F468026
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 600 | 237 | 1200 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300053077|Ga0495601_0160929|Ga0495601_0160929_569_1291 |
| Length | 240 |
| Sequence | LCRVCDGTVPIVRQIDAALTVAAARAACYNAGVSGRILWDVDTQVDFVLPEGKLYVRGAEETAPAMGRLVAAAREAGLVHVASADDHELTDPEISDEPDFRNTYPPHCLRGTRGAARIPETEQADPLPLPLVPFPPGLVPELISHRRELLLLKKSFDVFTNPNAEAVLDALDPDEVILFGVATDVCVDAAILGLLRRGRRVTFVEDAARGLDDEHVATCTAAWREGGVAFTTTDDVVNSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 144 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 146 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 147 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 155 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 156 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 157 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 199 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 237 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 1.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 14 |
| Rhizosphere | 85.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495601_0160929 | 3300053077 | Bacteria | 1467 |
| 2 | MBSR1b_contig_7856167 | 2162886012 | Bacteria | 1014 |
| 3 | Ga0070658_10009314 | 3300005327 | Bacteria | 7896 |
| 4 | Ga0070683_100059606 | 3300005329 | Bacteria | 3546 |
| 5 | Ga0070683_100090091 | 3300005329 | Bacteria | 2879 |
| 6 | Ga0070683_100194305 | 3300005329 | Bacteria | 1927 |
| 7 | Ga0070683_100491417 | 3300005329 | Bacteria | 1172 |
| 8 | Ga0070683_100660921 | 3300005329 | Unclassified | 1001 |
| 9 | Ga0070680_100052144 | 3300005336 | Bacteria | 3339 |
| 10 | Ga0070680_100281245 | 3300005336 | Bacteria | 1410 |
| 11 | Ga0070680_100319950 | 3300005336 | Bacteria | 1317 |
| 12 | Ga0070682_100104654 | 3300005337 | Bacteria | 1875 |
| 13 | Ga0070682_100248099 | 3300005337 | Bacteria | 1282 |
| 14 | Ga0070660_100000984 | 3300005339 | Bacteria | 19070 |
| 15 | Ga0070660_100032748 | 3300005339 | Bacteria | 3914 |
| 16 | Ga0070660_100168287 | 3300005339 | Bacteria | 1769 |
| 17 | Ga0070661_100046370 | 3300005344 | Bacteria | 3179 |
| 18 | Ga0070661_100090227 | 3300005344 | Bacteria | 2270 |
| 19 | Ga0070661_100690734 | 3300005344 | Unclassified | 831 |
| 20 | Ga0070675_100403441 | 3300005354 | Bacteria | 1220 |
| 21 | Ga0070671_100170559 | 3300005355 | Bacteria | 1840 |
| 22 | Ga0070659_100184372 | 3300005366 | Bacteria | 1713 |
| 23 | Ga0070659_100263652 | 3300005366 | Bacteria | 1430 |
| 24 | Ga0070659_100708414 | 3300005366 | Unclassified | 871 |
| 25 | Ga0070709_10355177 | 3300005434 | Unclassified | 1084 |
| 26 | Ga0070714_100041357 | 3300005435 | Bacteria | 3889 |
| 27 | Ga0070714_100220352 | 3300005435 | Bacteria | 1743 |
| 28 | Ga0070714_100457659 | 3300005435 | Bacteria | 1213 |
| 29 | Ga0070713_100049718 | 3300005436 | Bacteria | 3460 |
| 30 | Ga0070713_100329560 | 3300005436 | Unclassified | 1412 |
| 31 | Ga0070701_10447589 | 3300005438 | Bacteria | 828 |
| 32 | Ga0070705_100177309 | 3300005440 | Bacteria | 1440 |
| 33 | Ga0070694_100257924 | 3300005444 | Bacteria | 1321 |
| 34 | Ga0070708_100043266 | 3300005445 | Bacteria | 3956 |
| 35 | Ga0070663_100418302 | 3300005455 | Unclassified | 1099 |
| 36 | Ga0070678_100264808 | 3300005456 | Bacteria | 1447 |
| 37 | Ga0070678_100295431 | 3300005456 | Bacteria | 1375 |
| 38 | Ga0070681_10008140 | 3300005458 | Bacteria | 10263 |
| 39 | Ga0070681_10016502 | 3300005458 | Bacteria | 7375 |
| 40 | Ga0070681_10051912 | 3300005458 | Bacteria | 4090 |
| 41 | Ga0070681_10063702 | 3300005458 | Bacteria | 3659 |
| 42 | Ga0070681_10116438 | 3300005458 | Bacteria | 2609 |
| 43 | Ga0070681_10119553 | 3300005458 | Bacteria | 2571 |
| 44 | Ga0070685_10445593 | 3300005466 | Unclassified | 906 |
| 45 | Ga0070707_100005156 | 3300005468 | Bacteria | 12238 |
| 46 | Ga0070707_100295176 | 3300005468 | Bacteria | 1575 |
| 47 | Ga0070707_100541998 | 3300005468 | Bacteria | 1126 |
| 48 | Ga0070698_100038579 | 3300005471 | Bacteria | 4921 |
| 49 | Ga0070698_100090569 | 3300005471 | Bacteria | 3041 |
| 50 | Ga0070698_100237780 | 3300005471 | Archaea | 1754 |
| 51 | Ga0070698_100550710 | 3300005471 | Bacteria | 1093 |
| 52 | Ga0070698_100694037 | 3300005471 | Unclassified | 960 |
| 53 | Ga0070698_100755210 | 3300005471 | Bacteria | 916 |
| 54 | Ga0070699_100280596 | 3300005518 | Bacteria | 1492 |
| 55 | Ga0070699_100565075 | 3300005518 | Unclassified | 1036 |
| 56 | Ga0070679_100027515 | 3300005530 | Bacteria | 5597 |
| 57 | Ga0070679_100047714 | 3300005530 | Archaea | 4267 |
| 58 | Ga0070679_100057187 | 3300005530 | Bacteria | 3887 |
| 59 | Ga0070679_100063954 | 3300005530 | Bacteria | 3666 |
| 60 | Ga0070679_100076254 | 3300005530 | Bacteria | 3343 |
| 61 | Ga0070684_100024186 | 3300005535 | Bacteria | 5093 |
| 62 | Ga0070684_100032922 | 3300005535 | Bacteria | 4422 |
| 63 | Ga0070684_100064947 | 3300005535 | Bacteria | 3202 |
| 64 | Ga0070684_100068643 | 3300005535 | Bacteria | 3116 |
| 65 | Ga0070684_100147457 | 3300005535 | Bacteria | 2130 |
| 66 | Ga0070684_100639987 | 3300005535 | Unclassified | 990 |
| 67 | Ga0070684_100673132 | 3300005535 | Bacteria | 964 |
| 68 | Ga0070697_100047383 | 3300005536 | Bacteria | 3484 |
| 69 | Ga0070697_100337449 | 3300005536 | Bacteria | 1300 |
| 70 | Ga0068853_100211924 | 3300005539 | Unclassified | 1766 |
| 71 | Ga0068853_100653815 | 3300005539 | Bacteria | 1001 |
| 72 | Ga0070672_100068999 | 3300005543 | Bacteria | 2805 |
| 73 | Ga0070696_100027076 | 3300005546 | Bacteria | 3904 |
| 74 | Ga0070696_100073312 | 3300005546 | Bacteria | 2412 |
| 75 | Ga0070693_100067652 | 3300005547 | Bacteria | 2094 |
| 76 | Ga0070704_100063673 | 3300005549 | Bacteria | 2647 |
| 77 | Ga0070704_100140030 | 3300005549 | Bacteria | 1888 |
| 78 | Ga0068855_100036745 | 3300005563 | Bacteria | 5827 |
| 79 | Ga0068855_100059511 | 3300005563 | Bacteria | 4469 |
| 80 | Ga0068855_100129663 | 3300005563 | Bacteria | 2881 |
| 81 | Ga0068855_100200504 | 3300005563 | Bacteria | 2246 |
| 82 | Ga0068855_100343058 | 3300005563 | Bacteria | 1646 |
| 83 | Ga0070664_100279419 | 3300005564 | Bacteria | 1505 |
| 84 | Ga0068856_100038352 | 3300005614 | Bacteria | 4703 |
| 85 | Ga0068856_100475331 | 3300005614 | Bacteria | 1271 |
| 86 | Ga0070702_100419935 | 3300005615 | Bacteria | 962 |
| 87 | Ga0068852_100052416 | 3300005616 | Bacteria | 3506 |
| 88 | Ga0068852_100065755 | 3300005616 | Bacteria | 3165 |
| 89 | Ga0068852_100145400 | 3300005616 | Bacteria | 2199 |
| 90 | Ga0068852_100693760 | 3300005616 | Bacteria | 1028 |
| 91 | Ga0068866_10255003 | 3300005718 | Bacteria | 1075 |
| 92 | Ga0068861_100309067 | 3300005719 | Unclassified | 1372 |
| 93 | Ga0068863_100838024 | 3300005841 | Bacteria | 918 |
| 94 | Ga0081455_10023971 | 3300005937 | Bacteria | 5662 |
| 95 | Ga0070717_10011291 | 3300006028 | Bacteria | 6778 |
| 96 | Ga0070717_10127386 | 3300006028 | Bacteria | 2187 |
| 97 | Ga0075365_10020916 | 3300006038 | Bacteria | 4070 |
| 98 | Ga0070716_100098882 | 3300006173 | Bacteria | 1784 |
| 99 | Ga0070716_100366214 | 3300006173 | Unclassified | 1025 |
| 100 | Ga0070712_100453682 | 3300006175 | Bacteria | 1068 |
| 101 | Ga0075367_10079491 | 3300006178 | Bacteria | 1982 |
| 102 | Ga0097621_100381533 | 3300006237 | Bacteria | 1259 |
| 103 | Ga0075433_10417969 | 3300006852 | Bacteria | 1182 |
| 104 | Ga0075434_101234566 | 3300006871 | Unclassified | 759 |
| 105 | Ga0068865_100235600 | 3300006881 | Bacteria | 1438 |
| 106 | Ga0075436_100234492 | 3300006914 | Bacteria | 1304 |
| 107 | Ga0105240_10007847 | 3300009093 | Bacteria | 15404 |
| 108 | Ga0105240_10043546 | 3300009093 | Bacteria | 5711 |
| 109 | Ga0105240_10240497 | 3300009093 | Bacteria | 2099 |
| 110 | Ga0105240_10990052 | 3300009093 | Bacteria | 900 |
| 111 | Ga0111539_10161787 | 3300009094 | Unclassified | 2618 |
| 112 | Ga0105245_10029924 | 3300009098 | Bacteria | 4815 |
| 113 | Ga0105245_10168482 | 3300009098 | Bacteria | 2084 |
| 114 | Ga0105245_10239551 | 3300009098 | Bacteria | 1758 |
| 115 | Ga0105245_10376095 | 3300009098 | Bacteria | 1413 |
| 116 | Ga0105245_10806040 | 3300009098 | Bacteria | 977 |
| 117 | Ga0114129_10201231 | 3300009147 | Bacteria | 2697 |
| 118 | Ga0114129_10352915 | 3300009147 | Bacteria | 1948 |
| 119 | Ga0105243_10097674 | 3300009148 | Bacteria | 2431 |
| 120 | Ga0105243_10380858 | 3300009148 | Bacteria | 1305 |
| 121 | Ga0105243_10956248 | 3300009148 | Bacteria | 856 |
| 122 | Ga0105243_11121048 | 3300009148 | Unclassified | 796 |
| 123 | Ga0105242_10079385 | 3300009176 | Unclassified | 2740 |
| 124 | Ga0105242_10089259 | 3300009176 | Bacteria | 2591 |
| 125 | Ga0105242_10475344 | 3300009176 | Bacteria | 1183 |
| 126 | Ga0105248_10151720 | 3300009177 | Bacteria | 2614 |
| 127 | Ga0105248_10868520 | 3300009177 | Bacteria | 1018 |
| 128 | Ga0105248_11093138 | 3300009177 | Bacteria | 901 |
| 129 | Ga0105238_10768305 | 3300009551 | Unclassified | 978 |
| 130 | Ga0105249_10568827 | 3300009553 | Bacteria | 1186 |
| 131 | Ga0105239_10019324 | 3300010375 | Bacteria | 7524 |
| 132 | Ga0105239_10180960 | 3300010375 | Bacteria | 2359 |
| 133 | Ga0105239_10769332 | 3300010375 | Bacteria | 1102 |
| 134 | Ga0105246_10102930 | 3300011119 | Bacteria | 2083 |
| 135 | Ga0157373_10118968 | 3300013100 | Bacteria | 1857 |
| 136 | Ga0157373_10166076 | 3300013100 | Bacteria | 1553 |
| 137 | Ga0157373_10633264 | 3300013100 | Bacteria | 780 |
| 138 | Ga0157371_10080264 | 3300013102 | Bacteria | 2310 |
| 139 | Ga0157370_10005135 | 3300013104 | Bacteria | 14764 |
| 140 | Ga0157370_10015554 | 3300013104 | Bacteria | 7735 |
| 141 | Ga0157370_10130824 | 3300013104 | Bacteria | 2341 |
| 142 | Ga0157370_10265110 | 3300013104 | Bacteria | 1587 |
| 143 | Ga0157370_10287828 | 3300013104 | Bacteria | 1518 |
| 144 | Ga0157370_10312525 | 3300013104 | Bacteria | 1450 |
| 145 | Ga0157369_10001404 | 3300013105 | Bacteria | 29589 |
| 146 | Ga0157369_10003691 | 3300013105 | Bacteria | 18191 |
| 147 | Ga0157369_10005700 | 3300013105 | Bacteria | 14465 |
| 148 | Ga0157369_10005810 | 3300013105 | Bacteria | 14346 |
| 149 | Ga0157369_10014197 | 3300013105 | Bacteria | 8998 |
| 150 | Ga0157369_10111986 | 3300013105 | Bacteria | 2900 |
| 151 | Ga0157369_10212353 | 3300013105 | Bacteria | 2028 |
| 152 | Ga0157369_10646461 | 3300013105 | Bacteria | 1091 |
| 153 | Ga0157369_10724877 | 3300013105 | Bacteria | 1023 |
| 154 | Ga0157369_10926139 | 3300013105 | Unclassified | 893 |
| 155 | Ga0157374_10278141 | 3300013296 | Bacteria | 1652 |
| 156 | Ga0157374_10631684 | 3300013296 | Bacteria | 1082 |
| 157 | Ga0157378_10922374 | 3300013297 | Bacteria | 905 |
| 158 | Ga0157372_10121999 | 3300013307 | Bacteria | 2994 |
| 159 | Ga0157372_10971048 | 3300013307 | Bacteria | 984 |
| 160 | Ga0157372_11001019 | 3300013307 | Bacteria | 968 |
| 161 | Ga0157375_10043912 | 3300013308 | Bacteria | 4337 |
| 162 | Ga0157375_10072618 | 3300013308 | Unclassified | 3458 |
| 163 | Ga0157375_10132191 | 3300013308 | Bacteria | 2616 |
| 164 | Ga0182008_10005917 | 3300014497 | Bacteria | 6903 |
| 165 | Ga0157377_10020511 | 3300014745 | Bacteria | 3464 |
| 166 | Ga0157377_10075483 | 3300014745 | Bacteria | 1958 |
| 167 | Ga0157377_10259544 | 3300014745 | Bacteria | 1130 |
| 168 | Ga0157376_10260787 | 3300014969 | Bacteria | 1624 |
| 169 | Ga0182006_1034074 | 3300015261 | Bacteria | 2039 |
| 170 | Ga0206356_10226513 | 3300020070 | Bacteria | 3070 |
| 171 | Ga0206356_10559060 | 3300020070 | Unclassified | 934 |
| 172 | Ga0206356_11243275 | 3300020070 | Bacteria | 807 |
| 173 | Ga0206354_11488358 | 3300020081 | Bacteria | 3631 |
| 174 | Ga0206353_10361018 | 3300020082 | Bacteria | 3733 |
| 175 | Ga0206353_10671812 | 3300020082 | Bacteria | 3587 |
| 176 | Ga0206353_10948189 | 3300020082 | Bacteria | 2037 |
| 177 | Ga0213871_10032651 | 3300021441 | Bacteria | 1365 |
| 178 | Ga0207699_10042520 | 3300025906 | Bacteria | 2633 |
| 179 | Ga0207699_10446795 | 3300025906 | Unclassified | 927 |
| 180 | Ga0207699_10587615 | 3300025906 | Bacteria | 810 |
| 181 | Ga0207705_10424885 | 3300025909 | Unclassified | 1029 |
| 182 | Ga0207705_10739562 | 3300025909 | Unclassified | 764 |
| 183 | Ga0207684_10356019 | 3300025910 | Unclassified | 1260 |
| 184 | Ga0207707_10022570 | 3300025912 | Bacteria | 5501 |
| 185 | Ga0207707_10032427 | 3300025912 | Bacteria | 4572 |
| 186 | Ga0207707_10039358 | 3300025912 | Bacteria | 4133 |
| 187 | Ga0207707_10039982 | 3300025912 | Bacteria | 4098 |
| 188 | Ga0207707_10148733 | 3300025912 | Bacteria | 2048 |
| 189 | Ga0207707_10155468 | 3300025912 | Bacteria | 2000 |
| 190 | Ga0207695_10019644 | 3300025913 | Bacteria | 7772 |
| 191 | Ga0207695_10213400 | 3300025913 | Bacteria | 1840 |
| 192 | Ga0207695_10656142 | 3300025913 | Bacteria | 930 |
| 193 | Ga0207695_10716887 | 3300025913 | Bacteria | 881 |
| 194 | Ga0207671_10214370 | 3300025914 | Bacteria | 1507 |
| 195 | Ga0207693_10011954 | 3300025915 | Bacteria | 7018 |
| 196 | Ga0207693_10126798 | 3300025915 | Bacteria | 2006 |
| 197 | Ga0207660_10113992 | 3300025917 | Unclassified | 2038 |
| 198 | Ga0207662_10111543 | 3300025918 | Bacteria | 1706 |
| 199 | Ga0207657_10002091 | 3300025919 | Bacteria | 21596 |
| 200 | Ga0207657_10007705 | 3300025919 | Bacteria | 11002 |
| 201 | Ga0207657_10008201 | 3300025919 | Bacteria | 10643 |
| 202 | Ga0207657_10035720 | 3300025919 | Bacteria | 4454 |
| 203 | Ga0207657_10044262 | 3300025919 | Bacteria | 3914 |
| 204 | Ga0207657_10116791 | 3300025919 | Bacteria | 2198 |
| 205 | Ga0207657_10213364 | 3300025919 | Bacteria | 1548 |
| 206 | Ga0207649_10143169 | 3300025920 | Bacteria | 1638 |
| 207 | Ga0207652_10080533 | 3300025921 | Bacteria | 2847 |
| 208 | Ga0207652_10153472 | 3300025921 | Bacteria | 2062 |
| 209 | Ga0207652_10161457 | 3300025921 | Bacteria | 2009 |
| 210 | Ga0207652_10229968 | 3300025921 | Bacteria | 1671 |
| 211 | Ga0207652_10275520 | 3300025921 | Bacteria | 1518 |
| 212 | Ga0207652_10352742 | 3300025921 | Bacteria | 1328 |
| 213 | Ga0207652_10378555 | 3300025921 | Bacteria | 1278 |
| 214 | Ga0207652_10926273 | 3300025921 | Unclassified | 769 |
| 215 | Ga0207646_10007769 | 3300025922 | Bacteria | 10853 |
| 216 | Ga0207646_10167035 | 3300025922 | Bacteria | 1987 |
| 217 | Ga0207646_10190697 | 3300025922 | Bacteria | 1851 |
| 218 | Ga0207659_10221957 | 3300025926 | Bacteria | 1520 |
| 219 | Ga0207687_10040993 | 3300025927 | Bacteria | 3177 |
| 220 | Ga0207700_10000039 | 3300025928 | Bacteria | 102496 |
| 221 | Ga0207700_10566091 | 3300025928 | Unclassified | 1010 |
| 222 | Ga0207664_10005888 | 3300025929 | Bacteria | 8387 |
| 223 | Ga0207664_10021048 | 3300025929 | Bacteria | 4841 |
| 224 | Ga0207664_10052028 | 3300025929 | Bacteria | 3237 |
| 225 | Ga0207664_10228781 | 3300025929 | Bacteria | 1615 |
| 226 | Ga0207664_10515125 | 3300025929 | Unclassified | 1072 |
| 227 | Ga0207690_10037079 | 3300025932 | Bacteria | 3163 |
| 228 | Ga0207690_10071023 | 3300025932 | Bacteria | 2400 |
| 229 | Ga0207706_10064391 | 3300025933 | Bacteria | 3227 |
| 230 | Ga0207706_10544640 | 3300025933 | Bacteria | 999 |
| 231 | Ga0207686_10102440 | 3300025934 | Unclassified | 1914 |
| 232 | Ga0207686_10299625 | 3300025934 | Bacteria | 1193 |
| 233 | Ga0207704_10302645 | 3300025938 | Bacteria | 1226 |
| 234 | Ga0207665_10075176 | 3300025939 | Bacteria | 2313 |
| 235 | Ga0207665_10113381 | 3300025939 | Bacteria | 1907 |
| 236 | Ga0207665_10121104 | 3300025939 | Bacteria | 1848 |
| 237 | Ga0207691_10085234 | 3300025940 | Bacteria | 2835 |
| 238 | Ga0207711_10094264 | 3300025941 | Bacteria | 2638 |
| 239 | Ga0207711_10856521 | 3300025941 | Bacteria | 846 |
| 240 | Ga0207661_10000846 | 3300025944 | Bacteria | 20063 |
| 241 | Ga0207661_10004419 | 3300025944 | Bacteria | 9863 |
| 242 | Ga0207661_10214645 | 3300025944 | Bacteria | 1697 |
| 243 | Ga0207661_10260674 | 3300025944 | Bacteria | 1544 |
| 244 | Ga0207661_10558425 | 3300025944 | Bacteria | 1049 |
| 245 | Ga0207679_10121456 | 3300025945 | Bacteria | 2081 |
| 246 | Ga0207679_10565137 | 3300025945 | Bacteria | 1022 |
| 247 | Ga0207667_10151851 | 3300025949 | Bacteria | 2383 |
| 248 | Ga0207667_10184238 | 3300025949 | Bacteria | 2144 |
| 249 | Ga0207667_10687766 | 3300025949 | Unclassified | 1026 |
| 250 | Ga0207651_10155099 | 3300025960 | Bacteria | 1788 |
| 251 | Ga0207639_10521594 | 3300026041 | Bacteria | 1088 |
| 252 | Ga0207702_10157783 | 3300026078 | Bacteria | 2069 |
| 253 | Ga0207702_10162865 | 3300026078 | Bacteria | 2038 |
| 254 | Ga0207702_10569359 | 3300026078 | Bacteria | 1109 |
| 255 | Ga0207702_10685246 | 3300026078 | Bacteria | 1009 |
| 256 | Ga0207641_10371131 | 3300026088 | Bacteria | 1368 |
| 257 | Ga0207641_11106466 | 3300026088 | Bacteria | 791 |
| 258 | Ga0207648_10087644 | 3300026089 | Bacteria | 2717 |
| 259 | Ga0207675_100764146 | 3300026118 | Unclassified | 978 |
| 260 | Ga0207683_10029199 | 3300026121 | Bacteria | 4773 |
| 261 | Ga0207698_10045528 | 3300026142 | Bacteria | 3306 |
| 262 | Ga0207698_10055419 | 3300026142 | Bacteria | 3056 |
| 263 | Ga0207698_10568544 | 3300026142 | Bacteria | 1114 |
| 264 | Ga0207698_11097875 | 3300026142 | Bacteria | 808 |
| 265 | Ga0268266_10832138 | 3300028379 | Unclassified | 892 |
| 266 | Ga0265319_1002454 | 3300028563 | Bacteria | 10122 |
| 267 | Ga0265318_10027242 | 3300028577 | Bacteria | 2247 |
| 268 | Ga0265323_10093777 | 3300028653 | Bacteria | 1000 |
| 269 | Ga0265322_10015265 | 3300028654 | Bacteria | 2219 |
| 270 | Ga0265338_10028780 | 3300028800 | Bacteria | 5531 |
| 271 | Ga0265330_10184373 | 3300031235 | Bacteria | 884 |
| 272 | Ga0265320_10013704 | 3300031240 | Bacteria | 4649 |
| 273 | Ga0265339_10236691 | 3300031249 | Unclassified | 888 |
| 274 | Ga0265331_10208650 | 3300031250 | Bacteria | 879 |
| 275 | Ga0265316_10083542 | 3300031344 | Bacteria | 2446 |
| 276 | Ga0265314_10021108 | 3300031711 | Bacteria | 5016 |
| 277 | Ga0307405_10146790 | 3300031731 | Bacteria | 1653 |
| 278 | Ga0307413_10042128 | 3300031824 | Bacteria | 2680 |
| 279 | Ga0307410_10051758 | 3300031852 | Bacteria | 2769 |
| 280 | Ga0307407_10152931 | 3300031903 | Bacteria | 1501 |
| 281 | Ga0307412_10478266 | 3300031911 | Bacteria | 1032 |
| 282 | Ga0307416_100497619 | 3300032002 | Bacteria | 1282 |
| 283 | Ga0307414_10056386 | 3300032004 | Bacteria | 2756 |
| 284 | Ga0307411_10071221 | 3300032005 | Bacteria | 2355 |
| 285 | Ga0373943_0011392 | 3300035170 | Bacteria | 4002 |
| 286 | Ga0395899_0022900 | 3300037312 | Bacteria | 4733 |
| 287 | Ga0395899_0047390 | 3300037312 | Bacteria | 3200 |
| 288 | Ga0395899_0059359 | 3300037312 | Bacteria | 2820 |
| 289 | Ga0395899_0174910 | 3300037312 | Bacteria | 1510 |
| 290 | Ga0395899_0355325 | 3300037312 | Bacteria | 979 |
| 291 | Ga0395899_0548317 | 3300037312 | Unclassified | 743 |
| 292 | Ga0395899_0553788 | 3300037312 | Bacteria | 739 |
| 293 | Ga0395900_0000528 | 3300037418 | Bacteria | 53945 |
| 294 | Ga0395900_0003881 | 3300037418 | Bacteria | 15977 |
| 295 | Ga0395900_0014793 | 3300037418 | Bacteria | 7952 |
| 296 | Ga0395900_0035757 | 3300037418 | Bacteria | 5118 |
| 297 | Ga0395900_0054878 | 3300037418 | Bacteria | 4102 |
| 298 | Ga0395900_0096139 | 3300037418 | Bacteria | 3043 |
| 299 | Ga0395900_0116010 | 3300037418 | Bacteria | 2748 |
| 300 | Ga0395900_0119863 | 3300037418 | Bacteria | 2700 |
| 301 | Ga0395900_0134013 | 3300037418 | Bacteria | 2538 |
| 302 | Ga0395900_0152633 | 3300037418 | Bacteria | 2359 |
| 303 | Ga0395900_0173232 | 3300037418 | Bacteria | 2196 |
| 304 | Ga0395900_0196510 | 3300037418 | Bacteria | 2043 |
| 305 | Ga0395900_0279065 | 3300037418 | Bacteria | 1663 |
| 306 | Ga0395900_0293444 | 3300037418 | Bacteria | 1614 |
| 307 | Ga0395900_0548111 | 3300037418 | Unclassified | 1101 |
| 308 | Ga0395900_0742237 | 3300037418 | Unclassified | 912 |
| 309 | Ga0395898_0007329 | 3300037466 | Bacteria | 11711 |
| 310 | Ga0395898_0008888 | 3300037466 | Bacteria | 10583 |
| 311 | Ga0395898_0009120 | 3300037466 | Bacteria | 10449 |
| 312 | Ga0395898_0012243 | 3300037466 | Bacteria | 8868 |
| 313 | Ga0395898_0014330 | 3300037466 | Bacteria | 8147 |
| 314 | Ga0395898_0040289 | 3300037466 | Bacteria | 4620 |
| 315 | Ga0395898_0050568 | 3300037466 | Bacteria | 4067 |
| 316 | Ga0395898_0052061 | 3300037466 | Bacteria | 4000 |
| 317 | Ga0395898_0080162 | 3300037466 | Bacteria | 3149 |
| 318 | Ga0395898_0174455 | 3300037466 | Bacteria | 2055 |
| 319 | Ga0395898_0178585 | 3300037466 | Bacteria | 2029 |
| 320 | Ga0395898_0238063 | 3300037466 | Archaea | 1736 |
| 321 | Ga0395898_0746787 | 3300037466 | Bacteria | 920 |
| 322 | Ga0395905_0000661 | 3300037471 | Bacteria | 45819 |
| 323 | Ga0395905_0003053 | 3300037471 | Bacteria | 18137 |
| 324 | Ga0395905_0017506 | 3300037471 | Bacteria | 6803 |
| 325 | Ga0395905_0030433 | 3300037471 | Bacteria | 5086 |
| 326 | Ga0395905_0056384 | 3300037471 | Bacteria | 3676 |
| 327 | Ga0395905_0866389 | 3300037471 | Unclassified | 806 |
| 328 | Ga0395905_1133138 | 3300037471 | Bacteria | 686 |
| 329 | Ga0436364_0197195 | 3300037853 | Bacteria | 2562 |
| 330 | Ga0395901_0001883 | 3300038443 | Bacteria | 21647 |
| 331 | Ga0395901_0001886 | 3300038443 | Bacteria | 21635 |
| 332 | Ga0395901_0004160 | 3300038443 | Bacteria | 14597 |
| 333 | Ga0395901_0005294 | 3300038443 | Bacteria | 13040 |
| 334 | Ga0395901_0009762 | 3300038443 | Bacteria | 9733 |
| 335 | Ga0395901_0012865 | 3300038443 | Bacteria | 8487 |
| 336 | Ga0395901_0022948 | 3300038443 | Bacteria | 6397 |
| 337 | Ga0395901_0037025 | 3300038443 | Bacteria | 5046 |
| 338 | Ga0395901_0185068 | 3300038443 | Bacteria | 2184 |
| 339 | Ga0395901_0191437 | 3300038443 | Bacteria | 2145 |
| 340 | Ga0395901_0233145 | 3300038443 | Bacteria | 1921 |
| 341 | Ga0395901_0286783 | 3300038443 | Bacteria | 1709 |
| 342 | Ga0395901_0289506 | 3300038443 | Bacteria | 1700 |
| 343 | Ga0395901_0358651 | 3300038443 | Bacteria | 1504 |
| 344 | Ga0395901_0401041 | 3300038443 | Bacteria | 1409 |
| 345 | Ga0395901_0619309 | 3300038443 | Bacteria | 1089 |
| 346 | Ga0395901_0811510 | 3300038443 | Unclassified | 924 |
| 347 | Ga0395901_0994096 | 3300038443 | Bacteria | 815 |
| 348 | Ga0395901_1091775 | 3300038443 | Bacteria | 769 |
| 349 | Ga0436365_1828440 | 3300039437 | Bacteria | 2656 |
| 350 | Ga0436360_1152069 | 3300039438 | Bacteria | 1988 |
| 351 | Ga0451804_0368465 | 3300041463 | Bacteria | 815 |
| 352 | Ga0451835_0581384 | 3300041492 | Bacteria | 787 |
| 353 | Ga0439448_0045616 | 3300042005 | Bacteria | 1427 |
| 354 | Ga0439451_017413 | 3300042009 | Unclassified | 1448 |
| 355 | Ga0466969_0020610 | 3300044656 | Bacteria | 3413 |
| 356 | Ga0466972_0055149 | 3300044658 | Bacteria | 1912 |
| 357 | Ga0466972_0516435 | 3300044658 | Unclassified | 563 |
| 358 | Ga0466965_0043874 | 3300044683 | Bacteria | 2209 |
| 359 | Ga0466965_0083177 | 3300044683 | Bacteria | 1620 |
| 360 | Ga0466965_0243247 | 3300044683 | Bacteria | 964 |
| 361 | Ga0466965_0403011 | 3300044683 | Bacteria | 756 |
| 362 | Ga0466966_0014288 | 3300044684 | Bacteria | 5256 |
| 363 | Ga0466966_0129382 | 3300044684 | Bacteria | 1547 |
| 364 | Ga0466961_0003261 | 3300044693 | Bacteria | 10104 |
| 365 | Ga0466961_0070676 | 3300044693 | Bacteria | 2216 |
| 366 | Ga0466961_0132158 | 3300044693 | Bacteria | 1564 |
| 367 | Ga0466963_0002288 | 3300044694 | Bacteria | 10650 |
| 368 | Ga0466963_0011538 | 3300044694 | Bacteria | 5381 |
| 369 | Ga0466963_0025079 | 3300044694 | Bacteria | 3799 |
| 370 | Ga0466963_0025670 | 3300044694 | Bacteria | 3760 |
| 371 | Ga0466963_0048221 | 3300044694 | Bacteria | 2813 |
| 372 | Ga0466963_0105608 | 3300044694 | Bacteria | 1930 |
| 373 | Ga0466963_0227613 | 3300044694 | Bacteria | 1306 |
| 374 | Ga0466963_0298206 | 3300044694 | Bacteria | 1133 |
| 375 | Ga0466963_0312352 | 3300044694 | Bacteria | 1106 |
| 376 | Ga0466964_0003042 | 3300044706 | Bacteria | 6085 |
| 377 | Ga0466964_0009153 | 3300044706 | Bacteria | 3726 |
| 378 | Ga0466964_0044241 | 3300044706 | Bacteria | 1808 |
| 379 | Ga0466964_0231186 | 3300044706 | Bacteria | 903 |
| 380 | Ga0466971_0004887 | 3300044719 | Bacteria | 5794 |
| 381 | Ga0466971_0045326 | 3300044719 | Bacteria | 1975 |
| 382 | Ga0466971_0056421 | 3300044719 | Bacteria | 1772 |
| 383 | Ga0466971_0083978 | 3300044719 | Bacteria | 1454 |
| 384 | Ga0466971_0104090 | 3300044719 | Bacteria | 1306 |
| 385 | Ga0466971_0242374 | 3300044719 | Bacteria | 858 |
| 386 | Ga0466968_0056140 | 3300044735 | Bacteria | 1691 |
| 387 | Ga0466970_0123033 | 3300044765 | Bacteria | 1422 |
| 388 | Ga0466970_0464886 | 3300044765 | Bacteria | 726 |
| 389 | Ga0466957_0000806 | 3300044842 | Bacteria | 15982 |
| 390 | Ga0466957_0014641 | 3300044842 | Bacteria | 4570 |
| 391 | Ga0466957_0120410 | 3300044842 | Bacteria | 1673 |
| 392 | Ga0466957_0250531 | 3300044842 | Bacteria | 1177 |
| 393 | Ga0466957_0682102 | 3300044842 | Bacteria | 724 |
| 394 | Ga0466960_0147214 | 3300044901 | Unclassified | 1255 |
| 395 | Ga0466960_0311427 | 3300044901 | Unclassified | 889 |
| 396 | Ga0466959_0009826 | 3300045049 | Bacteria | 6817 |
| 397 | Ga0466959_0023901 | 3300045049 | Bacteria | 4524 |
| 398 | Ga0466959_0182609 | 3300045049 | Bacteria | 1467 |
| 399 | Ga0466959_0216804 | 3300045049 | Bacteria | 1328 |
| 400 | Ga0466958_0009266 | 3300045836 | Bacteria | 5481 |
| 401 | Ga0466958_0033843 | 3300045836 | Bacteria | 3046 |
| 402 | Ga0466958_0044488 | 3300045836 | Bacteria | 2676 |
| 403 | Ga0466958_0165414 | 3300045836 | Bacteria | 1399 |
| 404 | Ga0466958_0356624 | 3300045836 | Bacteria | 942 |
| 405 | Ga0466967_0002124 | 3300045976 | Bacteria | 12152 |
| 406 | Ga0466967_0002856 | 3300045976 | Bacteria | 10972 |
| 407 | Ga0466967_0003602 | 3300045976 | Bacteria | 10170 |
| 408 | Ga0466967_0005947 | 3300045976 | Bacteria | 8561 |
| 409 | Ga0466967_0007612 | 3300045976 | Bacteria | 7833 |
| 410 | Ga0466967_0023094 | 3300045976 | Bacteria | 5091 |
| 411 | Ga0466967_0026759 | 3300045976 | Bacteria | 4784 |
| 412 | Ga0466967_0037188 | 3300045976 | Bacteria | 4163 |
| 413 | Ga0466967_0042602 | 3300045976 | Bacteria | 3924 |
| 414 | Ga0466967_0056485 | 3300045976 | Bacteria | 3462 |
| 415 | Ga0466967_0063248 | 3300045976 | Bacteria | 3287 |
| 416 | Ga0466967_0088341 | 3300045976 | Bacteria | 2813 |
| 417 | Ga0466967_0137081 | 3300045976 | Bacteria | 2276 |
| 418 | Ga0466967_0252031 | 3300045976 | Bacteria | 1686 |
| 419 | Ga0466967_0290229 | 3300045976 | Bacteria | 1571 |
| 420 | Ga0466967_0429549 | 3300045976 | Bacteria | 1288 |
| 421 | Ga0466967_0599289 | 3300045976 | Bacteria | 1087 |
| 422 | Ga0466967_0704738 | 3300045976 | Bacteria | 1000 |
| 423 | Ga0466967_0740476 | 3300045976 | Unclassified | 975 |
| 424 | Ga0495629_0007333 | 3300046459 | Bacteria | 8127 |
| 425 | Ga0495629_0142081 | 3300046459 | Bacteria | 1670 |
| 426 | Ga0495641_0232553 | 3300046461 | Bacteria | 827 |
| 427 | Ga0495651_0026302 | 3300046462 | Bacteria | 4533 |
| 428 | Ga0495653_0012836 | 3300046463 | Bacteria | 6839 |
| 429 | Ga0495653_0150263 | 3300046463 | Bacteria | 1628 |
| 430 | Ga0495582_0276047 | 3300046473 | Bacteria | 965 |
| 431 | Ga0495662_0040686 | 3300046476 | Bacteria | 2245 |
| 432 | Ga0495662_0106341 | 3300046476 | Bacteria | 1374 |
| 433 | Ga0495664_0131427 | 3300046477 | Bacteria | 1516 |
| 434 | Ga0495594_0105498 | 3300046499 | Bacteria | 1587 |
| 435 | Ga0495594_0234726 | 3300046499 | Archaea | 1045 |
| 436 | Ga0495608_0097169 | 3300046511 | Bacteria | 1901 |
| 437 | Ga0495628_0263867 | 3300046516 | Bacteria | 1283 |
| 438 | Ga0495630_0002134 | 3300046517 | Bacteria | 13757 |
| 439 | Ga0495630_0074432 | 3300046517 | Bacteria | 2558 |
| 440 | Ga0495630_0168706 | 3300046517 | Bacteria | 1667 |
| 441 | Ga0495652_0203533 | 3300046529 | Bacteria | 1500 |
| 442 | Ga0495640_0014274 | 3300046533 | Bacteria | 6018 |
| 443 | Ga0495640_0441920 | 3300046533 | Unclassified | 795 |
| 444 | Ga0495586_0059045 | 3300046535 | Bacteria | 2084 |
| 445 | Ga0495587_0191728 | 3300046536 | Bacteria | 1157 |
| 446 | Ga0495667_0012309 | 3300046559 | Bacteria | 5799 |
| 447 | Ga0495667_0135730 | 3300046559 | Bacteria | 1586 |
| 448 | Ga0495634_0032263 | 3300046642 | Bacteria | 3603 |
| 449 | Ga0495611_0127139 | 3300046648 | Archaea | 1189 |
| 450 | Ga0495635_0049727 | 3300046663 | Bacteria | 2890 |
| 451 | Ga0495659_0005067 | 3300046664 | Bacteria | 4138 |
| 452 | Ga0495657_0065250 | 3300046675 | Bacteria | 2395 |
| 453 | Ga0495658_0062829 | 3300046683 | Bacteria | 2135 |
| 454 | Ga0495658_0168187 | 3300046683 | Bacteria | 1355 |
| 455 | Ga0495658_0200260 | 3300046683 | Bacteria | 1244 |
| 456 | Ga0495613_0084508 | 3300046689 | Bacteria | 2304 |
| 457 | Ga0495589_0044768 | 3300046794 | Bacteria | 2200 |
| 458 | Ga0495636_0019126 | 3300047318 | Bacteria | 2751 |
| 459 | Ga0495636_0533293 | 3300047318 | Bacteria | 570 |
| 460 | Ga0495674_0009083 | 3300047319 | Bacteria | 9443 |
| 461 | Ga0495676_0046845 | 3300047321 | Bacteria | 3504 |
| 462 | Ga0495676_0069055 | 3300047321 | Bacteria | 2728 |
| 463 | Ga0495684_0075522 | 3300047471 | Bacteria | 2560 |
| 464 | Ga0496100_0009489 | 3300048903 | Bacteria | 5468 |
| 465 | Ga0496100_0011643 | 3300048903 | Bacteria | 5013 |
| 466 | Ga0496100_0043159 | 3300048903 | Bacteria | 2883 |
| 467 | Ga0496100_0156471 | 3300048903 | Bacteria | 1630 |
| 468 | Ga0496100_0330194 | 3300048903 | Bacteria | 1148 |
| 469 | Ga0496101_0008135 | 3300048904 | Bacteria | 6844 |
| 470 | Ga0496101_0009285 | 3300048904 | Bacteria | 6459 |
| 471 | Ga0496101_0193482 | 3300048904 | Bacteria | 1570 |
| 472 | Ga0496102_0045475 | 3300048905 | Bacteria | 3986 |
| 473 | Ga0496102_0183382 | 3300048905 | Bacteria | 1972 |
| 474 | Ga0496102_0195160 | 3300048905 | Bacteria | 1908 |
| 475 | Ga0496102_0242164 | 3300048905 | Bacteria | 1701 |
| 476 | Ga0496103_0025489 | 3300048906 | Bacteria | 3575 |
| 477 | Ga0496103_0052117 | 3300048906 | Bacteria | 2534 |
| 478 | Ga0496103_0100465 | 3300048906 | Bacteria | 1831 |
| 479 | Ga0496103_0221789 | 3300048906 | Bacteria | 1216 |
| 480 | Ga0496104_0027105 | 3300048907 | Bacteria | 5300 |
| 481 | Ga0496104_0055055 | 3300048907 | Bacteria | 3761 |
| 482 | Ga0496104_0129752 | 3300048907 | Bacteria | 2421 |
| 483 | Ga0496105_0010552 | 3300048908 | Bacteria | 7267 |
| 484 | Ga0496105_0015044 | 3300048908 | Bacteria | 6157 |
| 485 | Ga0496105_0228693 | 3300048908 | Bacteria | 1512 |
| 486 | Ga0496106_0004542 | 3300048909 | Bacteria | 10284 |
| 487 | Ga0496106_0020981 | 3300048909 | Bacteria | 4848 |
| 488 | Ga0496106_0216987 | 3300048909 | Bacteria | 1525 |
| 489 | Ga0496106_0881514 | 3300048909 | Unclassified | 707 |
| 490 | Ga0496107_0000242 | 3300048910 | Bacteria | 28631 |
| 491 | Ga0496107_0016119 | 3300048910 | Bacteria | 5243 |
| 492 | Ga0496107_0016145 | 3300048910 | Bacteria | 5239 |
| 493 | Ga0496107_0151089 | 3300048910 | Bacteria | 1718 |
| 494 | Ga0496107_0176594 | 3300048910 | Bacteria | 1586 |
| 495 | Ga0496107_0266524 | 3300048910 | Bacteria | 1275 |
| 496 | Ga0496107_0313891 | 3300048910 | Bacteria | 1167 |
| 497 | Ga0496108_0003459 | 3300048911 | Bacteria | 12666 |
| 498 | Ga0496108_0028596 | 3300048911 | Bacteria | 4612 |
| 499 | Ga0496108_0029785 | 3300048911 | Bacteria | 4523 |
| 500 | Ga0496108_0591520 | 3300048911 | Unclassified | 967 |
| 501 | Ga0496109_0000288 | 3300048912 | Bacteria | 47831 |
| 502 | Ga0496109_0000534 | 3300048912 | Bacteria | 32226 |
| 503 | Ga0496109_0028031 | 3300048912 | Bacteria | 5034 |
| 504 | Ga0496109_0117906 | 3300048912 | Bacteria | 2471 |
| 505 | Ga0496109_0285557 | 3300048912 | Bacteria | 1555 |
| 506 | Ga0496109_0397262 | 3300048912 | Bacteria | 1302 |
| 507 | Ga0496109_0415488 | 3300048912 | Unclassified | 1271 |
| 508 | Ga0496109_0881697 | 3300048912 | Unclassified | 833 |
| 509 | Ga0496110_0009021 | 3300048913 | Bacteria | 8048 |
| 510 | Ga0496110_0019828 | 3300048913 | Bacteria | 5667 |
| 511 | Ga0496110_0067059 | 3300048913 | Bacteria | 3175 |
| 512 | Ga0496110_0170675 | 3300048913 | Bacteria | 1973 |
| 513 | Ga0496110_0192425 | 3300048913 | Bacteria | 1852 |
| 514 | Ga0496110_0203285 | 3300048913 | Bacteria | 1800 |
| 515 | Ga0496110_0218050 | 3300048913 | Bacteria | 1735 |
| 516 | Ga0496110_0943498 | 3300048913 | Bacteria | 769 |
| 517 | Ga0496111_0000204 | 3300048914 | Bacteria | 27767 |
| 518 | Ga0496111_0003515 | 3300048914 | Bacteria | 9694 |
| 519 | Ga0496111_0005855 | 3300048914 | Bacteria | 7928 |
| 520 | Ga0496111_0007836 | 3300048914 | Bacteria | 7034 |
| 521 | Ga0496111_0102125 | 3300048914 | Bacteria | 2108 |
| 522 | Ga0496111_0176755 | 3300048914 | Bacteria | 1587 |
| 523 | Ga0496111_0236356 | 3300048914 | Unclassified | 1357 |
| 524 | Ga0496112_0001332 | 3300048915 | Bacteria | 18774 |
| 525 | Ga0496112_0001848 | 3300048915 | Bacteria | 16642 |
| 526 | Ga0496112_0003412 | 3300048915 | Bacteria | 13125 |
| 527 | Ga0496112_0011398 | 3300048915 | Bacteria | 8117 |
| 528 | Ga0496112_0014336 | 3300048915 | Bacteria | 7346 |
| 529 | Ga0496112_0034446 | 3300048915 | Bacteria | 4928 |
| 530 | Ga0496112_0035626 | 3300048915 | Bacteria | 4850 |
| 531 | Ga0496112_0099695 | 3300048915 | Bacteria | 2875 |
| 532 | Ga0496112_0226623 | 3300048915 | Bacteria | 1824 |
| 533 | Ga0496112_0422459 | 3300048915 | Bacteria | 1272 |
| 534 | Ga0496112_0525577 | 3300048915 | Bacteria | 1118 |
| 535 | Ga0496113_0022276 | 3300048916 | Bacteria | 4479 |
| 536 | Ga0496113_0164141 | 3300048916 | Bacteria | 1757 |
| 537 | Ga0496113_0200664 | 3300048916 | Bacteria | 1585 |
| 538 | Ga0496113_0433413 | 3300048916 | Bacteria | 1056 |
| 539 | Ga0496113_0933080 | 3300048916 | Unclassified | 686 |
| 540 | Ga0496114_0007879 | 3300048917 | Bacteria | 8428 |
| 541 | Ga0496114_0060712 | 3300048917 | Bacteria | 3160 |
| 542 | Ga0496114_0131751 | 3300048917 | Bacteria | 2159 |
| 543 | Ga0496114_0139222 | 3300048917 | Bacteria | 2100 |
| 544 | Ga0496114_0157478 | 3300048917 | Bacteria | 1973 |
| 545 | Ga0496114_0539140 | 3300048917 | Bacteria | 1031 |
| 546 | Ga0496115_0033167 | 3300048918 | Bacteria | 4076 |
| 547 | Ga0501032_0667736 | 3300049569 | Bacteria | 660 |
| 548 | Ga0501034_0028452 | 3300049571 | Bacteria | 5688 |
| 549 | Ga0501040_0301690 | 3300049576 | Bacteria | 1145 |
| 550 | Ga0501047_0046363 | 3300049581 | Bacteria | 4201 |
| 551 | Ga0501047_0081551 | 3300049581 | Bacteria | 3109 |
| 552 | Ga0501067_0045639 | 3300049583 | Bacteria | 2432 |
| 553 | Ga0501067_0114172 | 3300049583 | Bacteria | 1502 |
| 554 | Ga0501067_0115656 | 3300049583 | Bacteria | 1492 |
| 555 | Ga0501067_0139056 | 3300049583 | Bacteria | 1352 |
| 556 | Ga0501067_0269863 | 3300049583 | Bacteria | 947 |
| 557 | Ga0501068_0153328 | 3300049584 | Bacteria | 1449 |
| 558 | Ga0501068_0263190 | 3300049584 | Bacteria | 1100 |
| 559 | Ga0501069_0064932 | 3300049585 | Bacteria | 2040 |
| 560 | Ga0501070_0006916 | 3300049586 | Bacteria | 9654 |
| 561 | Ga0501070_0020474 | 3300049586 | Bacteria | 5547 |
| 562 | Ga0501071_0238044 | 3300049587 | Bacteria | 1372 |
| 563 | Ga0501071_0999116 | 3300049587 | Bacteria | 646 |
| 564 | Ga0501072_0001809 | 3300049588 | Bacteria | 15925 |
| 565 | Ga0501072_0008341 | 3300049588 | Bacteria | 7868 |
| 566 | Ga0501072_0099859 | 3300049588 | Bacteria | 2307 |
| 567 | Ga0501072_0597273 | 3300049588 | Bacteria | 870 |
| 568 | Ga0501073_0063480 | 3300049589 | Bacteria | 2576 |
| 569 | Ga0501076_0070594 | 3300049592 | Bacteria | 2793 |
| 570 | Ga0501076_0248199 | 3300049592 | Unclassified | 1456 |
| 571 | Ga0501077_0246599 | 3300049593 | Unclassified | 1135 |
| 572 | Ga0501079_0097704 | 3300049741 | Unclassified | 2276 |
| 573 | Ga0501080_0006721 | 3300049742 | Bacteria | 10357 |
| 574 | Ga0501080_0071783 | 3300049742 | Bacteria | 3220 |
| 575 | Ga0501081_0048069 | 3300049743 | Bacteria | 2936 |
| 576 | Ga0501083_0015094 | 3300049744 | Bacteria | 5407 |
| 577 | Ga0501035_0770431 | 3300049822 | Bacteria | 771 |
| 578 | Ga0501044_0803022 | 3300049823 | Bacteria | 820 |
| 579 | nmdc:mga05p37_531223_c1 | 3300050507 | Bacteria | 1343 |
| 580 | nmdc:mga06r32_1115371_c1 | 3300050510 | Bacteria | 737 |
| 581 | nmdc:mga08y16_331128_c1 | 3300050511 | Bacteria | 1566 |
| 582 | nmdc:mga08y16_602494_c1 | 3300050511 | Bacteria | 1107 |
| 583 | nmdc:mga0n895_665104_c1 | 3300050512 | Bacteria | 1039 |
| 584 | nmdc:mga0rr50_376534_c1 | 3300050513 | Bacteria | 1196 |
| 585 | nmdc:mga08x19_284260_c1 | 3300050514 | Bacteria | 1147 |
| 586 | nmdc:mga0a205_98464_c1 | 3300050515 | Bacteria | 1324 |
| 587 | Ga0495612_0058167 | 3300053078 | Bacteria | 1598 |
| 588 | Ga0501084_0092960 | 3300054114 | Bacteria | 2532 |
| 589 | Ga0501084_0111046 | 3300054114 | Bacteria | 2304 |
| 590 | Ga0501084_0111677 | 3300054114 | Bacteria | 2297 |
| 591 | Ga0501084_0202217 | 3300054114 | Bacteria | 1676 |
| 592 | Ga0501084_0585627 | 3300054114 | Bacteria | 943 |
| 593 | Ga0501082_0059586 | 3300060353 | Bacteria | 3290 |
| 594 | Ga0501082_0130892 | 3300060353 | Bacteria | 2177 |
| 595 | Ga0466962_0002596 | 3300061719 | Bacteria | 8581 |
| 596 | Ga0466962_0014635 | 3300061719 | Bacteria | 3781 |
| 597 | Ga0466962_0094054 | 3300061719 | Bacteria | 1437 |
| 598 | Ga0466962_0235006 | 3300061719 | Bacteria | 899 |
| 599 | Ga0530510_0045956 | 3300061734 | Bacteria | 3155 |
| 600 | Ga0530510_0112079 | 3300061734 | Unclassified | 1999 |
| 601 | Ga0495601_0160929 | |||
| 602 | MBSR1b_contig_7856167 | |||
| 603 | Ga0070658_10009314 | |||
| 604 | Ga0070683_100059606 | |||
| 605 | Ga0070683_100090091 | |||
| 606 | Ga0070683_100194305 | |||
| 607 | Ga0070683_100491417 | |||
| 608 | Ga0070683_100660921 | |||
| 609 | Ga0070680_100052144 | |||
| 610 | Ga0070680_100281245 | |||
| 611 | Ga0070680_100319950 | |||
| 612 | Ga0070682_100104654 | |||
| 613 | Ga0070682_100248099 | |||
| 614 | Ga0070660_100000984 | |||
| 615 | Ga0070660_100032748 | |||
| 616 | Ga0070660_100168287 | |||
| 617 | Ga0070661_100046370 | |||
| 618 | Ga0070661_100090227 | |||
| 619 | Ga0070661_100690734 | |||
| 620 | Ga0070675_100403441 | |||
| 621 | Ga0070671_100170559 | |||
| 622 | Ga0070659_100184372 | |||
| 623 | Ga0070659_100263652 | |||
| 624 | Ga0070659_100708414 | |||
| 625 | Ga0070709_10355177 | |||
| 626 | Ga0070714_100041357 | |||
| 627 | Ga0070714_100220352 | |||
| 628 | Ga0070714_100457659 | |||
| 629 | Ga0070713_100049718 | |||
| 630 | Ga0070713_100329560 | |||
| 631 | Ga0070701_10447589 | |||
| 632 | Ga0070705_100177309 | |||
| 633 | Ga0070694_100257924 | |||
| 634 | Ga0070708_100043266 | |||
| 635 | Ga0070663_100418302 | |||
| 636 | Ga0070678_100264808 | |||
| 637 | Ga0070678_100295431 | |||
| 638 | Ga0070681_10008140 | |||
| 639 | Ga0070681_10016502 | |||
| 640 | Ga0070681_10051912 | |||
| 641 | Ga0070681_10063702 | |||
| 642 | Ga0070681_10116438 | |||
| 643 | Ga0070681_10119553 | |||
| 644 | Ga0070685_10445593 | |||
| 645 | Ga0070707_100005156 | |||
| 646 | Ga0070707_100295176 | |||
| 647 | Ga0070707_100541998 | |||
| 648 | Ga0070698_100038579 | |||
| 649 | Ga0070698_100090569 | |||
| 650 | Ga0070698_100237780 | |||
| 651 | Ga0070698_100550710 | |||
| 652 | Ga0070698_100694037 | |||
| 653 | Ga0070698_100755210 | |||
| 654 | Ga0070699_100280596 | |||
| 655 | Ga0070699_100565075 | |||
| 656 | Ga0070679_100027515 | |||
| 657 | Ga0070679_100047714 | |||
| 658 | Ga0070679_100057187 | |||
| 659 | Ga0070679_100063954 | |||
| 660 | Ga0070679_100076254 | |||
| 661 | Ga0070684_100024186 | |||
| 662 | Ga0070684_100032922 | |||
| 663 | Ga0070684_100064947 | |||
| 664 | Ga0070684_100068643 | |||
| 665 | Ga0070684_100147457 | |||
| 666 | Ga0070684_100639987 | |||
| 667 | Ga0070684_100673132 | |||
| 668 | Ga0070697_100047383 | |||
| 669 | Ga0070697_100337449 | |||
| 670 | Ga0068853_100211924 | |||
| 671 | Ga0068853_100653815 | |||
| 672 | Ga0070672_100068999 | |||
| 673 | Ga0070696_100027076 | |||
| 674 | Ga0070696_100073312 | |||
| 675 | Ga0070693_100067652 | |||
| 676 | Ga0070704_100063673 | |||
| 677 | Ga0070704_100140030 | |||
| 678 | Ga0068855_100036745 | |||
| 679 | Ga0068855_100059511 | |||
| 680 | Ga0068855_100129663 | |||
| 681 | Ga0068855_100200504 | |||
| 682 | Ga0068855_100343058 | |||
| 683 | Ga0070664_100279419 | |||
| 684 | Ga0068856_100038352 | |||
| 685 | Ga0068856_100475331 | |||
| 686 | Ga0070702_100419935 | |||
| 687 | Ga0068852_100052416 | |||
| 688 | Ga0068852_100065755 | |||
| 689 | Ga0068852_100145400 | |||
| 690 | Ga0068852_100693760 | |||
| 691 | Ga0068866_10255003 | |||
| 692 | Ga0068861_100309067 | |||
| 693 | Ga0068863_100838024 | |||
| 694 | Ga0081455_10023971 | |||
| 695 | Ga0070717_10011291 | |||
| 696 | Ga0070717_10127386 | |||
| 697 | Ga0075365_10020916 | |||
| 698 | Ga0070716_100098882 | |||
| 699 | Ga0070716_100366214 | |||
| 700 | Ga0070712_100453682 | |||
| 701 | Ga0075367_10079491 | |||
| 702 | Ga0097621_100381533 | |||
| 703 | Ga0075433_10417969 | |||
| 704 | Ga0075434_101234566 | |||
| 705 | Ga0068865_100235600 | |||
| 706 | Ga0075436_100234492 | |||
| 707 | Ga0105240_10007847 | |||
| 708 | Ga0105240_10043546 | |||
| 709 | Ga0105240_10240497 | |||
| 710 | Ga0105240_10990052 | |||
| 711 | Ga0111539_10161787 | |||
| 712 | Ga0105245_10029924 | |||
| 713 | Ga0105245_10168482 | |||
| 714 | Ga0105245_10239551 | |||
| 715 | Ga0105245_10376095 | |||
| 716 | Ga0105245_10806040 | |||
| 717 | Ga0114129_10201231 | |||
| 718 | Ga0114129_10352915 | |||
| 719 | Ga0105243_10097674 | |||
| 720 | Ga0105243_10380858 | |||
| 721 | Ga0105243_10956248 | |||
| 722 | Ga0105243_11121048 | |||
| 723 | Ga0105242_10079385 | |||
| 724 | Ga0105242_10089259 | |||
| 725 | Ga0105242_10475344 | |||
| 726 | Ga0105248_10151720 | |||
| 727 | Ga0105248_10868520 | |||
| 728 | Ga0105248_11093138 | |||
| 729 | Ga0105238_10768305 | |||
| 730 | Ga0105249_10568827 | |||
| 731 | Ga0105239_10019324 | |||
| 732 | Ga0105239_10180960 | |||
| 733 | Ga0105239_10769332 | |||
| 734 | Ga0105246_10102930 | |||
| 735 | Ga0157373_10118968 | |||
| 736 | Ga0157373_10166076 | |||
| 737 | Ga0157373_10633264 | |||
| 738 | Ga0157371_10080264 | |||
| 739 | Ga0157370_10005135 | |||
| 740 | Ga0157370_10015554 | |||
| 741 | Ga0157370_10130824 | |||
| 742 | Ga0157370_10265110 | |||
| 743 | Ga0157370_10287828 | |||
| 744 | Ga0157370_10312525 | |||
| 745 | Ga0157369_10001404 | |||
| 746 | Ga0157369_10003691 | |||
| 747 | Ga0157369_10005700 | |||
| 748 | Ga0157369_10005810 | |||
| 749 | Ga0157369_10014197 | |||
| 750 | Ga0157369_10111986 | |||
| 751 | Ga0157369_10212353 | |||
| 752 | Ga0157369_10646461 | |||
| 753 | Ga0157369_10724877 | |||
| 754 | Ga0157369_10926139 | |||
| 755 | Ga0157374_10278141 | |||
| 756 | Ga0157374_10631684 | |||
| 757 | Ga0157378_10922374 | |||
| 758 | Ga0157372_10121999 | |||
| 759 | Ga0157372_10971048 | |||
| 760 | Ga0157372_11001019 | |||
| 761 | Ga0157375_10043912 | |||
| 762 | Ga0157375_10072618 | |||
| 763 | Ga0157375_10132191 | |||
| 764 | Ga0182008_10005917 | |||
| 765 | Ga0157377_10020511 | |||
| 766 | Ga0157377_10075483 | |||
| 767 | Ga0157377_10259544 | |||
| 768 | Ga0157376_10260787 | |||
| 769 | Ga0182006_1034074 | |||
| 770 | Ga0206356_10226513 | |||
| 771 | Ga0206356_10559060 | |||
| 772 | Ga0206356_11243275 | |||
| 773 | Ga0206354_11488358 | |||
| 774 | Ga0206353_10361018 | |||
| 775 | Ga0206353_10671812 | |||
| 776 | Ga0206353_10948189 | |||
| 777 | Ga0213871_10032651 | |||
| 778 | Ga0207699_10042520 | |||
| 779 | Ga0207699_10446795 | |||
| 780 | Ga0207699_10587615 | |||
| 781 | Ga0207705_10424885 | |||
| 782 | Ga0207705_10739562 | |||
| 783 | Ga0207684_10356019 | |||
| 784 | Ga0207707_10022570 | |||
| 785 | Ga0207707_10032427 | |||
| 786 | Ga0207707_10039358 | |||
| 787 | Ga0207707_10039982 | |||
| 788 | Ga0207707_10148733 | |||
| 789 | Ga0207707_10155468 | |||
| 790 | Ga0207695_10019644 | |||
| 791 | Ga0207695_10213400 | |||
| 792 | Ga0207695_10656142 | |||
| 793 | Ga0207695_10716887 | |||
| 794 | Ga0207671_10214370 | |||
| 795 | Ga0207693_10011954 | |||
| 796 | Ga0207693_10126798 | |||
| 797 | Ga0207660_10113992 | |||
| 798 | Ga0207662_10111543 | |||
| 799 | Ga0207657_10002091 | |||
| 800 | Ga0207657_10007705 | |||
| 801 | Ga0207657_10008201 | |||
| 802 | Ga0207657_10035720 | |||
| 803 | Ga0207657_10044262 | |||
| 804 | Ga0207657_10116791 | |||
| 805 | Ga0207657_10213364 | |||
| 806 | Ga0207649_10143169 | |||
| 807 | Ga0207652_10080533 | |||
| 808 | Ga0207652_10153472 | |||
| 809 | Ga0207652_10161457 | |||
| 810 | Ga0207652_10229968 | |||
| 811 | Ga0207652_10275520 | |||
| 812 | Ga0207652_10352742 | |||
| 813 | Ga0207652_10378555 | |||
| 814 | Ga0207652_10926273 | |||
| 815 | Ga0207646_10007769 | |||
| 816 | Ga0207646_10167035 | |||
| 817 | Ga0207646_10190697 | |||
| 818 | Ga0207659_10221957 | |||
| 819 | Ga0207687_10040993 | |||
| 820 | Ga0207700_10000039 | |||
| 821 | Ga0207700_10566091 | |||
| 822 | Ga0207664_10005888 | |||
| 823 | Ga0207664_10021048 | |||
| 824 | Ga0207664_10052028 | |||
| 825 | Ga0207664_10228781 | |||
| 826 | Ga0207664_10515125 | |||
| 827 | Ga0207690_10037079 | |||
| 828 | Ga0207690_10071023 | |||
| 829 | Ga0207706_10064391 | |||
| 830 | Ga0207706_10544640 | |||
| 831 | Ga0207686_10102440 | |||
| 832 | Ga0207686_10299625 | |||
| 833 | Ga0207704_10302645 | |||
| 834 | Ga0207665_10075176 | |||
| 835 | Ga0207665_10113381 | |||
| 836 | Ga0207665_10121104 | |||
| 837 | Ga0207691_10085234 | |||
| 838 | Ga0207711_10094264 | |||
| 839 | Ga0207711_10856521 | |||
| 840 | Ga0207661_10000846 | |||
| 841 | Ga0207661_10004419 | |||
| 842 | Ga0207661_10214645 | |||
| 843 | Ga0207661_10260674 | |||
| 844 | Ga0207661_10558425 | |||
| 845 | Ga0207679_10121456 | |||
| 846 | Ga0207679_10565137 | |||
| 847 | Ga0207667_10151851 | |||
| 848 | Ga0207667_10184238 | |||
| 849 | Ga0207667_10687766 | |||
| 850 | Ga0207651_10155099 | |||
| 851 | Ga0207639_10521594 | |||
| 852 | Ga0207702_10157783 | |||
| 853 | Ga0207702_10162865 | |||
| 854 | Ga0207702_10569359 | |||
| 855 | Ga0207702_10685246 | |||
| 856 | Ga0207641_10371131 | |||
| 857 | Ga0207641_11106466 | |||
| 858 | Ga0207648_10087644 | |||
| 859 | Ga0207675_100764146 | |||
| 860 | Ga0207683_10029199 | |||
| 861 | Ga0207698_10045528 | |||
| 862 | Ga0207698_10055419 | |||
| 863 | Ga0207698_10568544 | |||
| 864 | Ga0207698_11097875 | |||
| 865 | Ga0268266_10832138 | |||
| 866 | Ga0265319_1002454 | |||
| 867 | Ga0265318_10027242 | |||
| 868 | Ga0265323_10093777 | |||
| 869 | Ga0265322_10015265 | |||
| 870 | Ga0265338_10028780 | |||
| 871 | Ga0265330_10184373 | |||
| 872 | Ga0265320_10013704 | |||
| 873 | Ga0265339_10236691 | |||
| 874 | Ga0265331_10208650 | |||
| 875 | Ga0265316_10083542 | |||
| 876 | Ga0265314_10021108 | |||
| 877 | Ga0307405_10146790 | |||
| 878 | Ga0307413_10042128 | |||
| 879 | Ga0307410_10051758 | |||
| 880 | Ga0307407_10152931 | |||
| 881 | Ga0307412_10478266 | |||
| 882 | Ga0307416_100497619 | |||
| 883 | Ga0307414_10056386 | |||
| 884 | Ga0307411_10071221 | |||
| 885 | Ga0373943_0011392 | |||
| 886 | Ga0395899_0022900 | |||
| 887 | Ga0395899_0047390 | |||
| 888 | Ga0395899_0059359 | |||
| 889 | Ga0395899_0174910 | |||
| 890 | Ga0395899_0355325 | |||
| 891 | Ga0395899_0548317 | |||
| 892 | Ga0395899_0553788 | |||
| 893 | Ga0395900_0000528 | |||
| 894 | Ga0395900_0003881 | |||
| 895 | Ga0395900_0014793 | |||
| 896 | Ga0395900_0035757 | |||
| 897 | Ga0395900_0054878 | |||
| 898 | Ga0395900_0096139 | |||
| 899 | Ga0395900_0116010 | |||
| 900 | Ga0395900_0119863 | |||
| 901 | Ga0395900_0134013 | |||
| 902 | Ga0395900_0152633 | |||
| 903 | Ga0395900_0173232 | |||
| 904 | Ga0395900_0196510 | |||
| 905 | Ga0395900_0279065 | |||
| 906 | Ga0395900_0293444 | |||
| 907 | Ga0395900_0548111 | |||
| 908 | Ga0395900_0742237 | |||
| 909 | Ga0395898_0007329 | |||
| 910 | Ga0395898_0008888 | |||
| 911 | Ga0395898_0009120 | |||
| 912 | Ga0395898_0012243 | |||
| 913 | Ga0395898_0014330 | |||
| 914 | Ga0395898_0040289 | |||
| 915 | Ga0395898_0050568 | |||
| 916 | Ga0395898_0052061 | |||
| 917 | Ga0395898_0080162 | |||
| 918 | Ga0395898_0174455 | |||
| 919 | Ga0395898_0178585 | |||
| 920 | Ga0395898_0238063 | |||
| 921 | Ga0395898_0746787 | |||
| 922 | Ga0395905_0000661 | |||
| 923 | Ga0395905_0003053 | |||
| 924 | Ga0395905_0017506 | |||
| 925 | Ga0395905_0030433 | |||
| 926 | Ga0395905_0056384 | |||
| 927 | Ga0395905_0866389 | |||
| 928 | Ga0395905_1133138 | |||
| 929 | Ga0436364_0197195 | |||
| 930 | Ga0395901_0001883 | |||
| 931 | Ga0395901_0001886 | |||
| 932 | Ga0395901_0004160 | |||
| 933 | Ga0395901_0005294 | |||
| 934 | Ga0395901_0009762 | |||
| 935 | Ga0395901_0012865 | |||
| 936 | Ga0395901_0022948 | |||
| 937 | Ga0395901_0037025 | |||
| 938 | Ga0395901_0185068 | |||
| 939 | Ga0395901_0191437 | |||
| 940 | Ga0395901_0233145 | |||
| 941 | Ga0395901_0286783 | |||
| 942 | Ga0395901_0289506 | |||
| 943 | Ga0395901_0358651 | |||
| 944 | Ga0395901_0401041 | |||
| 945 | Ga0395901_0619309 | |||
| 946 | Ga0395901_0811510 | |||
| 947 | Ga0395901_0994096 | |||
| 948 | Ga0395901_1091775 | |||
| 949 | Ga0436365_1828440 | |||
| 950 | Ga0436360_1152069 | |||
| 951 | Ga0451804_0368465 | |||
| 952 | Ga0451835_0581384 | |||
| 953 | Ga0439448_0045616 | |||
| 954 | Ga0439451_017413 | |||
| 955 | Ga0466969_0020610 | |||
| 956 | Ga0466972_0055149 | |||
| 957 | Ga0466972_0516435 | |||
| 958 | Ga0466965_0043874 | |||
| 959 | Ga0466965_0083177 | |||
| 960 | Ga0466965_0243247 | |||
| 961 | Ga0466965_0403011 | |||
| 962 | Ga0466966_0014288 | |||
| 963 | Ga0466966_0129382 | |||
| 964 | Ga0466961_0003261 | |||
| 965 | Ga0466961_0070676 | |||
| 966 | Ga0466961_0132158 | |||
| 967 | Ga0466963_0002288 | |||
| 968 | Ga0466963_0011538 | |||
| 969 | Ga0466963_0025079 | |||
| 970 | Ga0466963_0025670 | |||
| 971 | Ga0466963_0048221 | |||
| 972 | Ga0466963_0105608 | |||
| 973 | Ga0466963_0227613 | |||
| 974 | Ga0466963_0298206 | |||
| 975 | Ga0466963_0312352 | |||
| 976 | Ga0466964_0003042 | |||
| 977 | Ga0466964_0009153 | |||
| 978 | Ga0466964_0044241 | |||
| 979 | Ga0466964_0231186 | |||
| 980 | Ga0466971_0004887 | |||
| 981 | Ga0466971_0045326 | |||
| 982 | Ga0466971_0056421 | |||
| 983 | Ga0466971_0083978 | |||
| 984 | Ga0466971_0104090 | |||
| 985 | Ga0466971_0242374 | |||
| 986 | Ga0466968_0056140 | |||
| 987 | Ga0466970_0123033 | |||
| 988 | Ga0466970_0464886 | |||
| 989 | Ga0466957_0000806 | |||
| 990 | Ga0466957_0014641 | |||
| 991 | Ga0466957_0120410 | |||
| 992 | Ga0466957_0250531 | |||
| 993 | Ga0466957_0682102 | |||
| 994 | Ga0466960_0147214 | |||
| 995 | Ga0466960_0311427 | |||
| 996 | Ga0466959_0009826 | |||
| 997 | Ga0466959_0023901 | |||
| 998 | Ga0466959_0182609 | |||
| 999 | Ga0466959_0216804 | |||
| 1000 | Ga0466958_0009266 | |||
| 1001 | Ga0466958_0033843 | |||
| 1002 | Ga0466958_0044488 | |||
| 1003 | Ga0466958_0165414 | |||
| 1004 | Ga0466958_0356624 | |||
| 1005 | Ga0466967_0002124 | |||
| 1006 | Ga0466967_0002856 | |||
| 1007 | Ga0466967_0003602 | |||
| 1008 | Ga0466967_0005947 | |||
| 1009 | Ga0466967_0007612 | |||
| 1010 | Ga0466967_0023094 | |||
| 1011 | Ga0466967_0026759 | |||
| 1012 | Ga0466967_0037188 | |||
| 1013 | Ga0466967_0042602 | |||
| 1014 | Ga0466967_0056485 | |||
| 1015 | Ga0466967_0063248 | |||
| 1016 | Ga0466967_0088341 | |||
| 1017 | Ga0466967_0137081 | |||
| 1018 | Ga0466967_0252031 | |||
| 1019 | Ga0466967_0290229 | |||
| 1020 | Ga0466967_0429549 | |||
| 1021 | Ga0466967_0599289 | |||
| 1022 | Ga0466967_0704738 | |||
| 1023 | Ga0466967_0740476 | |||
| 1024 | Ga0495629_0007333 | |||
| 1025 | Ga0495629_0142081 | |||
| 1026 | Ga0495641_0232553 | |||
| 1027 | Ga0495651_0026302 | |||
| 1028 | Ga0495653_0012836 | |||
| 1029 | Ga0495653_0150263 | |||
| 1030 | Ga0495582_0276047 | |||
| 1031 | Ga0495662_0040686 | |||
| 1032 | Ga0495662_0106341 | |||
| 1033 | Ga0495664_0131427 | |||
| 1034 | Ga0495594_0105498 | |||
| 1035 | Ga0495594_0234726 | |||
| 1036 | Ga0495608_0097169 | |||
| 1037 | Ga0495628_0263867 | |||
| 1038 | Ga0495630_0002134 | |||
| 1039 | Ga0495630_0074432 | |||
| 1040 | Ga0495630_0168706 | |||
| 1041 | Ga0495652_0203533 | |||
| 1042 | Ga0495640_0014274 | |||
| 1043 | Ga0495640_0441920 | |||
| 1044 | Ga0495586_0059045 | |||
| 1045 | Ga0495587_0191728 | |||
| 1046 | Ga0495667_0012309 | |||
| 1047 | Ga0495667_0135730 | |||
| 1048 | Ga0495634_0032263 | |||
| 1049 | Ga0495611_0127139 | |||
| 1050 | Ga0495635_0049727 | |||
| 1051 | Ga0495659_0005067 | |||
| 1052 | Ga0495657_0065250 | |||
| 1053 | Ga0495658_0062829 | |||
| 1054 | Ga0495658_0168187 | |||
| 1055 | Ga0495658_0200260 | |||
| 1056 | Ga0495613_0084508 | |||
| 1057 | Ga0495589_0044768 | |||
| 1058 | Ga0495636_0019126 | |||
| 1059 | Ga0495636_0533293 | |||
| 1060 | Ga0495674_0009083 | |||
| 1061 | Ga0495676_0046845 | |||
| 1062 | Ga0495676_0069055 | |||
| 1063 | Ga0495684_0075522 | |||
| 1064 | Ga0496100_0009489 | |||
| 1065 | Ga0496100_0011643 | |||
| 1066 | Ga0496100_0043159 | |||
| 1067 | Ga0496100_0156471 | |||
| 1068 | Ga0496100_0330194 | |||
| 1069 | Ga0496101_0008135 | |||
| 1070 | Ga0496101_0009285 | |||
| 1071 | Ga0496101_0193482 | |||
| 1072 | Ga0496102_0045475 | |||
| 1073 | Ga0496102_0183382 | |||
| 1074 | Ga0496102_0195160 | |||
| 1075 | Ga0496102_0242164 | |||
| 1076 | Ga0496103_0025489 | |||
| 1077 | Ga0496103_0052117 | |||
| 1078 | Ga0496103_0100465 | |||
| 1079 | Ga0496103_0221789 | |||
| 1080 | Ga0496104_0027105 | |||
| 1081 | Ga0496104_0055055 | |||
| 1082 | Ga0496104_0129752 | |||
| 1083 | Ga0496105_0010552 | |||
| 1084 | Ga0496105_0015044 | |||
| 1085 | Ga0496105_0228693 | |||
| 1086 | Ga0496106_0004542 | |||
| 1087 | Ga0496106_0020981 | |||
| 1088 | Ga0496106_0216987 | |||
| 1089 | Ga0496106_0881514 | |||
| 1090 | Ga0496107_0000242 | |||
| 1091 | Ga0496107_0016119 | |||
| 1092 | Ga0496107_0016145 | |||
| 1093 | Ga0496107_0151089 | |||
| 1094 | Ga0496107_0176594 | |||
| 1095 | Ga0496107_0266524 | |||
| 1096 | Ga0496107_0313891 | |||
| 1097 | Ga0496108_0003459 | |||
| 1098 | Ga0496108_0028596 | |||
| 1099 | Ga0496108_0029785 | |||
| 1100 | Ga0496108_0591520 | |||
| 1101 | Ga0496109_0000288 | |||
| 1102 | Ga0496109_0000534 | |||
| 1103 | Ga0496109_0028031 | |||
| 1104 | Ga0496109_0117906 | |||
| 1105 | Ga0496109_0285557 | |||
| 1106 | Ga0496109_0397262 | |||
| 1107 | Ga0496109_0415488 | |||
| 1108 | Ga0496109_0881697 | |||
| 1109 | Ga0496110_0009021 | |||
| 1110 | Ga0496110_0019828 | |||
| 1111 | Ga0496110_0067059 | |||
| 1112 | Ga0496110_0170675 | |||
| 1113 | Ga0496110_0192425 | |||
| 1114 | Ga0496110_0203285 | |||
| 1115 | Ga0496110_0218050 | |||
| 1116 | Ga0496110_0943498 | |||
| 1117 | Ga0496111_0000204 | |||
| 1118 | Ga0496111_0003515 | |||
| 1119 | Ga0496111_0005855 | |||
| 1120 | Ga0496111_0007836 | |||
| 1121 | Ga0496111_0102125 | |||
| 1122 | Ga0496111_0176755 | |||
| 1123 | Ga0496111_0236356 | |||
| 1124 | Ga0496112_0001332 | |||
| 1125 | Ga0496112_0001848 | |||
| 1126 | Ga0496112_0003412 | |||
| 1127 | Ga0496112_0011398 | |||
| 1128 | Ga0496112_0014336 | |||
| 1129 | Ga0496112_0034446 | |||
| 1130 | Ga0496112_0035626 | |||
| 1131 | Ga0496112_0099695 | |||
| 1132 | Ga0496112_0226623 | |||
| 1133 | Ga0496112_0422459 | |||
| 1134 | Ga0496112_0525577 | |||
| 1135 | Ga0496113_0022276 | |||
| 1136 | Ga0496113_0164141 | |||
| 1137 | Ga0496113_0200664 | |||
| 1138 | Ga0496113_0433413 | |||
| 1139 | Ga0496113_0933080 | |||
| 1140 | Ga0496114_0007879 | |||
| 1141 | Ga0496114_0060712 | |||
| 1142 | Ga0496114_0131751 | |||
| 1143 | Ga0496114_0139222 | |||
| 1144 | Ga0496114_0157478 | |||
| 1145 | Ga0496114_0539140 | |||
| 1146 | Ga0496115_0033167 | |||
| 1147 | Ga0501032_0667736 | |||
| 1148 | Ga0501034_0028452 | |||
| 1149 | Ga0501040_0301690 | |||
| 1150 | Ga0501047_0046363 | |||
| 1151 | Ga0501047_0081551 | |||
| 1152 | Ga0501067_0045639 | |||
| 1153 | Ga0501067_0114172 | |||
| 1154 | Ga0501067_0115656 | |||
| 1155 | Ga0501067_0139056 | |||
| 1156 | Ga0501067_0269863 | |||
| 1157 | Ga0501068_0153328 | |||
| 1158 | Ga0501068_0263190 | |||
| 1159 | Ga0501069_0064932 | |||
| 1160 | Ga0501070_0006916 | |||
| 1161 | Ga0501070_0020474 | |||
| 1162 | Ga0501071_0238044 | |||
| 1163 | Ga0501071_0999116 | |||
| 1164 | Ga0501072_0001809 | |||
| 1165 | Ga0501072_0008341 | |||
| 1166 | Ga0501072_0099859 | |||
| 1167 | Ga0501072_0597273 | |||
| 1168 | Ga0501073_0063480 | |||
| 1169 | Ga0501076_0070594 | |||
| 1170 | Ga0501076_0248199 | |||
| 1171 | Ga0501077_0246599 | |||
| 1172 | Ga0501079_0097704 | |||
| 1173 | Ga0501080_0006721 | |||
| 1174 | Ga0501080_0071783 | |||
| 1175 | Ga0501081_0048069 | |||
| 1176 | Ga0501083_0015094 | |||
| 1177 | Ga0501035_0770431 | |||
| 1178 | Ga0501044_0803022 | |||
| 1179 | nmdc:mga05p37_531223_c1 | |||
| 1180 | nmdc:mga06r32_1115371_c1 | |||
| 1181 | nmdc:mga08y16_331128_c1 | |||
| 1182 | nmdc:mga08y16_602494_c1 | |||
| 1183 | nmdc:mga0n895_665104_c1 | |||
| 1184 | nmdc:mga0rr50_376534_c1 | |||
| 1185 | nmdc:mga08x19_284260_c1 | |||
| 1186 | nmdc:mga0a205_98464_c1 | |||
| 1187 | Ga0495612_0058167 | |||
| 1188 | Ga0501084_0092960 | |||
| 1189 | Ga0501084_0111046 | |||
| 1190 | Ga0501084_0111677 | |||
| 1191 | Ga0501084_0202217 | |||
| 1192 | Ga0501084_0585627 | |||
| 1193 | Ga0501082_0059586 | |||
| 1194 | Ga0501082_0130892 | |||
| 1195 | Ga0466962_0002596 | |||
| 1196 | Ga0466962_0014635 | |||
| 1197 | Ga0466962_0094054 | |||
| 1198 | Ga0466962_0235006 | |||
| 1199 | Ga0530510_0045956 | |||
| 1200 | Ga0530510_0112079 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o90-assembly1.cif.gz_C | high resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes | 0.8788 | 5 | 205 |
| 3eef-assembly1.cif.gz_A | crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum | 0.8729 | 5 | 205 |
| 3o92-assembly1.cif.gz_C | high resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes | 0.8617 | 6 | 205 |
| 3o94-assembly1.cif.gz_A | high resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes | 0.8614 | 6 | 205 |
| 1im5-assembly1.cif.gz_A | crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc | 0.8572 | 4 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3eefB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8699 | 5 | 205 | 3.40.50.850 |
| af_Q55BH4_1_183_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8633 | 5 | 212 | 3.40.50.850 |
| 1im5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8572 | 4 | 204 | 3.40.50.850 |
| af_Q55BH4_1_183_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8545 | 5 | 212 | 3.40.50.850 |
| af_I1KV55_2_198_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8533 | 4 | 212 | 3.40.50.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7PUE5-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.989 | 1 | 211 |
GO:0016810
|
| AF-A0A2V8TR47-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.986 | 5 | 210 |
GO:0016787
GO:0019363 GO:0046872 |
| AF-A0A2V9RAY9-F1-model_v4 | Isochorismatase-like domain-containing protein | 0.9856 | 3 | 211 |
|
| AF-A0A538IJQ2-F1-model_v4 | Cysteine hydrolase | 0.9853 | 5 | 207 |
GO:0016810
|
| AF-A0A2M6YX02-F1-model_v4 | nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) | 0.985 | 3 | 215 |
GO:0016810
|