1000005592 | 74 |
| 408 | 3300032126 | Ga0307415_100004456 | Ga0307415_1000044566 | 74 |
| 409 | 3300032126 | Ga0307415_100163603 | Ga0307415_1001636033 | 74 |
| 410 | 3300032126 | Ga0307415_100234074 | Ga0307415_1002340743 | 74 |
| 411 | 3300032126 | Ga0307415_100432166 | Ga0307415_1004321662 | 74 |
| 412 | 3300032126 | Ga0307415_100754348 | Ga0307415_1007543482 | 74 |
| 413 | 3300032126 | Ga0307415_101382224 | Ga0307415_1013822242 | 74 |
| 414 | 3300035692 | Ga0373935_1259015 | Ga0373935_1259015_303_527 | 74 |
| 415 | 3300037312 | Ga0395899_0159368 | Ga0395899_0159368_1038_1262 | 74 |
| 416 | 3300037312 | Ga0395899_0786795 | Ga0395899_0786795_129_353 | 74 |
| 417 | 3300037418 | Ga0395900_0008987 | Ga0395900_0008987_2244_2468 | 74 |
| 418 | 3300037418 | Ga0395900_0466286 | Ga0395900_0466286_390_614 | 74 |
| 419 | 3300037466 | Ga0395898_0005459 | Ga0395898_0005459_4986_5210 | 74 |
| 420 | 3300037466 | Ga0395898_0007457 | Ga0395898_0007457_2499_2723 | 74 |
| 421 | 3300037466 | Ga0395898_0271427 | Ga0395898_0271427_588_812 | 74 |
| 422 | 3300037471 | Ga0395905_0009527 | Ga0395905_0009527_5130_5354 | 74 |
| 423 | 3300037471 | Ga0395905_1301417 | Ga0395905_1301417_93_317 | 74 |
| 424 | 3300037853 | Ga0436364_0769744 | Ga0436364_0769744_438_662 | 74 |
| 425 | 3300037853 | Ga0436364_0813757 | Ga0436364_0813757_108_332 | 74 |
| 426 | 3300038443 | Ga0395901_0011239 | Ga0395901_0011239_5694_5918 | 74 |
| 427 | 3300038443 | Ga0395901_0134862 | Ga0395901_0134862_1129_1353 | 74 |
| 428 | 3300038443 | Ga0395901_0173174 | Ga0395901_0173174_627_851 | 74 |
| 429 | 3300039437 | Ga0436365_0503126 | Ga0436365_0503126_244_468 | 74 |
| 430 | 3300039450 | Ga0436363_0750576 | Ga0436363_0750576_1216_1440 | 74 |
| 431 | 3300039453 | Ga0436362_0334836 | Ga0436362_0334836_94_318 | 74 |
| 432 | 3300041451 | Ga0451791_0280188 | Ga0451791_0280188_367_591 | 74 |
| 433 | 3300044683 | Ga0466965_0628569 | Ga0466965_0628569_306_530 | 74 |
| 434 | 3300044683 | Ga0466965_0936490 | Ga0466965_0936490_39_263 | 74 |
| 435 | 3300044684 | Ga0466966_0887433 | Ga0466966_0887433_295_519 | 74 |
| 436 | 3300044693 | Ga0466961_0440911 | Ga0466961_0440911_490_717 | 74 |
| 437 | 3300044694 | Ga0466963_0015311 | Ga0466963_0015311_1701_1925 | 74 |
| 438 | 3300044694 | Ga0466963_0146577 | Ga0466963_0146577_1247_1471 | 74 |
| 439 | 3300044694 | Ga0466963_0200683 | Ga0466963_0200683_1079_1303 | 74 |
| 440 | 3300044694 | Ga0466963_0314584 | Ga0466963_0314584_603_827 | 74 |
| 441 | 3300044694 | Ga0466963_0558542 | Ga0466963_0558542_310_534 | 74 |
| 442 | 3300044706 | Ga0466964_0014898 | Ga0466964_0014898_140_364 | 74 |
| 443 | 3300044706 | Ga0466964_0123576 | Ga0466964_0123576_383_607 | 74 |
| 444 | 3300044719 | Ga0466971_0252296 | Ga0466971_0252296_526_750 | 74 |
| 445 | 3300044719 | Ga0466971_0455659 | Ga0466971_0455659_146_373 | 74 |
| 446 | 3300044842 | Ga0466957_0039228 | Ga0466957_0039228_618_842 | 74 |
| 447 | 3300044842 | Ga0466957_0107665 | Ga0466957_0107665_1284_1508 | 74 |
| 448 | 3300044842 | Ga0466957_0579313 | Ga0466957_0579313_171_395 | 74 |
| 449 | 3300044842 | Ga0466957_0589536 | Ga0466957_0589536_513_737 | 74 |
| 450 | 3300044901 | Ga0466960_0277209 | Ga0466960_0277209_548_772 | 74 |
| 451 | 3300044901 | Ga0466960_0342900 | Ga0466960_0342900_63_287 | 74 |
| 452 | 3300044901 | Ga0466960_1042253 | Ga0466960_1042253_14_238 | 74 |
| 453 | 3300045836 | Ga0466958_0693596 | Ga0466958_0693596_409_633 | 74 |
| 454 | 3300045836 | Ga0466958_1020646 | Ga0466958_1020646_117_341 | 74 |
| 455 | 3300045976 | Ga0466967_0028548 | Ga0466967_0028548_2628_2852 | 74 |
| 456 | 3300045976 | Ga0466967_0034138 | Ga0466967_0034138_2395_2619 | 74 |
| 457 | 3300045976 | Ga0466967_0081682 | Ga0466967_0081682_811_1035 | 74 |
| 458 | 3300045976 | Ga0466967_0145748 | Ga0466967_0145748_801_1025 | 74 |
| 459 | 3300045976 | Ga0466967_0148288 | Ga0466967_0148288_350_574 | 74 |
| 460 | 3300045976 | Ga0466967_0317607 | Ga0466967_0317607_1114_1338 | 74 |
| 461 | 3300045976 | Ga0466967_0336240 | Ga0466967_0336240_321_545 | 74 |
| 462 | 3300045976 | Ga0466967_0630299 | Ga0466967_0630299_296_520 | 74 |
| 463 | 3300045976 | Ga0466967_0722281 | Ga0466967_0722281_75_299 | 74 |
| 464 | 3300045976 | Ga0466967_0769300 | Ga0466967_0769300_663_887 | 74 |
| 465 | 3300045976 | Ga0466967_0847130 | Ga0466967_0847130_228_452 | 74 |
| 466 | 3300045976 | Ga0466967_1128104 | Ga0466967_1128104_81_305 | 74 |
| 467 | 3300045976 | Ga0466967_1438650 | Ga0466967_1438650_54_281 | 74 |
| 468 | 3300045976 | Ga0466967_1963959 | Ga0466967_1963959_151_375 | 74 |
| 469 | 3300045976 | Ga0466967_2066351 | Ga0466967_2066351_197_421 | 74 |
| 470 | 3300045976 | Ga0466967_2374720 | Ga0466967_2374720_41_268 | 74 |
| 471 | 3300045976 | Ga0466967_2462377 | Ga0466967_2462377_167_391 | 74 |
| 472 | 3300046457 | Ga0495590_0168587 | Ga0495590_0168587_234_458 | 74 |
| 473 | 3300046461 | Ga0495641_0011740 | Ga0495641_0011740_413_637 | 74 |
| 474 | 3300046473 | Ga0495582_0787491 | Ga0495582_0787491_303_527 | 74 |
| 475 | 3300046664 | Ga0495659_0399491 | Ga0495659_0399491_56_280 | 74 |
| 476 | 3300046683 | Ga0495658_0365388 | Ga0495658_0365388_363_587 | 74 |
| 477 | 3300048903 | Ga0496100_0004548 | Ga0496100_0004548_6479_6703 | 74 |
| 478 | 3300048904 | Ga0496101_0058462 | Ga0496101_0058462_1085_1309 | 74 |
| 479 | 3300048904 | Ga0496101_1133733 | Ga0496101_1133733_242_466 | 74 |
| 480 | 3300048905 | Ga0496102_0001933 | Ga0496102_0001933_477_701 | 74 |
| 481 | 3300048905 | Ga0496102_1087246 | Ga0496102_1087246_170_394 | 74 |
| 482 | 3300048906 | Ga0496103_0006552 | Ga0496103_0006552_5189_5413 | 74 |
| 483 | 3300048907 | Ga0496104_0018692 | Ga0496104_0018692_5169_5393 | 74 |
| 484 | 3300048908 | Ga0496105_0026513 | Ga0496105_0026513_1712_1936 | 74 |
| 485 | 3300048909 | Ga0496106_0321251 | Ga0496106_0321251_37_261 | 74 |
| 486 | 3300048910 | Ga0496107_0458486 | Ga0496107_0458486_352_576 | 74 |
| 487 | 3300048911 | Ga0496108_0010015 | Ga0496108_0010015_6188_6412 | 74 |
| 488 | 3300048912 | Ga0496109_0067503 | Ga0496109_0067503_994_1218 | 74 |
| 489 | 3300048912 | Ga0496109_0328758 | Ga0496109_0328758_635_859 | 74 |
| 490 | 3300048912 | Ga0496109_0654205 | Ga0496109_0654205_615_839 | 74 |
| 491 | 3300048913 | Ga0496110_0011341 | Ga0496110_0011341_2225_2449 | 74 |
| 492 | 3300048913 | Ga0496110_0548394 | Ga0496110_0548394_38_262 | 74 |
| 493 | 3300048913 | Ga0496110_0891008 | Ga0496110_0891008_186_410 | 74 |
| 494 | 3300048914 | Ga0496111_0090499 | Ga0496111_0090499_1413_1637 | 74 |
| 495 | 3300048914 | Ga0496111_0132243 | Ga0496111_0132243_350_574 | 74 |
| 496 | 3300048915 | Ga0496112_0433001 | Ga0496112_0433001_111_335 | 74 |
| 497 | 3300048915 | Ga0496112_0624683 | Ga0496112_0624683_331_555 | 74 |
| 498 | 3300048916 | Ga0496113_0027471 | Ga0496113_0027471_1995_2219 | 74 |
| 499 | 3300048917 | Ga0496114_0000754 | Ga0496114_0000754_3916_4140 | 74 |
| 500 | 3300048917 | Ga0496114_0579167 | Ga0496114_0579167_341_565 | 74 |
| 501 | 3300048917 | Ga0496114_0954993 | Ga0496114_0954993_201_425 | 74 |
| 502 | 3300048918 | Ga0496115_0003151 | Ga0496115_0003151_9256_9480 | 74 |
| 503 | 3300048929 | Ga0496126_0485631 | Ga0496126_0485631_424_648 | 74 |
| 504 | 3300049568 | Ga0501031_0106607 | Ga0501031_0106607_429_653 | 74 |
| 505 | 3300049568 | Ga0501031_0266241 | Ga0501031_0266241_289_513 | 74 |
| 506 | 3300049568 | Ga0501031_0760673 | Ga0501031_0760673_159_383 | 74 |
| 507 | 3300049569 | Ga0501032_0520606 | Ga0501032_0520606_429_653 | 74 |
| 508 | 3300049569 | Ga0501032_0527879 | Ga0501032_0527879_431_655 | 74 |
| 509 | 3300049570 | Ga0501033_0279375 | Ga0501033_0279375_387_611 | 74 |
| 510 | 3300049570 | Ga0501033_0538278 | Ga0501033_0538278_298_522 | 74 |
| 511 | 3300049571 | Ga0501034_0608284 | Ga0501034_0608284_560_784 | 74 |
| 512 | 3300049572 | Ga0501036_0198551 | Ga0501036_0198551_410_634 | 74 |
| 513 | 3300049572 | Ga0501036_0408149 | Ga0501036_0408149_182_406 | 74 |
| 514 | 3300049572 | Ga0501036_1359377 | Ga0501036_1359377_159_383 | 74 |
| 515 | 3300049573 | Ga0501037_0379891 | Ga0501037_0379891_14_238 | 74 |
| 516 | 3300049574 | Ga0501038_0039903 | Ga0501038_0039903_1654_1878 | 74 |
| 517 | 3300049574 | Ga0501038_0951603 | Ga0501038_0951603_62_286 | 74 |
| 518 | 3300049575 | Ga0501039_0032723 | Ga0501039_0032723_1925_2149 | 74 |
| 519 | 3300049575 | Ga0501039_0190840 | Ga0501039_0190840_1149_1373 | 74 |
| 520 | 3300049575 | Ga0501039_0814284 | Ga0501039_0814284_89_313 | 74 |
| 521 | 3300049575 | Ga0501039_1598811 | Ga0501039_1598811_252_476 | 74 |
| 522 | 3300049576 | Ga0501040_0112262 | Ga0501040_0112262_664_888 | 74 |
| 523 | 3300049576 | Ga0501040_0145870 | Ga0501040_0145870_696_920 | 74 |
| 524 | 3300049576 | Ga0501040_0768086 | Ga0501040_0768086_280_504 | 74 |
| 525 | 3300049576 | Ga0501040_0952594 | Ga0501040_0952594_212_481 | 74 |
| 526 | 3300049577 | Ga0501041_0265354 | Ga0501041_0265354_320_544 | 74 |
| 527 | 3300049578 | Ga0501042_0009829 | Ga0501042_0009829_5589_5813 | 74 |
| 528 | 3300049578 | Ga0501042_0321786 | Ga0501042_0321786_229_453 | 74 |
| 529 | 3300049578 | Ga0501042_0465587 | Ga0501042_0465587_462_686 | 74 |
| 530 | 3300049578 | Ga0501042_0745177 | Ga0501042_0745177_278_502 | 74 |
| 531 | 3300049579 | Ga0501043_0785389 | Ga0501043_0785389_61_285 | 74 |
| 532 | 3300049579 | Ga0501043_0876861 | Ga0501043_0876861_21_245 | 74 |
| 533 | 3300049579 | Ga0501043_0923264 | Ga0501043_0923264_186_410 | 74 |
| 534 | 3300049580 | Ga0501046_0314461 | Ga0501046_0314461_387_611 | 74 |
| 535 | 3300049580 | Ga0501046_0404340 | Ga0501046_0404340_141_365 | 74 |
| 536 | 3300049581 | Ga0501047_0000016 | Ga0501047_0000016_79419_79643 | 74 |
| 537 | 3300049582 | Ga0501048_0049622 | Ga0501048_0049622_1663_1887 | 74 |
| 538 | 3300049582 | Ga0501048_0290238 | Ga0501048_0290238_883_1107 | 74 |
| 539 | 3300049582 | Ga0501048_0746860 | Ga0501048_0746860_334_558 | 74 |
| 540 | 3300049582 | Ga0501048_1005937 | Ga0501048_1005937_228_452 | 74 |
| 541 | 3300049582 | Ga0501048_1192598 | Ga0501048_1192598_55_279 | 74 |
| 542 | 3300049583 | Ga0501067_0114231 | Ga0501067_0114231_303_527 | 74 |
| 543 | 3300049583 | Ga0501067_0297363 | Ga0501067_0297363_186_410 | 74 |
| 544 | 3300049584 | Ga0501068_0387017 | Ga0501068_0387017_495_719 | 74 |
| 545 | 3300049586 | Ga0501070_0273250 | Ga0501070_0273250_228_452 | 74 |
| 546 | 3300049587 | Ga0501071_0070983 | Ga0501071_0070983_1955_2179 | 74 |
| 547 | 3300049587 | Ga0501071_0084897 | Ga0501071_0084897_1287_1511 | 74 |
| 548 | 3300049587 | Ga0501071_0231740 | Ga0501071_0231740_648_872 | 74 |
| 549 | 3300049587 | Ga0501071_0430947 | Ga0501071_0430947_341_565 | 74 |
| 550 | 3300049588 | Ga0501072_0070590 | Ga0501072_0070590_1613_1837 | 74 |
| 551 | 3300049588 | Ga0501072_0464139 | Ga0501072_0464139_255_479 | 74 |
| 552 | 3300049589 | Ga0501073_0295930 | Ga0501073_0295930_369_593 | 74 |
| 553 | 3300049591 | Ga0501075_0093989 | Ga0501075_0093989_684_908 | 74 |
| 554 | 3300049591 | Ga0501075_0157762 | Ga0501075_0157762_1147_1371 | 74 |
| 555 | 3300049592 | Ga0501076_0103061 | Ga0501076_0103061_1130_1354 | 74 |
| 556 | 3300049592 | Ga0501076_0151714 | Ga0501076_0151714_1512_1736 | 74 |
| 557 | 3300049592 | Ga0501076_1063955 | Ga0501076_1063955_261_485 | 74 |
| 558 | 3300049592 | Ga0501076_1701555 | Ga0501076_1701555_63_287 | 74 |
| 559 | 3300049593 | Ga0501077_0096211 | Ga0501077_0096211_1434_1658 | 74 |
| 560 | 3300049593 | Ga0501077_0351802 | Ga0501077_0351802_132_356 | 74 |
| 561 | 3300049593 | Ga0501077_0567834 | Ga0501077_0567834_75_299 | 74 |
| 562 | 3300049741 | Ga0501079_0187706 | Ga0501079_0187706_539_763 | 74 |
| 563 | 3300049741 | Ga0501079_0746296 | Ga0501079_0746296_143_367 | 74 |
| 564 | 3300049741 | Ga0501079_0983201 | Ga0501079_0983201_143_367 | 74 |
| 565 | 3300049741 | Ga0501079_1339805 | Ga0501079_1339805_151_375 | 74 |
| 566 | 3300049742 | Ga0501080_0389323 | Ga0501080_0389323_684_908 | 74 |
| 567 | 3300049742 | Ga0501080_1521696 | Ga0501080_1521696_312_536 | 74 |
| 568 | 3300049744 | Ga0501083_0178806 | Ga0501083_0178806_826_1050 | 74 |
| 569 | 3300049822 | Ga0501035_0163227 | Ga0501035_0163227_1271_1495 | 74 |
| 570 | 3300049822 | Ga0501035_0177960 | Ga0501035_0177960_657_881 | 74 |
| 571 | 3300049822 | Ga0501035_0798986 | Ga0501035_0798986_519_743 | 74 |
| 572 | 3300049824 | Ga0501045_0887451 | Ga0501045_0887451_89_313 | 74 |
| 573 | 3300049824 | Ga0501045_0904117 | Ga0501045_0904117_216_440 | 74 |
| 574 | 3300049824 | Ga0501045_1096278 | Ga0501045_1096278_308_532 | 74 |
| 575 | 3300050491 | nmdc:mga00v17_338032_c1 | nmdc:mga00v17_338032_c1_215_439 | 74 |
| 576 | 3300050492 | nmdc:mga0yw44_233893_c1 | nmdc:mga0yw44_233893_c1_195_419 | 74 |
| 577 | 3300050492 | nmdc:mga0yw44_23725_c1 | nmdc:mga0yw44_23725_c1_3179_3403 | 74 |
| 578 | 3300050492 | nmdc:mga0yw44_482068_c1 | nmdc:mga0yw44_482068_c1_196_420 | 74 |
| 579 | 3300050492 | nmdc:mga0yw44_5408_c1 | nmdc:mga0yw44_5408_c1_5315_5539 | 74 |
| 580 | 3300050508 | nmdc:mga09592_593698_c1 | nmdc:mga09592_593698_c1_110_379 | 74 |
| 581 | 3300050508 | nmdc:mga09592_731910_c1 | nmdc:mga09592_731910_c1_51_275 | 74 |
| 582 | 3300050510 | nmdc:mga06r32_1075476_c1 | nmdc:mga06r32_1075476_c1_113_382 | 74 |
| 583 | 3300050510 | nmdc:mga06r32_2046_c1 | nmdc:mga06r32_2046_c1_17660_17884 | 74 |
| 584 | 3300050511 | nmdc:mga08y16_1199980_c1 | nmdc:mga08y16_1199980_c1_367_591 | 74 |
| 585 | 3300050511 | nmdc:mga08y16_177347_c1 | nmdc:mga08y16_177347_c1_960_1184 | 74 |
| 586 | 3300050511 | nmdc:mga08y16_308016_c1 | nmdc:mga08y16_308016_c1_1095_1319 | 74 |
| 587 | 3300050511 | nmdc:mga08y16_507572_c1 | nmdc:mga08y16_507572_c1_395_619 | 74 |
| 588 | 3300050511 | nmdc:mga08y16_71164_c1 | nmdc:mga08y16_71164_c1_2845_3114 | 74 |
| 589 | 3300050512 | nmdc:mga0n895_98099_c1 | nmdc:mga0n895_98099_c1_492_716 | 74 |
| 590 | 3300050513 | nmdc:mga0rr50_1020725_c1 | nmdc:mga0rr50_1020725_c1_311_535 | 74 |
| 591 | 3300050513 | nmdc:mga0rr50_432696_c1 | nmdc:mga0rr50_432696_c1_10_234 | 74 |
| 592 | 3300050515 | nmdc:mga0a205_321543_c1 | nmdc:mga0a205_321543_c1_652_876 | 74 |
| 593 | 3300054114 | Ga0501084_0285262 | Ga0501084_0285262_934_1158 | 74 |
| 594 | 3300054114 | Ga0501084_1068263 | Ga0501084_1068263_12_236 | 74 |
| 595 | 3300060353 | Ga0501082_0246983 | Ga0501082_0246983_1112_1336 | 74 |
| 596 | 3300060353 | Ga0501082_0814752 | Ga0501082_0814752_349_573 | 74 |
| 597 | 3300060353 | Ga0501082_1918501 | Ga0501082_1918501_158_382 | 74 |
| 598 | 3300061719 | Ga0466962_0041964 | Ga0466962_0041964_1922_2155 | 74 |
| 599 | 3300061719 | Ga0466962_0278093 | Ga0466962_0278093_418_642 | 74 |
| 600 | 3300061734 | Ga0530510_0653316 | Ga0530510_0653316_427_651 | 74 |
| 601 | 3300061734 | Ga0530510_0807635 | Ga0530510_0807635_184_408 | 74 |
| 602 | 3300061734 | Ga0530510_1451847 | Ga0530510_1451847_219_443 | 74 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mkv-assembly1.cif.gz_S | structure of pisum sativum rubisco with aba | 0.5892 | 27 | 55 |
| 3axk-assembly1.cif.gz_S | structure of rice rubisco in complex with nadp(h) | 0.5556 | 22 | 53 |
| 2o5h-assembly1.cif.gz_A | uncharacterized protein conserved in bacteria, cog3792 from neisseria meningitidis | 0.5547 | 21 | 55 |
| 1wmh-assembly1.cif.gz_A | crystal structure of a pb1 domain complex of protein kinase c iota and par6 alpha | 0.5495 | 1 | 67 |
| 1oey-assembly1.cif.gz_A | heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase | 0.5159 | 2 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HYW3_368_509_3.90.70.10 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases | 0.7353 | 21 | 51 | 3.90.70.10 |
| af_Q4DJS8_372_526_3.90.70.10 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases | 0.726 | 21 | 51 | 3.90.70.10 |
| af_G5EEZ6_321_454_3.90.70.10 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases | 0.6775 | 22 | 50 | 3.90.70.10 |
| af_Q2FYJ0_45_287_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6622 | 41 | 68 | 3.40.50.300 |
| af_A0A0G2KAS0_736_870_3.90.70.10 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases | 0.6293 | 22 | 53 | 3.90.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537ZWT6-F1-model_v4 | GNAT family N-acetyltransferase | 0.9552 | 1 | 74 |
|
| AF-A0A317H9H7-F1-model_v4 | Uncharacterized protein | 0.9223 | 2 | 74 |
|
| AF-A0A7Y4GSS0-F1-model_v4 | Uncharacterized protein | 0.922 | 1 | 74 |
|
| AF-A0A6J4RNN7-F1-model_v4 | Uncharacterized protein | 0.9217 | 1 | 74 |
|
| AF-A0A1U7CWG1-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9129 | 1 | 74 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar