F468101

General Info

Members Datasets Scaffolds Average Seq Length
601 306 1202 101

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_1176256|Ga0496101_1176256_142_450
Length 102
Sequence VAAKDFFDSLPGRADASKLAGMTNSYLFDIEGEGQWRVVVQDGTLDVSEGGADEGADATITTSSDVFAQIVAGEQNPTTAYMTGKLKIKGDMGAAMKLQKLF

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
184 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 5.66
Rhizosphere 92.85
Stem 0
Stem Tuber 0
Unclassified 11.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_1176256 3300048904 Unclassified 601
2 JGI24746J21847_1038671 3300001977 Bacteria 662
3 JGI24745J21846_1042771 3300002073 Unclassified 564
4 JGI24749J21850_1047007 3300002076 Bacteria 639
5 JGI24744J21845_10098243 3300002077 Unclassified 540
6 Ga0070658_10009834 3300005327 Bacteria 7683
7 Ga0070676_10451849 3300005328 Bacteria 904
8 Ga0070683_100025053 3300005329 Bacteria 5352
9 Ga0070683_100107930 3300005329 Bacteria 2625
10 Ga0070683_100283241 3300005329 Bacteria 1577
11 Ga0070683_102093309 3300005329 Bacteria 544
12 Ga0070690_100497345 3300005330 Bacteria 912
13 Ga0070670_100017030 3300005331 Bacteria 6237
14 Ga0068869_100170849 3300005334 Bacteria 1698
15 Ga0070680_100006305 3300005336 Bacteria 9008
16 Ga0070680_100240353 3300005336 Bacteria 1531
17 Ga0070682_100188678 3300005337 Bacteria 1446
18 Ga0070682_100309779 3300005337 Bacteria 1162
19 Ga0070660_100078303 3300005339 Bacteria 2592
20 Ga0070660_100960223 3300005339 Bacteria 722
21 Ga0070689_100169980 3300005340 Bacteria 1766
22 Ga0070687_100096708 3300005343 Bacteria 1644
23 Ga0070661_100035649 3300005344 Bacteria 3613
24 Ga0070661_100326868 3300005344 Bacteria 1199
25 Ga0070661_100358399 3300005344 Bacteria 1146
26 Ga0070661_100471745 3300005344 Bacteria 1001
27 Ga0070692_10199190 3300005345 Bacteria 1172
28 Ga0070668_100027548 3300005347 Bacteria 4315
29 Ga0070668_100453555 3300005347 Bacteria 1103
30 Ga0070675_100010430 3300005354 Bacteria 7259
31 Ga0070671_100803870 3300005355 Bacteria 819
32 Ga0070674_100014165 3300005356 Bacteria 4951
33 Ga0070674_100499911 3300005356 Bacteria 1012
34 Ga0070688_100551120 3300005365 Bacteria 876
35 Ga0070659_100149513 3300005366 Bacteria 1905
36 Ga0070659_100188089 3300005366 Bacteria 1697
37 Ga0070659_100710698 3300005366 Bacteria 869
38 Ga0070659_100824505 3300005366 Bacteria 808
39 Ga0070667_100139365 3300005367 Bacteria 2123
40 Ga0070714_100095252 3300005435 Bacteria 2614
41 Ga0070714_100837518 3300005435 Bacteria 892
42 Ga0070714_100923664 3300005435 Bacteria 848
43 Ga0070714_101990200 3300005435 Bacteria 567
44 Ga0070701_10201539 3300005438 Bacteria 1177
45 Ga0070663_100682250 3300005455 Bacteria 872
46 Ga0070678_100069342 3300005456 Bacteria 2633
47 Ga0070681_10026959 3300005458 Bacteria 5777
48 Ga0070681_10070466 3300005458 Bacteria 3462
49 Ga0070681_10138787 3300005458 Bacteria 2361
50 Ga0068867_100287834 3300005459 Bacteria 1350
51 Ga0070685_10049480 3300005466 Bacteria 2424
52 Ga0070685_10612634 3300005466 Bacteria 785
53 Ga0070706_100717601 3300005467 Bacteria 927
54 Ga0070706_101653286 3300005467 Unclassified 584
55 Ga0070707_100360204 3300005468 Bacteria 1413
56 Ga0070707_100714937 3300005468 Bacteria 965
57 Ga0070698_100123228 3300005471 Bacteria 2550
58 Ga0070698_100135418 3300005471 Bacteria 2417
59 Ga0070698_100402154 3300005471 Bacteria 1303
60 Ga0070699_100016592 3300005518 Bacteria 6320
61 Ga0070699_100100491 3300005518 Bacteria 2535
62 Ga0070679_100011728 3300005530 Bacteria 8353
63 Ga0070679_100409300 3300005530 Unclassified 1302
64 Ga0070679_100604971 3300005530 Unclassified 1039
65 Ga0070684_100002364 3300005535 Bacteria 13907
66 Ga0070684_100053629 3300005535 Bacteria 3511
67 Ga0070684_100059467 3300005535 Bacteria 3341
68 Ga0070684_100282792 3300005535 Bacteria 1520
69 Ga0070684_100414670 3300005535 Unclassified 1243
70 Ga0070697_100556428 3300005536 Bacteria 1006
71 Ga0070697_101141734 3300005536 Unclassified 694
72 Ga0068853_100967957 3300005539 Unclassified 819
73 Ga0068853_101371323 3300005539 Bacteria 684
74 Ga0070672_100080825 3300005543 Bacteria 2605
75 Ga0070686_100013176 3300005544 Bacteria 4724
76 Ga0070665_100014467 3300005548 Bacteria 7914
77 Ga0070665_100501814 3300005548 Bacteria 1224
78 Ga0068855_100022384 3300005563 Bacteria 7573
79 Ga0068855_100063298 3300005563 Bacteria 4317
80 Ga0068855_100837152 3300005563 Unclassified 976
81 Ga0068855_101777838 3300005563 Bacteria 627
82 Ga0068857_100025517 3300005577 Bacteria 5203
83 Ga0068857_100046524 3300005577 Bacteria 3851
84 Ga0068857_100116886 3300005577 Bacteria 2400
85 Ga0068857_100289395 3300005577 Unclassified 1508
86 Ga0068856_100035150 3300005614 Bacteria 4911
87 Ga0068856_100124787 3300005614 Bacteria 2577
88 Ga0068856_101411845 3300005614 Unclassified 711
89 Ga0070702_100031672 3300005615 Bacteria 2896
90 Ga0070702_100280002 3300005615 Bacteria 1145
91 Ga0068852_100101472 3300005616 Bacteria 2598
92 Ga0068864_100019893 3300005618 Bacteria 5613
93 Ga0068866_10136377 3300005718 Bacteria 1403
94 Ga0068861_100145402 3300005719 Bacteria 1940
95 Ga0068851_10426722 3300005834 Bacteria 784
96 Ga0068870_10003003 3300005840 Bacteria 7109
97 Ga0068870_10030630 3300005840 Bacteria 2721
98 Ga0068863_100263364 3300005841 Bacteria 1667
99 Ga0068858_101734321 3300005842 Bacteria 617
100 Ga0068862_101522055 3300005844 Bacteria 675
101 Ga0081455_10006261 3300005937 Bacteria 12806
102 Ga0081538_10219460 3300005981 Unclassified 756
103 Ga0070717_11287349 3300006028 Bacteria 665
104 Ga0075365_10374637 3300006038 Bacteria 1004
105 Ga0075365_11207559 3300006038 Unclassified 532
106 Ga0075365_11255576 3300006038 Unclassified 521
107 Ga0075428_100033110 3300006844 Bacteria 5707
108 Ga0075430_100001946 3300006846 Bacteria 16963
109 Ga0075431_100201651 3300006847 Bacteria 2035
110 Ga0075433_10207976 3300006852 Bacteria 1740
111 Ga0075434_100278366 3300006871 Bacteria 1693
112 Ga0075429_100314896 3300006880 Bacteria 1370
113 Ga0075429_100604930 3300006880 Bacteria 960
114 Ga0068865_100023195 3300006881 Bacteria 4060
115 Ga0068865_101450778 3300006881 Unclassified 614
116 Ga0075436_100426011 3300006914 Bacteria 964
117 Ga0075435_100049220 3300007076 Bacteria 3388
118 Ga0105251_10365283 3300009011 Bacteria 660
119 Ga0105240_10535590 3300009093 Bacteria 1298
120 Ga0105240_10536994 3300009093 Bacteria 1296
121 Ga0105240_11005996 3300009093 Bacteria 891
122 Ga0111539_10040824 3300009094 Bacteria 5583
123 Ga0111539_10203984 3300009094 Bacteria 2305
124 Ga0105245_10046973 3300009098 Bacteria 3859
125 Ga0105245_10608711 3300009098 Bacteria 1120
126 Ga0114129_10037359 3300009147 Bacteria 6858
127 Ga0114129_10334992 3300009147 Bacteria 2008
128 Ga0114129_11026950 3300009147 Bacteria 1037
129 Ga0105243_10434360 3300009148 Bacteria 1228
130 Ga0105241_10175167 3300009174 Bacteria 1775
131 Ga0105241_10544016 3300009174 Unclassified 1042
132 Ga0105241_11104584 3300009174 Bacteria 747
133 Ga0105242_12239512 3300009176 Unclassified 592
134 Ga0105237_10083314 3300009545 Bacteria 3189
135 Ga0105238_10004903 3300009551 Bacteria 13239
136 Ga0105238_10400368 3300009551 Bacteria 1366
137 Ga0105238_11831670 3300009551 Unclassified 639
138 Ga0105239_10194030 3300010375 Bacteria 2274
139 Ga0105239_11098408 3300010375 Bacteria 916
140 Ga0105239_11306831 3300010375 Bacteria 837
141 Ga0105239_12886620 3300010375 Bacteria 561
142 Ga0105246_10117512 3300011119 Bacteria 1965
143 Ga0105246_10175263 3300011119 Bacteria 1646
144 Ga0157373_10227671 3300013100 Bacteria 1316
145 Ga0157373_10964429 3300013100 Bacteria 635
146 Ga0157373_11318595 3300013100 Bacteria 547
147 Ga0157371_10183244 3300013102 Bacteria 1498
148 Ga0157370_10125808 3300013104 Bacteria 2392
149 Ga0157370_10221971 3300013104 Bacteria 1750
150 Ga0157369_10012331 3300013105 Bacteria 9707
151 Ga0157369_10122488 3300013105 Bacteria 2758
152 Ga0157369_10179293 3300013105 Bacteria 2229
153 Ga0157369_10181680 3300013105 Bacteria 2213
154 Ga0157369_10786253 3300013105 Bacteria 978
155 Ga0157374_10057929 3300013296 Bacteria 3619
156 Ga0157374_10076782 3300013296 Bacteria 3159
157 Ga0157374_12876509 3300013296 Unclassified 509
158 Ga0163162_11358396 3300013306 Bacteria 808
159 Ga0157372_10057138 3300013307 Bacteria 4362
160 Ga0157372_10264787 3300013307 Bacteria 1996
161 Ga0157372_10660331 3300013307 Bacteria 1217
162 Ga0157375_10023869 3300013308 Bacteria 5649
163 Ga0163163_10053762 3300014325 Bacteria 3976
164 Ga0157380_10439677 3300014326 Bacteria 1249
165 Ga0182008_10597391 3300014497 Unclassified 619
166 Ga0157377_10007906 3300014745 Bacteria 5160
167 Ga0157377_10919108 3300014745 Bacteria 656
168 Ga0157379_11407626 3300014968 Bacteria 676
169 Ga0157376_10300762 3300014969 Bacteria 1519
170 Ga0163161_10140999 3300017792 Bacteria 1825
171 Ga0206356_10104856 3300020070 Unclassified 670
172 Ga0206354_11224934 3300020081 Bacteria 2138
173 Ga0206353_11578354 3300020082 Bacteria 552
174 Ga0207713_1233896 3300025735 Bacteria 548
175 Ga0207653_10356044 3300025885 Bacteria 572
176 Ga0207692_10290808 3300025898 Bacteria 991
177 Ga0207642_10009885 3300025899 Bacteria 3338
178 Ga0207688_10004008 3300025901 Bacteria 8023
179 Ga0207647_10686580 3300025904 Unclassified 559
180 Ga0207699_10855307 3300025906 Unclassified 670
181 Ga0207645_10087006 3300025907 Bacteria 2008
182 Ga0207643_10011628 3300025908 Bacteria 4752
183 Ga0207643_10012484 3300025908 Bacteria 4591
184 Ga0207705_10154599 3300025909 Bacteria 1720
185 Ga0207705_10242863 3300025909 Bacteria 1372
186 Ga0207705_11224796 3300025909 Bacteria 575
187 Ga0207684_10192272 3300025910 Bacteria 1760
188 Ga0207654_10367024 3300025911 Bacteria 994
189 Ga0207707_10005619 3300025912 Bacteria 10967
190 Ga0207707_10235381 3300025912 Bacteria 1593
191 Ga0207707_10378169 3300025912 Unclassified 1218
192 Ga0207671_10565125 3300025914 Bacteria 907
193 Ga0207693_10076850 3300025915 Bacteria 2615
194 Ga0207693_10281709 3300025915 Unclassified 1303
195 Ga0207693_10544602 3300025915 Bacteria 905
196 Ga0207660_10033080 3300025917 Bacteria 3573
197 Ga0207657_10034207 3300025919 Bacteria 4573
198 Ga0207657_10169542 3300025919 Bacteria 1769
199 Ga0207657_10192303 3300025919 Bacteria 1645
200 Ga0207657_10866315 3300025919 Bacteria 697
201 Ga0207649_10116770 3300025920 Bacteria 1793
202 Ga0207649_10796920 3300025920 Bacteria 737
203 Ga0207652_10021900 3300025921 Bacteria 5280
204 Ga0207652_10638880 3300025921 Bacteria 952
205 Ga0207646_10050078 3300025922 Bacteria 3739
206 Ga0207646_10255838 3300025922 Bacteria 1583
207 Ga0207681_10067522 3300025923 Bacteria 2480
208 Ga0207694_10573424 3300025924 Bacteria 948
209 Ga0207650_10024622 3300025925 Bacteria 4281
210 Ga0207650_10032514 3300025925 Bacteria 3773
211 Ga0207659_10451109 3300025926 Bacteria 1083
212 Ga0207700_10053216 3300025928 Bacteria 3032
213 Ga0207664_10004761 3300025929 Bacteria 9225
214 Ga0207664_10462596 3300025929 Bacteria 1133
215 Ga0207664_10846432 3300025929 Bacteria 822
216 Ga0207664_10887919 3300025929 Bacteria 801
217 Ga0207644_10057859 3300025931 Bacteria 2800
218 Ga0207690_10122159 3300025932 Bacteria 1893
219 Ga0207690_10760726 3300025932 Bacteria 799
220 Ga0207709_10168745 3300025935 Bacteria 1534
221 Ga0207709_11854480 3300025935 Unclassified 502
222 Ga0207670_10079265 3300025936 Bacteria 2293
223 Ga0207669_11243495 3300025937 Bacteria 631
224 Ga0207704_10273447 3300025938 Bacteria 1280
225 Ga0207704_11833962 3300025938 Unclassified 522
226 Ga0207691_10108615 3300025940 Bacteria 2469
227 Ga0207689_10183237 3300025942 Bacteria 1727
228 Ga0207661_10114868 3300025944 Bacteria 2283
229 Ga0207661_10168340 3300025944 Bacteria 1906
230 Ga0207661_11480649 3300025944 Bacteria 622
231 Ga0207667_10221190 3300025949 Bacteria 1940
232 Ga0207651_10438989 3300025960 Bacteria 1118
233 Ga0207668_11607021 3300025972 Bacteria 587
234 Ga0207640_10725236 3300025981 Bacteria 855
235 Ga0207658_10636009 3300025986 Bacteria 961
236 Ga0207677_10397894 3300026023 Bacteria 1167
237 Ga0207639_10376133 3300026041 Bacteria 1274
238 Ga0207639_10549008 3300026041 Unclassified 1061
239 Ga0207678_10203403 3300026067 Bacteria 1694
240 Ga0207708_10004461 3300026075 Bacteria 10319
241 Ga0207702_10051657 3300026078 Bacteria 3475
242 Ga0207702_10739363 3300026078 Unclassified 971
243 Ga0207641_10531390 3300026088 Bacteria 1145
244 Ga0207648_10018548 3300026089 Bacteria 6297
245 Ga0207676_10185493 3300026095 Bacteria 1825
246 Ga0207674_10017995 3300026116 Bacteria 7697
247 Ga0207674_10053391 3300026116 Bacteria 4119
248 Ga0207674_10125767 3300026116 Bacteria 2529
249 Ga0207675_100102609 3300026118 Bacteria 2695
250 Ga0207683_10356289 3300026121 Bacteria 1343
251 Ga0207698_10152988 3300026142 Bacteria 2005
252 Ga0207698_10543339 3300026142 Bacteria 1138
253 Ga0207428_10021815 3300027907 Bacteria 5417
254 Ga0207428_10339597 3300027907 Bacteria 1106
255 Ga0207428_10467078 3300027907 Bacteria 919
256 Ga0268266_10239960 3300028379 Bacteria 1672
257 Ga0268266_11218107 3300028379 Bacteria 728
258 Ga0268265_11774139 3300028380 Unclassified 623
259 Ga0265319_1127259 3300028563 Bacteria 793
260 Ga0265320_10332495 3300031240 Bacteria 671
261 Ga0265340_10050511 3300031247 Bacteria 2017
262 Ga0265339_10042836 3300031249 Bacteria 2505
263 Ga0265339_10575621 3300031249 Unclassified 517
264 Ga0307408_102008746 3300031548 Bacteria 556
265 Ga0265313_10115220 3300031595 Unclassified 1178
266 Ga0265314_10069274 3300031711 Bacteria 2368
267 Ga0265342_10588495 3300031712 Unclassified 562
268 Ga0307406_10564768 3300031901 Bacteria 933
269 Ga0307409_102435531 3300031995 Bacteria 552
270 Ga0307416_100177952 3300032002 Bacteria 1990
271 Ga0373926_0042142 3300035083 Bacteria 1632
272 Ga0373926_0108707 3300035083 Bacteria 1041
273 Ga0373944_0003474 3300035089 Bacteria 4072
274 Ga0373944_0064362 3300035089 Bacteria 1182
275 Ga0373936_0082707 3300035113 Unclassified 1338
276 Ga0373945_0011674 3300035116 Bacteria 2908
277 Ga0373943_0003752 3300035170 Bacteria 6905
278 Ga0373943_0007613 3300035170 Bacteria 4864
279 Ga0373946_0014335 3300035171 Bacteria 2988
280 Ga0373946_0054039 3300035171 Bacteria 1689
281 Ga0373935_0017919 3300035692 Bacteria 4302
282 Ga0373935_0259188 3300035692 Bacteria 1219
283 Ga0373927_0126077 3300035695 Bacteria 1671
284 Ga0373947_0000609 3300035725 Bacteria 21058
285 Ga0373947_0000938 3300035725 Bacteria 17731
286 Ga0373925_0006726 3300037068 Bacteria 8430
287 Ga0373925_0044962 3300037068 Bacteria 3279
288 Ga0395900_0387142 3300037418 Unclassified 1365
289 Ga0395898_0472944 3300037466 Bacteria 1193
290 Ga0395898_1470478 3300037466 Bacteria 608
291 Ga0395905_0329631 3300037471 Bacteria 1417
292 Ga0395905_0350477 3300037471 Unclassified 1368
293 Ga0436364_0204990 3300037853 Bacteria 1294
294 Ga0395901_0387682 3300038443 Bacteria 1437
295 Ga0436365_0804816 3300039437 Bacteria 863
296 Ga0436365_1004662 3300039437 Unclassified 673
297 Ga0436363_1072830 3300039450 Bacteria 1456
298 Ga0439453_0082577 3300041408 Unclassified 695
299 Ga0439451_005429 3300042009 Bacteria 2599
300 Ga0439456_108626 3300042013 Unclassified 631
301 Ga0466969_0199770 3300044656 Bacteria 912
302 Ga0466969_0568593 3300044656 Bacteria 519
303 Ga0466972_0048815 3300044658 Bacteria 2045
304 Ga0466966_0256588 3300044684 Bacteria 1053
305 Ga0466966_0343357 3300044684 Bacteria 897
306 Ga0466966_0659054 3300044684 Bacteria 630
307 Ga0466961_0030508 3300044693 Bacteria 3465
308 Ga0466961_0065446 3300044693 Bacteria 2310
309 Ga0466963_0004993 3300044694 Bacteria 7746
310 Ga0466963_0010226 3300044694 Bacteria 5674
311 Ga0466963_0714052 3300044694 Bacteria 707
312 Ga0466963_0796170 3300044694 Bacteria 667
313 Ga0466964_0101081 3300044706 Unclassified 1271
314 Ga0466964_0114304 3300044706 Bacteria 1208
315 Ga0466971_0006631 3300044719 Bacteria 5033
316 Ga0466968_0161764 3300044735 Bacteria 1033
317 Ga0466970_0319760 3300044765 Bacteria 877
318 Ga0466957_0045388 3300044842 Bacteria 2665
319 Ga0466957_0076048 3300044842 Unclassified 2084
320 Ga0466957_0948955 3300044842 Unclassified 616
321 Ga0466959_0258814 3300045049 Bacteria 1198
322 Ga0466959_0270865 3300045049 Bacteria 1167
323 Ga0466958_0092559 3300045836 Bacteria 1872
324 Ga0466958_0119600 3300045836 Bacteria 1648
325 Ga0466958_0736540 3300045836 Bacteria 642
326 Ga0466967_0018307 3300045976 Bacteria 5593
327 Ga0466967_0027476 3300045976 Bacteria 4734
328 Ga0466967_0030879 3300045976 Bacteria 4502
329 Ga0466967_0064378 3300045976 Bacteria 3260
330 Ga0466967_0118883 3300045976 Bacteria 2438
331 Ga0466967_0320368 3300045976 Bacteria 1495
332 Ga0466967_0526889 3300045976 Bacteria 1161
333 Ga0495592_0059092 3300046454 Bacteria 2825
334 Ga0495592_0249360 3300046454 Bacteria 1174
335 Ga0495603_0040440 3300046455 Bacteria 2791
336 Ga0495629_0001986 3300046459 Bacteria 15915
337 Ga0495629_0022108 3300046459 Bacteria 4535
338 Ga0495629_0043669 3300046459 Bacteria 3147
339 Ga0495629_0650186 3300046459 Bacteria 702
340 Ga0495641_0001911 3300046461 Bacteria 17004
341 Ga0495641_0003610 3300046461 Bacteria 11457
342 Ga0495641_0047749 3300046461 Bacteria 1964
343 Ga0495641_0311305 3300046461 Unclassified 710
344 Ga0495651_0019003 3300046462 Bacteria 5324
345 Ga0495651_0654983 3300046462 Bacteria 658
346 Ga0495653_0016548 3300046463 Bacteria 6001
347 Ga0495653_0016935 3300046463 Bacteria 5929
348 Ga0495653_0026636 3300046463 Bacteria 4634
349 Ga0495580_0095276 3300046472 Bacteria 2070
350 Ga0495582_0002169 3300046473 Bacteria 10987
351 Ga0495582_0015497 3300046473 Bacteria 4187
352 Ga0495639_0002190 3300046475 Bacteria 8604
353 Ga0495639_0020492 3300046475 Bacteria 2889
354 Ga0495662_0004660 3300046476 Bacteria 6882
355 Ga0495662_0024430 3300046476 Bacteria 2916
356 Ga0495662_0232143 3300046476 Bacteria 909
357 Ga0495664_0127399 3300046477 Bacteria 1540
358 Ga0495664_0292071 3300046477 Bacteria 984
359 Ga0495664_0588743 3300046477 Bacteria 661
360 Ga0495584_0420137 3300046491 Unclassified 680
361 Ga0495585_0150445 3300046492 Bacteria 1214
362 Ga0495594_0161301 3300046499 Bacteria 1275
363 Ga0495594_0216138 3300046499 Bacteria 1093
364 Ga0495608_0087236 3300046511 Bacteria 2021
365 Ga0495618_0005092 3300046514 Bacteria 8027
366 Ga0495618_0031119 3300046514 Bacteria 3336
367 Ga0495618_0160104 3300046514 Bacteria 1435
368 Ga0495628_0126185 3300046516 Bacteria 1960
369 Ga0495628_0158735 3300046516 Bacteria 1719
370 Ga0495630_0006223 3300046517 Bacteria 8469
371 Ga0495630_0010195 3300046517 Bacteria 6776
372 Ga0495666_0006868 3300046526 Bacteria 5716
373 Ga0495666_0028675 3300046526 Bacteria 2739
374 Ga0495652_0012284 3300046529 Bacteria 7731
375 Ga0495652_0287683 3300046529 Bacteria 1200
376 Ga0495652_0968642 3300046529 Unclassified 558
377 Ga0495665_0000262 3300046531 Bacteria 26588
378 Ga0495665_0005769 3300046531 Bacteria 6683
379 Ga0495640_0006782 3300046533 Bacteria 9035
380 Ga0495640_0011730 3300046533 Bacteria 6727
381 Ga0495640_0019311 3300046533 Bacteria 5033
382 Ga0495586_0060127 3300046535 Bacteria 2065
383 Ga0495586_0089996 3300046535 Bacteria 1695
384 Ga0495586_0154400 3300046535 Bacteria 1292
385 Ga0495587_0094834 3300046536 Bacteria 1722
386 Ga0495645_0821004 3300046543 Unclassified 556
387 Ga0495667_0117917 3300046559 Bacteria 1714
388 Ga0495667_0316896 3300046559 Bacteria 987
389 Ga0495667_0589506 3300046559 Unclassified 693
390 Ga0495656_0174589 3300046615 Bacteria 1053
391 Ga0495656_0427327 3300046615 Bacteria 696
392 Ga0495634_0011039 3300046642 Bacteria 6592
393 Ga0495634_0033282 3300046642 Bacteria 3542
394 Ga0495634_0243748 3300046642 Bacteria 1101
395 Ga0495634_0883140 3300046642 Bacteria 506
396 Ga0495635_0013421 3300046663 Bacteria 5732
397 Ga0495635_0027948 3300046663 Bacteria 3922
398 Ga0495635_0040256 3300046663 Bacteria 3229
399 Ga0495635_0098783 3300046663 Bacteria 1995
400 Ga0495657_0049191 3300046675 Bacteria 2841
401 Ga0495657_0540469 3300046675 Unclassified 677
402 Ga0495599_0102418 3300046678 Bacteria 1784
403 Ga0495599_0502616 3300046678 Bacteria 713
404 Ga0495646_0037176 3300046680 Bacteria 3014
405 Ga0495647_0004579 3300046681 Bacteria 4503
406 Ga0495647_0006357 3300046681 Bacteria 3909
407 Ga0495658_0002183 3300046683 Bacteria 9896
408 Ga0495658_0005747 3300046683 Bacteria 6095
409 Ga0495613_0003992 3300046689 Bacteria 11038
410 Ga0495613_0012964 3300046689 Bacteria 6193
411 Ga0495613_0338089 3300046689 Unclassified 1036
412 Ga0495624_0005716 3300046690 Bacteria 8918
413 Ga0495624_0043057 3300046690 Unclassified 2881
414 Ga0495670_0825633 3300046691 Bacteria 506
415 Ga0495581_0012196 3300047315 Bacteria 4976
416 Ga0495581_0074400 3300047315 Bacteria 1965
417 Ga0495604_0034580 3300047317 Bacteria 3997
418 Ga0495674_0006299 3300047319 Bacteria 11377
419 Ga0495674_0016082 3300047319 Bacteria 6982
420 Ga0495674_0031203 3300047319 Bacteria 4842
421 Ga0495674_0714247 3300047319 Bacteria 785
422 Ga0495674_0742163 3300047319 Bacteria 767
423 Ga0495676_0026034 3300047321 Bacteria 5040
424 Ga0495676_0059634 3300047321 Bacteria 2995
425 Ga0495676_0570713 3300047321 Unclassified 738
426 Ga0495680_0023496 3300047322 Bacteria 5124
427 Ga0495680_0048094 3300047322 Bacteria 3351
428 Ga0495680_0051533 3300047322 Bacteria 3213
429 Ga0495684_0008844 3300047471 Bacteria 7782
430 Ga0495684_0060891 3300047471 Bacteria 2873
431 Ga0495684_0136121 3300047471 Bacteria 1843
432 Ga0495684_0375785 3300047471 Bacteria 1003
433 Ga0495593_0020035 3300047673 Bacteria 3745
434 Ga0495593_0057440 3300047673 Unclassified 2043
435 Ga0495602_0176608 3300048088 Bacteria 1652
436 Ga0495614_0016931 3300048089 Bacteria 3168
437 Ga0495614_0032967 3300048089 Bacteria 2228
438 Ga0496100_0064823 3300048903 Bacteria 2419
439 Ga0496101_0033611 3300048904 Bacteria 3618
440 Ga0496102_0067936 3300048905 Bacteria 3270
441 Ga0496102_0223988 3300048905 Bacteria 1773
442 Ga0496104_0459048 3300048907 Bacteria 1185
443 Ga0496104_0623476 3300048907 Bacteria 988
444 Ga0496104_0647798 3300048907 Bacteria 965
445 Ga0496105_0058012 3300048908 Bacteria 3196
446 Ga0496105_0323206 3300048908 Bacteria 1236
447 Ga0496105_1241867 3300048908 Bacteria 547
448 Ga0496106_0059026 3300048909 Bacteria 2905
449 Ga0496106_0109685 3300048909 Bacteria 2148
450 Ga0496106_0330483 3300048909 Bacteria 1224
451 Ga0496106_0992550 3300048909 Bacteria 661
452 Ga0496107_0006300 3300048910 Bacteria 8155
453 Ga0496107_0142843 3300048910 Bacteria 1769
454 Ga0496107_0684780 3300048910 Bacteria 755
455 Ga0496107_1164767 3300048910 Unclassified 555
456 Ga0496108_0045870 3300048911 Bacteria 3650
457 Ga0496109_0037349 3300048912 Bacteria 4388
458 Ga0496110_0629326 3300048913 Bacteria 972
459 Ga0496110_0838369 3300048913 Bacteria 824
460 Ga0496110_1040687 3300048913 Bacteria 726
461 Ga0496111_0287517 3300048914 Bacteria 1219
462 Ga0496112_0008910 3300048915 Bacteria 9005
463 Ga0496112_1117304 3300048915 Bacteria 706
464 Ga0496114_0011353 3300048917 Bacteria 7115
465 Ga0496114_0464534 3300048917 Unclassified 1120
466 Ga0496114_0481271 3300048917 Bacteria 1098
467 Ga0496115_0000452 3300048918 Bacteria 32951
468 Ga0496115_0024182 3300048918 Bacteria 4719
469 Ga0496115_0334494 3300048918 Bacteria 1237
470 Ga0496115_0446675 3300048918 Bacteria 1045
471 Ga0501031_0019824 3300049568 Bacteria 4383
472 Ga0501031_0071872 3300049568 Bacteria 2252
473 Ga0501031_0175961 3300049568 Bacteria 1398
474 Ga0501031_0303367 3300049568 Bacteria 1035
475 Ga0501032_0019754 3300049569 Bacteria 4706
476 Ga0501033_0028975 3300049570 Bacteria 4160
477 Ga0501033_0114124 3300049570 Bacteria 1964
478 Ga0501036_0002532 3300049572 Bacteria 14356
479 Ga0501036_0004178 3300049572 Bacteria 11631
480 Ga0501036_0156589 3300049572 Bacteria 1921
481 Ga0501036_0687707 3300049572 Bacteria 846
482 Ga0501037_0002486 3300049573 Bacteria 13311
483 Ga0501037_0310967 3300049573 Bacteria 1092
484 Ga0501037_1107059 3300049573 Bacteria 513
485 Ga0501038_0001419 3300049574 Bacteria 21940
486 Ga0501038_0307961 3300049574 Bacteria 1242
487 Ga0501039_0003659 3300049575 Bacteria 11526
488 Ga0501039_0674257 3300049575 Bacteria 809
489 Ga0501040_0001766 3300049576 Bacteria 13889
490 Ga0501040_0062881 3300049576 Bacteria 2553
491 Ga0501040_0348144 3300049576 Bacteria 1061
492 Ga0501040_0648982 3300049576 Unclassified 763
493 Ga0501040_0728793 3300049576 Bacteria 717
494 Ga0501041_0002765 3300049577 Bacteria 10025
495 Ga0501041_0078891 3300049577 Bacteria 2026
496 Ga0501041_0139220 3300049577 Bacteria 1513
497 Ga0501042_0002156 3300049578 Bacteria 11976
498 Ga0501042_0106573 3300049578 Bacteria 2017
499 Ga0501042_0128353 3300049578 Unclassified 1826
500 Ga0501042_0761646 3300049578 Unclassified 704
501 Ga0501043_0012498 3300049579 Bacteria 6643
502 Ga0501043_0074261 3300049579 Bacteria 2671
503 Ga0501043_1021384 3300049579 Bacteria 588
504 Ga0501046_0043701 3300049580 Bacteria 3566
505 Ga0501046_0064479 3300049580 Bacteria 2860
506 Ga0501046_0121620 3300049580 Bacteria 1985
507 Ga0501048_0004525 3300049582 Bacteria 10589
508 Ga0501048_0024049 3300049582 Bacteria 4448
509 Ga0501067_0002480 3300049583 Bacteria 10188
510 Ga0501068_0000820 3300049584 Bacteria 16120
511 Ga0501068_0423699 3300049584 Bacteria 860
512 Ga0501068_0635229 3300049584 Bacteria 697
513 Ga0501069_0002228 3300049585 Bacteria 9772
514 Ga0501069_0161995 3300049585 Bacteria 1288
515 Ga0501069_0209326 3300049585 Bacteria 1132
516 Ga0501070_0006828 3300049586 Bacteria 9712
517 Ga0501070_0592963 3300049586 Bacteria 884
518 Ga0501071_0000277 3300049587 Bacteria 24366
519 Ga0501071_0233933 3300049587 Bacteria 1385
520 Ga0501071_0255684 3300049587 Bacteria 1322
521 Ga0501071_0486274 3300049587 Bacteria 946
522 Ga0501071_0606980 3300049587 Bacteria 841
523 Ga0501071_1211949 3300049587 Unclassified 583
524 Ga0501072_0002555 3300049588 Bacteria 13641
525 Ga0501072_0026607 3300049588 Bacteria 4510
526 Ga0501072_0183662 3300049588 Bacteria 1668
527 Ga0501072_0204879 3300049588 Bacteria 1573
528 Ga0501072_0522457 3300049588 Bacteria 938
529 Ga0501072_0973216 3300049588 Bacteria 662
530 Ga0501073_0151672 3300049589 Unclassified 1606
531 Ga0501073_0171951 3300049589 Bacteria 1500
532 Ga0501073_0490698 3300049589 Bacteria 849
533 Ga0501074_0005250 3300049590 Bacteria 9318
534 Ga0501074_0024254 3300049590 Bacteria 4408
535 Ga0501074_0479660 3300049590 Bacteria 881
536 Ga0501075_0001045 3300049591 Bacteria 17789
537 Ga0501075_0101581 3300049591 Bacteria 2184
538 Ga0501075_0670165 3300049591 Bacteria 790
539 Ga0501076_0003774 3300049592 Bacteria 10658
540 Ga0501076_0030951 3300049592 Bacteria 4170
541 Ga0501077_0008012 3300049593 Bacteria 6531
542 Ga0501077_0077206 3300049593 Bacteria 2109
543 Ga0501079_0001623 3300049741 Bacteria 16031
544 Ga0501079_0218927 3300049741 Bacteria 1487
545 Ga0501079_0271736 3300049741 Bacteria 1325
546 Ga0501079_0850025 3300049741 Bacteria 718
547 Ga0501080_0062674 3300049742 Bacteria 3460
548 Ga0501080_0123516 3300049742 Bacteria 2398
549 Ga0501080_0379391 3300049742 Unclassified 1274
550 Ga0501080_1556068 3300049742 Archaea 561
551 Ga0501081_0003339 3300049743 Bacteria 10206
552 Ga0501081_0012568 3300049743 Bacteria 5567
553 Ga0501081_0165918 3300049743 Bacteria 1593
554 Ga0501081_0497580 3300049743 Bacteria 908
555 Ga0501081_0584811 3300049743 Unclassified 835
556 Ga0501083_0058342 3300049744 Bacteria 2582
557 Ga0501035_0005485 3300049822 Bacteria 11985
558 Ga0501035_0059786 3300049822 Bacteria 3394
559 Ga0501035_0293411 3300049822 Bacteria 1372
560 Ga0501035_0978922 3300049822 Unclassified 666
561 Ga0501044_0040256 3300049823 Bacteria 4871
562 Ga0501044_0364361 3300049823 Bacteria 1363
563 Ga0501045_0009261 3300049824 Bacteria 6886
564 Ga0501045_0036219 3300049824 Bacteria 3583
565 Ga0501045_0171343 3300049824 Unclassified 1616
566 Ga0501045_0956918 3300049824 Bacteria 628
567 nmdc:mga05p37_16001_c1 3300050507 Bacteria 9025
568 nmdc:mga05p37_280334_c1 3300050507 Bacteria 1988
569 nmdc:mga05p37_42877_c1 3300050507 Bacteria 1907
570 nmdc:mga09592_538297_c1 3300050508 Bacteria 1004
571 nmdc:mga09592_612878_c1 3300050508 Unclassified 932
572 nmdc:mga06r32_5331_c1 3300050510 Bacteria 11579
573 nmdc:mga08y16_14222_c1 3300050511 Bacteria 8375
574 nmdc:mga08y16_745597_c1 3300050511 Bacteria 976
575 nmdc:mga08y16_801680_c1 3300050511 Bacteria 935
576 nmdc:mga0n895_287247_c1 3300050512 Bacteria 1668
577 nmdc:mga0rr50_75849_c1 3300050513 Bacteria 2579
578 nmdc:mga08x19_838733_c1 3300050514 Bacteria 653
579 nmdc:mga0a205_89348_c1 3300050515 Bacteria 2978
580 Ga0495601_0022224 3300053077 Bacteria 3892
581 Ga0495601_0046321 3300053077 Bacteria 2737
582 Ga0495612_0130707 3300053078 Bacteria 1084
583 Ga0495595_0011393 3300053084 Bacteria 3716
584 Ga0495595_0051646 3300053084 Unclassified 1906
585 Ga0495619_0001772 3300053085 Bacteria 14352
586 Ga0495619_0002885 3300053085 Bacteria 11169
587 Ga0500566_0237083 3300053094 Bacteria 896
588 Ga0500566_0245014 3300053094 Bacteria 875
589 Ga0501084_0002882 3300054114 Bacteria 13909
590 Ga0501084_0319515 3300054114 Bacteria 1311
591 Ga0587130_030872 3300059631 Bacteria 617
592 Ga0501082_0006717 3300060353 Bacteria 9950
593 Ga0501082_0033476 3300060353 Bacteria 4435
594 Ga0501082_0644751 3300060353 Unclassified 927
595 Ga0501082_0783571 3300060353 Bacteria 834
596 Ga0466962_0010539 3300061719 Bacteria 4447
597 Ga0466962_0190898 3300061719 Bacteria 1000
598 Ga0466962_0364642 3300061719 Bacteria 720
599 Ga0530510_0037014 3300061734 Bacteria 3516
600 Ga0530510_0182663 3300061734 Bacteria 1555
601 Ga0530510_0223350 3300061734 Bacteria 1400
602 Ga0496101_1176256
603 JGI24746J21847_1038671
604 JGI24745J21846_1042771
605 JGI24749J21850_1047007
606 JGI24744J21845_10098243
607 Ga0070658_10009834
608 Ga0070676_10451849
609 Ga0070683_100025053
610 Ga0070683_100107930
611 Ga0070683_100283241
612 Ga0070683_102093309
613 Ga0070690_100497345
614 Ga0070670_100017030
615 Ga0068869_100170849
616 Ga0070680_100006305
617 Ga0070680_100240353
618 Ga0070682_100188678
619 Ga0070682_100309779
620 Ga0070660_100078303
621 Ga0070660_100960223
622 Ga0070689_100169980
623 Ga0070687_100096708
624 Ga0070661_100035649
625 Ga0070661_100326868
626 Ga0070661_100358399
627 Ga0070661_100471745
628 Ga0070692_10199190
629 Ga0070668_100027548
630 Ga0070668_100453555
631 Ga0070675_100010430
632 Ga0070671_100803870
633 Ga0070674_100014165
634 Ga0070674_100499911
635 Ga0070688_100551120
636 Ga0070659_100149513
637 Ga0070659_100188089
638 Ga0070659_100710698
639 Ga0070659_100824505
640 Ga0070667_100139365
641 Ga0070714_100095252
642 Ga0070714_100837518
643 Ga0070714_100923664
644 Ga0070714_101990200
645 Ga0070701_10201539
646 Ga0070663_100682250
647 Ga0070678_100069342
648 Ga0070681_10026959
649 Ga0070681_10070466
650 Ga0070681_10138787
651 Ga0068867_100287834
652 Ga0070685_10049480
653 Ga0070685_10612634
654 Ga0070706_100717601
655 Ga0070706_101653286
656 Ga0070707_100360204
657 Ga0070707_100714937
658 Ga0070698_100123228
659 Ga0070698_100135418
660 Ga0070698_100402154
661 Ga0070699_100016592
662 Ga0070699_100100491
663 Ga0070679_100011728
664 Ga0070679_100409300
665 Ga0070679_100604971
666 Ga0070684_100002364
667 Ga0070684_100053629
668 Ga0070684_100059467
669 Ga0070684_100282792
670 Ga0070684_100414670
671 Ga0070697_100556428
672 Ga0070697_101141734
673 Ga0068853_100967957
674 Ga0068853_101371323
675 Ga0070672_100080825
676 Ga0070686_100013176
677 Ga0070665_100014467
678 Ga0070665_100501814
679 Ga0068855_100022384
680 Ga0068855_100063298
681 Ga0068855_100837152
682 Ga0068855_101777838
683 Ga0068857_100025517
684 Ga0068857_100046524
685 Ga0068857_100116886
686 Ga0068857_100289395
687 Ga0068856_100035150
688 Ga0068856_100124787
689 Ga0068856_101411845
690 Ga0070702_100031672
691 Ga0070702_100280002
692 Ga0068852_100101472
693 Ga0068864_100019893
694 Ga0068866_10136377
695 Ga0068861_100145402
696 Ga0068851_10426722
697 Ga0068870_10003003
698 Ga0068870_10030630
699 Ga0068863_100263364
700 Ga0068858_101734321
701 Ga0068862_101522055
702 Ga0081455_10006261
703 Ga0081538_10219460
704 Ga0070717_11287349
705 Ga0075365_10374637
706 Ga0075365_11207559
707 Ga0075365_11255576
708 Ga0075428_100033110
709 Ga0075430_100001946
710 Ga0075431_100201651
711 Ga0075433_10207976
712 Ga0075434_100278366
713 Ga0075429_100314896
714 Ga0075429_100604930
715 Ga0068865_100023195
716 Ga0068865_101450778
717 Ga0075436_100426011
718 Ga0075435_100049220
719 Ga0105251_10365283
720 Ga0105240_10535590
721 Ga0105240_10536994
722 Ga0105240_11005996
723 Ga0111539_10040824
724 Ga0111539_10203984
725 Ga0105245_10046973
726 Ga0105245_10608711
727 Ga0114129_10037359
728 Ga0114129_10334992
729 Ga0114129_11026950
730 Ga0105243_10434360
731 Ga0105241_10175167
732 Ga0105241_10544016
733 Ga0105241_11104584
734 Ga0105242_12239512
735 Ga0105237_10083314
736 Ga0105238_10004903
737 Ga0105238_10400368
738 Ga0105238_11831670
739 Ga0105239_10194030
740 Ga0105239_11098408
741 Ga0105239_11306831
742 Ga0105239_12886620
743 Ga0105246_10117512
744 Ga0105246_10175263
745 Ga0157373_10227671
746 Ga0157373_10964429
747 Ga0157373_11318595
748 Ga0157371_10183244
749 Ga0157370_10125808
750 Ga0157370_10221971
751 Ga0157369_10012331
752 Ga0157369_10122488
753 Ga0157369_10179293
754 Ga0157369_10181680
755 Ga0157369_10786253
756 Ga0157374_10057929
757 Ga0157374_10076782
758 Ga0157374_12876509
759 Ga0163162_11358396
760 Ga0157372_10057138
761 Ga0157372_10264787
762 Ga0157372_10660331
763 Ga0157375_10023869
764 Ga0163163_10053762
765 Ga0157380_10439677
766 Ga0182008_10597391
767 Ga0157377_10007906
768 Ga0157377_10919108
769 Ga0157379_11407626
770 Ga0157376_10300762
771 Ga0163161_10140999
772 Ga0206356_10104856
773 Ga0206354_11224934
774 Ga0206353_11578354
775 Ga0207713_1233896
776 Ga0207653_10356044
777 Ga0207692_10290808
778 Ga0207642_10009885
779 Ga0207688_10004008
780 Ga0207647_10686580
781 Ga0207699_10855307
782 Ga0207645_10087006
783 Ga0207643_10011628
784 Ga0207643_10012484
785 Ga0207705_10154599
786 Ga0207705_10242863
787 Ga0207705_11224796
788 Ga0207684_10192272
789 Ga0207654_10367024
790 Ga0207707_10005619
791 Ga0207707_10235381
792 Ga0207707_10378169
793 Ga0207671_10565125
794 Ga0207693_10076850
795 Ga0207693_10281709
796 Ga0207693_10544602
797 Ga0207660_10033080
798 Ga0207657_10034207
799 Ga0207657_10169542
800 Ga0207657_10192303
801 Ga0207657_10866315
802 Ga0207649_10116770
803 Ga0207649_10796920
804 Ga0207652_10021900
805 Ga0207652_10638880
806 Ga0207646_10050078
807 Ga0207646_10255838
808 Ga0207681_10067522
809 Ga0207694_10573424
810 Ga0207650_10024622
811 Ga0207650_10032514
812 Ga0207659_10451109
813 Ga0207700_10053216
814 Ga0207664_10004761
815 Ga0207664_10462596
816 Ga0207664_10846432
817 Ga0207664_10887919
818 Ga0207644_10057859
819 Ga0207690_10122159
820 Ga0207690_10760726
821 Ga0207709_10168745
822 Ga0207709_11854480
823 Ga0207670_10079265
824 Ga0207669_11243495
825 Ga0207704_10273447
826 Ga0207704_11833962
827 Ga0207691_10108615
828 Ga0207689_10183237
829 Ga0207661_10114868
830 Ga0207661_10168340
831 Ga0207661_11480649
832 Ga0207667_10221190
833 Ga0207651_10438989
834 Ga0207668_11607021
835 Ga0207640_10725236
836 Ga0207658_10636009
837 Ga0207677_10397894
838 Ga0207639_10376133
839 Ga0207639_10549008
840 Ga0207678_10203403
841 Ga0207708_10004461
842 Ga0207702_10051657
843 Ga0207702_10739363
844 Ga0207641_10531390
845 Ga0207648_10018548
846 Ga0207676_10185493
847 Ga0207674_10017995
848 Ga0207674_10053391
849 Ga0207674_10125767
850 Ga0207675_100102609
851 Ga0207683_10356289
852 Ga0207698_10152988
853 Ga0207698_10543339
854 Ga0207428_10021815
855 Ga0207428_10339597
856 Ga0207428_10467078
857 Ga0268266_10239960
858 Ga0268266_11218107
859 Ga0268265_11774139
860 Ga0265319_1127259
861 Ga0265320_10332495
862 Ga0265340_10050511
863 Ga0265339_10042836
864 Ga0265339_10575621
865 Ga0307408_102008746
866 Ga0265313_10115220
867 Ga0265314_10069274
868 Ga0265342_10588495
869 Ga0307406_10564768
870 Ga0307409_102435531
871 Ga0307416_100177952
872 Ga0373926_0042142
873 Ga0373926_0108707
874 Ga0373944_0003474
875 Ga0373944_0064362
876 Ga0373936_0082707
877 Ga0373945_0011674
878 Ga0373943_0003752
879 Ga0373943_0007613
880 Ga0373946_0014335
881 Ga0373946_0054039
882 Ga0373935_0017919
883 Ga0373935_0259188
884 Ga0373927_0126077
885 Ga0373947_0000609
886 Ga0373947_0000938
887 Ga0373925_0006726
888 Ga0373925_0044962
889 Ga0395900_0387142
890 Ga0395898_0472944
891 Ga0395898_1470478
892 Ga0395905_0329631
893 Ga0395905_0350477
894 Ga0436364_0204990
895 Ga0395901_0387682
896 Ga0436365_0804816
897 Ga0436365_1004662
898 Ga0436363_1072830
899 Ga0439453_0082577
900 Ga0439451_005429
901 Ga0439456_108626
902 Ga0466969_0199770
903 Ga0466969_0568593
904 Ga0466972_0048815
905 Ga0466966_0256588
906 Ga0466966_0343357
907 Ga0466966_0659054
908 Ga0466961_0030508
909 Ga0466961_0065446
910 Ga0466963_0004993
911 Ga0466963_0010226
912 Ga0466963_0714052
913 Ga0466963_0796170
914 Ga0466964_0101081
915 Ga0466964_0114304
916 Ga0466971_0006631
917 Ga0466968_0161764
918 Ga0466970_0319760
919 Ga0466957_0045388
920 Ga0466957_0076048
921 Ga0466957_0948955
922 Ga0466959_0258814
923 Ga0466959_0270865
924 Ga0466958_0092559
925 Ga0466958_0119600
926 Ga0466958_0736540
927 Ga0466967_0018307
928 Ga0466967_0027476
929 Ga0466967_0030879
930 Ga0466967_0064378
931 Ga0466967_0118883
932 Ga0466967_0320368
933 Ga0466967_0526889
934 Ga0495592_0059092
935 Ga0495592_0249360
936 Ga0495603_0040440
937 Ga0495629_0001986
938 Ga0495629_0022108
939 Ga0495629_0043669
940 Ga0495629_0650186
941 Ga0495641_0001911
942 Ga0495641_0003610
943 Ga0495641_0047749
944 Ga0495641_0311305
945 Ga0495651_0019003
946 Ga0495651_0654983
947 Ga0495653_0016548
948 Ga0495653_0016935
949 Ga0495653_0026636
950 Ga0495580_0095276
951 Ga0495582_0002169
952 Ga0495582_0015497
953 Ga0495639_0002190
954 Ga0495639_0020492
955 Ga0495662_0004660
956 Ga0495662_0024430
957 Ga0495662_0232143
958 Ga0495664_0127399
959 Ga0495664_0292071
960 Ga0495664_0588743
961 Ga0495584_0420137
962 Ga0495585_0150445
963 Ga0495594_0161301
964 Ga0495594_0216138
965 Ga0495608_0087236
966 Ga0495618_0005092
967 Ga0495618_0031119
968 Ga0495618_0160104
969 Ga0495628_0126185
970 Ga0495628_0158735
971 Ga0495630_0006223
972 Ga0495630_0010195
973 Ga0495666_0006868
974 Ga0495666_0028675
975 Ga0495652_0012284
976 Ga0495652_0287683
977 Ga0495652_0968642
978 Ga0495665_0000262
979 Ga0495665_0005769
980 Ga0495640_0006782
981 Ga0495640_0011730
982 Ga0495640_0019311
983 Ga0495586_0060127
984 Ga0495586_0089996
985 Ga0495586_0154400
986 Ga0495587_0094834
987 Ga0495645_0821004
988 Ga0495667_0117917
989 Ga0495667_0316896
990 Ga0495667_0589506
991 Ga0495656_0174589
992 Ga0495656_0427327
993 Ga0495634_0011039
994 Ga0495634_0033282
995 Ga0495634_0243748
996 Ga0495634_0883140
997 Ga0495635_0013421
998 Ga0495635_0027948
999 Ga0495635_0040256
1000 Ga0495635_0098783
1001 Ga0495657_0049191
1002 Ga0495657_0540469
1003 Ga0495599_0102418
1004 Ga0495599_0502616
1005 Ga0495646_0037176
1006 Ga0495647_0004579
1007 Ga0495647_0006357
1008 Ga0495658_0002183
1009 Ga0495658_0005747
1010 Ga0495613_0003992
1011 Ga0495613_0012964
1012 Ga0495613_0338089
1013 Ga0495624_0005716
1014 Ga0495624_0043057
1015 Ga0495670_0825633
1016 Ga0495581_0012196
1017 Ga0495581_0074400
1018 Ga0495604_0034580
1019 Ga0495674_0006299
1020 Ga0495674_0016082
1021 Ga0495674_0031203
1022 Ga0495674_0714247
1023 Ga0495674_0742163
1024 Ga0495676_0026034
1025 Ga0495676_0059634
1026 Ga0495676_0570713
1027 Ga0495680_0023496
1028 Ga0495680_0048094
1029 Ga0495680_0051533
1030 Ga0495684_0008844
1031 Ga0495684_0060891
1032 Ga0495684_0136121
1033 Ga0495684_0375785
1034 Ga0495593_0020035
1035 Ga0495593_0057440
1036 Ga0495602_0176608
1037 Ga0495614_0016931
1038 Ga0495614_0032967
1039 Ga0496100_0064823
1040 Ga0496101_0033611
1041 Ga0496102_0067936
1042 Ga0496102_0223988
1043 Ga0496104_0459048
1044 Ga0496104_0623476
1045 Ga0496104_0647798
1046 Ga0496105_0058012
1047 Ga0496105_0323206
1048 Ga0496105_1241867
1049 Ga0496106_0059026
1050 Ga0496106_0109685
1051 Ga0496106_0330483
1052 Ga0496106_0992550
1053 Ga0496107_0006300
1054 Ga0496107_0142843
1055 Ga0496107_0684780
1056 Ga0496107_1164767
1057 Ga0496108_0045870
1058 Ga0496109_0037349
1059 Ga0496110_0629326
1060 Ga0496110_0838369
1061 Ga0496110_1040687
1062 Ga0496111_0287517
1063 Ga0496112_0008910
1064 Ga0496112_1117304
1065 Ga0496114_0011353
1066 Ga0496114_0464534
1067 Ga0496114_0481271
1068 Ga0496115_0000452
1069 Ga0496115_0024182
1070 Ga0496115_0334494
1071 Ga0496115_0446675
1072 Ga0501031_0019824
1073 Ga0501031_0071872
1074 Ga0501031_0175961
1075 Ga0501031_0303367
1076 Ga0501032_0019754
1077 Ga0501033_0028975
1078 Ga0501033_0114124
1079 Ga0501036_0002532
1080 Ga0501036_0004178
1081 Ga0501036_0156589
1082 Ga0501036_0687707
1083 Ga0501037_0002486
1084 Ga0501037_0310967
1085 Ga0501037_1107059
1086 Ga0501038_0001419
1087 Ga0501038_0307961
1088 Ga0501039_0003659
1089 Ga0501039_0674257
1090 Ga0501040_0001766
1091 Ga0501040_0062881
1092 Ga0501040_0348144
1093 Ga0501040_0648982
1094 Ga0501040_0728793
1095 Ga0501041_0002765
1096 Ga0501041_0078891
1097 Ga0501041_0139220
1098 Ga0501042_0002156
1099 Ga0501042_0106573
1100 Ga0501042_0128353
1101 Ga0501042_0761646
1102 Ga0501043_0012498
1103 Ga0501043_0074261
1104 Ga0501043_1021384
1105 Ga0501046_0043701
1106 Ga0501046_0064479
1107 Ga0501046_0121620
1108 Ga0501048_0004525
1109 Ga0501048_0024049
1110 Ga0501067_0002480
1111 Ga0501068_0000820
1112 Ga0501068_0423699
1113 Ga0501068_0635229
1114 Ga0501069_0002228
1115 Ga0501069_0161995
1116 Ga0501069_0209326
1117 Ga0501070_0006828
1118 Ga0501070_0592963
1119 Ga0501071_0000277
1120 Ga0501071_0233933
1121 Ga0501071_0255684
1122 Ga0501071_0486274
1123 Ga0501071_0606980
1124 Ga0501071_1211949
1125 Ga0501072_0002555
1126 Ga0501072_0026607
1127 Ga0501072_0183662
1128 Ga0501072_0204879
1129 Ga0501072_0522457
1130 Ga0501072_0973216
1131 Ga0501073_0151672
1132 Ga0501073_0171951
1133 Ga0501073_0490698
1134 Ga0501074_0005250
1135 Ga0501074_0024254
1136 Ga0501074_0479660
1137 Ga0501075_0001045
1138 Ga0501075_0101581
1139 Ga0501075_0670165
1140 Ga0501076_0003774
1141 Ga0501076_0030951
1142 Ga0501077_0008012
1143 Ga0501077_0077206
1144 Ga0501079_0001623
1145 Ga0501079_0218927
1146 Ga0501079_0271736
1147 Ga0501079_0850025
1148 Ga0501080_0062674
1149 Ga0501080_0123516
1150 Ga0501080_0379391
1151 Ga0501080_1556068
1152 Ga0501081_0003339
1153 Ga0501081_0012568
1154 Ga0501081_0165918
1155 Ga0501081_0497580
1156 Ga0501081_0584811
1157 Ga0501083_0058342
1158 Ga0501035_0005485
1159 Ga0501035_0059786
1160 Ga0501035_0293411
1161 Ga0501035_0978922
1162 Ga0501044_0040256
1163 Ga0501044_0364361
1164 Ga0501045_0009261
1165 Ga0501045_0036219
1166 Ga0501045_0171343
1167 Ga0501045_0956918
1168 nmdc:mga05p37_16001_c1
1169 nmdc:mga05p37_280334_c1
1170 nmdc:mga05p37_42877_c1
1171 nmdc:mga09592_538297_c1
1172 nmdc:mga09592_612878_c1
1173 nmdc:mga06r32_5331_c1
1174 nmdc:mga08y16_14222_c1
1175 nmdc:mga08y16_745597_c1
1176 nmdc:mga08y16_801680_c1
1177 nmdc:mga0n895_287247_c1
1178 nmdc:mga0rr50_75849_c1
1179 nmdc:mga08x19_838733_c1
1180 nmdc:mga0a205_89348_c1
1181 Ga0495601_0022224
1182 Ga0495601_0046321
1183 Ga0495612_0130707
1184 Ga0495595_0011393
1185 Ga0495595_0051646
1186 Ga0495619_0001772
1187 Ga0495619_0002885
1188 Ga0500566_0237083
1189 Ga0500566_0245014
1190 Ga0501084_0002882
1191 Ga0501084_0319515
1192 Ga0587130_030872
1193 Ga0501082_0006717
1194 Ga0501082_0033476
1195 Ga0501082_0644751
1196 Ga0501082_0783571
1197 Ga0466962_0010539
1198 Ga0466962_0190898
1199 Ga0466962_0364642
1200 Ga0530510_0037014
1201 Ga0530510_0182663
1202 Ga0530510_0223350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14864

Alkyl_sulf_C

Alkyl sulfatase C-terminal

1

102

0.94

PF02036

SCP2

SCP-2 sterol transfer family

4

102

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4av7-assembly3.cif.gz_F structure determination of the double mutant s233y f250g from the sec- alkyl sulfatase pisa1 0.8776 2 101
2yhe-assembly3.cif.gz_C structure determination of the stereoselective inverting sec- alkylsulfatase pisa1 from pseudomonas sp. 0.8621 7 100
4av7-assembly3.cif.gz_F structure determination of the double mutant s233y f250g from the sec- alkyl sulfatase pisa1 0.8617 2 101
2cg2-assembly1.cif.gz_A-2 crystal structure of sdsa1, an alkylsulfatase from pseudomonas aeruginosa, in complex with sulfate 0.8608 2 101
4nur-assembly1.cif.gz_B crystal structure of thermostable alkylsulfatase sdsap from pseudomonas sp. s9 0.8546 2 101
ID Description Score Start End Superfamily
af_Q7KPQ9_334_441_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8717 3 100 3.30.1050.10
2yheA03 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8694 7 100 3.30.1050.10
4nurB03 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8546 2 101 3.30.1050.10
af_Q08347_515_642_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8511 1 101 3.30.1050.10
af_Q54PA2_138_240_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8504 6 100 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A7W0N2H3-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.992 4 101 GO:0005829
AF-A0A7W1N4I3-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9851 5 101 GO:0005829
AF-A0A7W0N2H3-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.982 4 101 GO:0005829
AF-A0A7W0P806-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9802 1 101 GO:0005829
AF-A0A7W0P806-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.9707 1 101 GO:0005829

Map