F468026

General Info

Members Datasets Scaffolds Average Seq Length
600 237 1200 206

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0160929|Ga0495601_0160929_569_1291
Length 240
Sequence LCRVCDGTVPIVRQIDAALTVAAARAACYNAGVSGRILWDVDTQVDFVLPEGKLYVRGAEETAPAMGRLVAAAREAGLVHVASADDHELTDPEISDEPDFRNTYPPHCLRGTRGAARIPETEQADPLPLPLVPFPPGLVPELISHRRELLLLKKSFDVFTNPNAEAVLDALDPDEVILFGVATDVCVDAAILGLLRRGRRVTFVEDAARGLDDEHVATCTAAWREGGVAFTTTDDVVNSL

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
145 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 14
Rhizosphere 85.17
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0160929 3300053077 Bacteria 1467
2 MBSR1b_contig_7856167 2162886012 Bacteria 1014
3 Ga0070658_10009314 3300005327 Bacteria 7896
4 Ga0070683_100059606 3300005329 Bacteria 3546
5 Ga0070683_100090091 3300005329 Bacteria 2879
6 Ga0070683_100194305 3300005329 Bacteria 1927
7 Ga0070683_100491417 3300005329 Bacteria 1172
8 Ga0070683_100660921 3300005329 Unclassified 1001
9 Ga0070680_100052144 3300005336 Bacteria 3339
10 Ga0070680_100281245 3300005336 Bacteria 1410
11 Ga0070680_100319950 3300005336 Bacteria 1317
12 Ga0070682_100104654 3300005337 Bacteria 1875
13 Ga0070682_100248099 3300005337 Bacteria 1282
14 Ga0070660_100000984 3300005339 Bacteria 19070
15 Ga0070660_100032748 3300005339 Bacteria 3914
16 Ga0070660_100168287 3300005339 Bacteria 1769
17 Ga0070661_100046370 3300005344 Bacteria 3179
18 Ga0070661_100090227 3300005344 Bacteria 2270
19 Ga0070661_100690734 3300005344 Unclassified 831
20 Ga0070675_100403441 3300005354 Bacteria 1220
21 Ga0070671_100170559 3300005355 Bacteria 1840
22 Ga0070659_100184372 3300005366 Bacteria 1713
23 Ga0070659_100263652 3300005366 Bacteria 1430
24 Ga0070659_100708414 3300005366 Unclassified 871
25 Ga0070709_10355177 3300005434 Unclassified 1084
26 Ga0070714_100041357 3300005435 Bacteria 3889
27 Ga0070714_100220352 3300005435 Bacteria 1743
28 Ga0070714_100457659 3300005435 Bacteria 1213
29 Ga0070713_100049718 3300005436 Bacteria 3460
30 Ga0070713_100329560 3300005436 Unclassified 1412
31 Ga0070701_10447589 3300005438 Bacteria 828
32 Ga0070705_100177309 3300005440 Bacteria 1440
33 Ga0070694_100257924 3300005444 Bacteria 1321
34 Ga0070708_100043266 3300005445 Bacteria 3956
35 Ga0070663_100418302 3300005455 Unclassified 1099
36 Ga0070678_100264808 3300005456 Bacteria 1447
37 Ga0070678_100295431 3300005456 Bacteria 1375
38 Ga0070681_10008140 3300005458 Bacteria 10263
39 Ga0070681_10016502 3300005458 Bacteria 7375
40 Ga0070681_10051912 3300005458 Bacteria 4090
41 Ga0070681_10063702 3300005458 Bacteria 3659
42 Ga0070681_10116438 3300005458 Bacteria 2609
43 Ga0070681_10119553 3300005458 Bacteria 2571
44 Ga0070685_10445593 3300005466 Unclassified 906
45 Ga0070707_100005156 3300005468 Bacteria 12238
46 Ga0070707_100295176 3300005468 Bacteria 1575
47 Ga0070707_100541998 3300005468 Bacteria 1126
48 Ga0070698_100038579 3300005471 Bacteria 4921
49 Ga0070698_100090569 3300005471 Bacteria 3041
50 Ga0070698_100237780 3300005471 Archaea 1754
51 Ga0070698_100550710 3300005471 Bacteria 1093
52 Ga0070698_100694037 3300005471 Unclassified 960
53 Ga0070698_100755210 3300005471 Bacteria 916
54 Ga0070699_100280596 3300005518 Bacteria 1492
55 Ga0070699_100565075 3300005518 Unclassified 1036
56 Ga0070679_100027515 3300005530 Bacteria 5597
57 Ga0070679_100047714 3300005530 Archaea 4267
58 Ga0070679_100057187 3300005530 Bacteria 3887
59 Ga0070679_100063954 3300005530 Bacteria 3666
60 Ga0070679_100076254 3300005530 Bacteria 3343
61 Ga0070684_100024186 3300005535 Bacteria 5093
62 Ga0070684_100032922 3300005535 Bacteria 4422
63 Ga0070684_100064947 3300005535 Bacteria 3202
64 Ga0070684_100068643 3300005535 Bacteria 3116
65 Ga0070684_100147457 3300005535 Bacteria 2130
66 Ga0070684_100639987 3300005535 Unclassified 990
67 Ga0070684_100673132 3300005535 Bacteria 964
68 Ga0070697_100047383 3300005536 Bacteria 3484
69 Ga0070697_100337449 3300005536 Bacteria 1300
70 Ga0068853_100211924 3300005539 Unclassified 1766
71 Ga0068853_100653815 3300005539 Bacteria 1001
72 Ga0070672_100068999 3300005543 Bacteria 2805
73 Ga0070696_100027076 3300005546 Bacteria 3904
74 Ga0070696_100073312 3300005546 Bacteria 2412
75 Ga0070693_100067652 3300005547 Bacteria 2094
76 Ga0070704_100063673 3300005549 Bacteria 2647
77 Ga0070704_100140030 3300005549 Bacteria 1888
78 Ga0068855_100036745 3300005563 Bacteria 5827
79 Ga0068855_100059511 3300005563 Bacteria 4469
80 Ga0068855_100129663 3300005563 Bacteria 2881
81 Ga0068855_100200504 3300005563 Bacteria 2246
82 Ga0068855_100343058 3300005563 Bacteria 1646
83 Ga0070664_100279419 3300005564 Bacteria 1505
84 Ga0068856_100038352 3300005614 Bacteria 4703
85 Ga0068856_100475331 3300005614 Bacteria 1271
86 Ga0070702_100419935 3300005615 Bacteria 962
87 Ga0068852_100052416 3300005616 Bacteria 3506
88 Ga0068852_100065755 3300005616 Bacteria 3165
89 Ga0068852_100145400 3300005616 Bacteria 2199
90 Ga0068852_100693760 3300005616 Bacteria 1028
91 Ga0068866_10255003 3300005718 Bacteria 1075
92 Ga0068861_100309067 3300005719 Unclassified 1372
93 Ga0068863_100838024 3300005841 Bacteria 918
94 Ga0081455_10023971 3300005937 Bacteria 5662
95 Ga0070717_10011291 3300006028 Bacteria 6778
96 Ga0070717_10127386 3300006028 Bacteria 2187
97 Ga0075365_10020916 3300006038 Bacteria 4070
98 Ga0070716_100098882 3300006173 Bacteria 1784
99 Ga0070716_100366214 3300006173 Unclassified 1025
100 Ga0070712_100453682 3300006175 Bacteria 1068
101 Ga0075367_10079491 3300006178 Bacteria 1982
102 Ga0097621_100381533 3300006237 Bacteria 1259
103 Ga0075433_10417969 3300006852 Bacteria 1182
104 Ga0075434_101234566 3300006871 Unclassified 759
105 Ga0068865_100235600 3300006881 Bacteria 1438
106 Ga0075436_100234492 3300006914 Bacteria 1304
107 Ga0105240_10007847 3300009093 Bacteria 15404
108 Ga0105240_10043546 3300009093 Bacteria 5711
109 Ga0105240_10240497 3300009093 Bacteria 2099
110 Ga0105240_10990052 3300009093 Bacteria 900
111 Ga0111539_10161787 3300009094 Unclassified 2618
112 Ga0105245_10029924 3300009098 Bacteria 4815
113 Ga0105245_10168482 3300009098 Bacteria 2084
114 Ga0105245_10239551 3300009098 Bacteria 1758
115 Ga0105245_10376095 3300009098 Bacteria 1413
116 Ga0105245_10806040 3300009098 Bacteria 977
117 Ga0114129_10201231 3300009147 Bacteria 2697
118 Ga0114129_10352915 3300009147 Bacteria 1948
119 Ga0105243_10097674 3300009148 Bacteria 2431
120 Ga0105243_10380858 3300009148 Bacteria 1305
121 Ga0105243_10956248 3300009148 Bacteria 856
122 Ga0105243_11121048 3300009148 Unclassified 796
123 Ga0105242_10079385 3300009176 Unclassified 2740
124 Ga0105242_10089259 3300009176 Bacteria 2591
125 Ga0105242_10475344 3300009176 Bacteria 1183
126 Ga0105248_10151720 3300009177 Bacteria 2614
127 Ga0105248_10868520 3300009177 Bacteria 1018
128 Ga0105248_11093138 3300009177 Bacteria 901
129 Ga0105238_10768305 3300009551 Unclassified 978
130 Ga0105249_10568827 3300009553 Bacteria 1186
131 Ga0105239_10019324 3300010375 Bacteria 7524
132 Ga0105239_10180960 3300010375 Bacteria 2359
133 Ga0105239_10769332 3300010375 Bacteria 1102
134 Ga0105246_10102930 3300011119 Bacteria 2083
135 Ga0157373_10118968 3300013100 Bacteria 1857
136 Ga0157373_10166076 3300013100 Bacteria 1553
137 Ga0157373_10633264 3300013100 Bacteria 780
138 Ga0157371_10080264 3300013102 Bacteria 2310
139 Ga0157370_10005135 3300013104 Bacteria 14764
140 Ga0157370_10015554 3300013104 Bacteria 7735
141 Ga0157370_10130824 3300013104 Bacteria 2341
142 Ga0157370_10265110 3300013104 Bacteria 1587
143 Ga0157370_10287828 3300013104 Bacteria 1518
144 Ga0157370_10312525 3300013104 Bacteria 1450
145 Ga0157369_10001404 3300013105 Bacteria 29589
146 Ga0157369_10003691 3300013105 Bacteria 18191
147 Ga0157369_10005700 3300013105 Bacteria 14465
148 Ga0157369_10005810 3300013105 Bacteria 14346
149 Ga0157369_10014197 3300013105 Bacteria 8998
150 Ga0157369_10111986 3300013105 Bacteria 2900
151 Ga0157369_10212353 3300013105 Bacteria 2028
152 Ga0157369_10646461 3300013105 Bacteria 1091
153 Ga0157369_10724877 3300013105 Bacteria 1023
154 Ga0157369_10926139 3300013105 Unclassified 893
155 Ga0157374_10278141 3300013296 Bacteria 1652
156 Ga0157374_10631684 3300013296 Bacteria 1082
157 Ga0157378_10922374 3300013297 Bacteria 905
158 Ga0157372_10121999 3300013307 Bacteria 2994
159 Ga0157372_10971048 3300013307 Bacteria 984
160 Ga0157372_11001019 3300013307 Bacteria 968
161 Ga0157375_10043912 3300013308 Bacteria 4337
162 Ga0157375_10072618 3300013308 Unclassified 3458
163 Ga0157375_10132191 3300013308 Bacteria 2616
164 Ga0182008_10005917 3300014497 Bacteria 6903
165 Ga0157377_10020511 3300014745 Bacteria 3464
166 Ga0157377_10075483 3300014745 Bacteria 1958
167 Ga0157377_10259544 3300014745 Bacteria 1130
168 Ga0157376_10260787 3300014969 Bacteria 1624
169 Ga0182006_1034074 3300015261 Bacteria 2039
170 Ga0206356_10226513 3300020070 Bacteria 3070
171 Ga0206356_10559060 3300020070 Unclassified 934
172 Ga0206356_11243275 3300020070 Bacteria 807
173 Ga0206354_11488358 3300020081 Bacteria 3631
174 Ga0206353_10361018 3300020082 Bacteria 3733
175 Ga0206353_10671812 3300020082 Bacteria 3587
176 Ga0206353_10948189 3300020082 Bacteria 2037
177 Ga0213871_10032651 3300021441 Bacteria 1365
178 Ga0207699_10042520 3300025906 Bacteria 2633
179 Ga0207699_10446795 3300025906 Unclassified 927
180 Ga0207699_10587615 3300025906 Bacteria 810
181 Ga0207705_10424885 3300025909 Unclassified 1029
182 Ga0207705_10739562 3300025909 Unclassified 764
183 Ga0207684_10356019 3300025910 Unclassified 1260
184 Ga0207707_10022570 3300025912 Bacteria 5501
185 Ga0207707_10032427 3300025912 Bacteria 4572
186 Ga0207707_10039358 3300025912 Bacteria 4133
187 Ga0207707_10039982 3300025912 Bacteria 4098
188 Ga0207707_10148733 3300025912 Bacteria 2048
189 Ga0207707_10155468 3300025912 Bacteria 2000
190 Ga0207695_10019644 3300025913 Bacteria 7772
191 Ga0207695_10213400 3300025913 Bacteria 1840
192 Ga0207695_10656142 3300025913 Bacteria 930
193 Ga0207695_10716887 3300025913 Bacteria 881
194 Ga0207671_10214370 3300025914 Bacteria 1507
195 Ga0207693_10011954 3300025915 Bacteria 7018
196 Ga0207693_10126798 3300025915 Bacteria 2006
197 Ga0207660_10113992 3300025917 Unclassified 2038
198 Ga0207662_10111543 3300025918 Bacteria 1706
199 Ga0207657_10002091 3300025919 Bacteria 21596
200 Ga0207657_10007705 3300025919 Bacteria 11002
201 Ga0207657_10008201 3300025919 Bacteria 10643
202 Ga0207657_10035720 3300025919 Bacteria 4454
203 Ga0207657_10044262 3300025919 Bacteria 3914
204 Ga0207657_10116791 3300025919 Bacteria 2198
205 Ga0207657_10213364 3300025919 Bacteria 1548
206 Ga0207649_10143169 3300025920 Bacteria 1638
207 Ga0207652_10080533 3300025921 Bacteria 2847
208 Ga0207652_10153472 3300025921 Bacteria 2062
209 Ga0207652_10161457 3300025921 Bacteria 2009
210 Ga0207652_10229968 3300025921 Bacteria 1671
211 Ga0207652_10275520 3300025921 Bacteria 1518
212 Ga0207652_10352742 3300025921 Bacteria 1328
213 Ga0207652_10378555 3300025921 Bacteria 1278
214 Ga0207652_10926273 3300025921 Unclassified 769
215 Ga0207646_10007769 3300025922 Bacteria 10853
216 Ga0207646_10167035 3300025922 Bacteria 1987
217 Ga0207646_10190697 3300025922 Bacteria 1851
218 Ga0207659_10221957 3300025926 Bacteria 1520
219 Ga0207687_10040993 3300025927 Bacteria 3177
220 Ga0207700_10000039 3300025928 Bacteria 102496
221 Ga0207700_10566091 3300025928 Unclassified 1010
222 Ga0207664_10005888 3300025929 Bacteria 8387
223 Ga0207664_10021048 3300025929 Bacteria 4841
224 Ga0207664_10052028 3300025929 Bacteria 3237
225 Ga0207664_10228781 3300025929 Bacteria 1615
226 Ga0207664_10515125 3300025929 Unclassified 1072
227 Ga0207690_10037079 3300025932 Bacteria 3163
228 Ga0207690_10071023 3300025932 Bacteria 2400
229 Ga0207706_10064391 3300025933 Bacteria 3227
230 Ga0207706_10544640 3300025933 Bacteria 999
231 Ga0207686_10102440 3300025934 Unclassified 1914
232 Ga0207686_10299625 3300025934 Bacteria 1193
233 Ga0207704_10302645 3300025938 Bacteria 1226
234 Ga0207665_10075176 3300025939 Bacteria 2313
235 Ga0207665_10113381 3300025939 Bacteria 1907
236 Ga0207665_10121104 3300025939 Bacteria 1848
237 Ga0207691_10085234 3300025940 Bacteria 2835
238 Ga0207711_10094264 3300025941 Bacteria 2638
239 Ga0207711_10856521 3300025941 Bacteria 846
240 Ga0207661_10000846 3300025944 Bacteria 20063
241 Ga0207661_10004419 3300025944 Bacteria 9863
242 Ga0207661_10214645 3300025944 Bacteria 1697
243 Ga0207661_10260674 3300025944 Bacteria 1544
244 Ga0207661_10558425 3300025944 Bacteria 1049
245 Ga0207679_10121456 3300025945 Bacteria 2081
246 Ga0207679_10565137 3300025945 Bacteria 1022
247 Ga0207667_10151851 3300025949 Bacteria 2383
248 Ga0207667_10184238 3300025949 Bacteria 2144
249 Ga0207667_10687766 3300025949 Unclassified 1026
250 Ga0207651_10155099 3300025960 Bacteria 1788
251 Ga0207639_10521594 3300026041 Bacteria 1088
252 Ga0207702_10157783 3300026078 Bacteria 2069
253 Ga0207702_10162865 3300026078 Bacteria 2038
254 Ga0207702_10569359 3300026078 Bacteria 1109
255 Ga0207702_10685246 3300026078 Bacteria 1009
256 Ga0207641_10371131 3300026088 Bacteria 1368
257 Ga0207641_11106466 3300026088 Bacteria 791
258 Ga0207648_10087644 3300026089 Bacteria 2717
259 Ga0207675_100764146 3300026118 Unclassified 978
260 Ga0207683_10029199 3300026121 Bacteria 4773
261 Ga0207698_10045528 3300026142 Bacteria 3306
262 Ga0207698_10055419 3300026142 Bacteria 3056
263 Ga0207698_10568544 3300026142 Bacteria 1114
264 Ga0207698_11097875 3300026142 Bacteria 808
265 Ga0268266_10832138 3300028379 Unclassified 892
266 Ga0265319_1002454 3300028563 Bacteria 10122
267 Ga0265318_10027242 3300028577 Bacteria 2247
268 Ga0265323_10093777 3300028653 Bacteria 1000
269 Ga0265322_10015265 3300028654 Bacteria 2219
270 Ga0265338_10028780 3300028800 Bacteria 5531
271 Ga0265330_10184373 3300031235 Bacteria 884
272 Ga0265320_10013704 3300031240 Bacteria 4649
273 Ga0265339_10236691 3300031249 Unclassified 888
274 Ga0265331_10208650 3300031250 Bacteria 879
275 Ga0265316_10083542 3300031344 Bacteria 2446
276 Ga0265314_10021108 3300031711 Bacteria 5016
277 Ga0307405_10146790 3300031731 Bacteria 1653
278 Ga0307413_10042128 3300031824 Bacteria 2680
279 Ga0307410_10051758 3300031852 Bacteria 2769
280 Ga0307407_10152931 3300031903 Bacteria 1501
281 Ga0307412_10478266 3300031911 Bacteria 1032
282 Ga0307416_100497619 3300032002 Bacteria 1282
283 Ga0307414_10056386 3300032004 Bacteria 2756
284 Ga0307411_10071221 3300032005 Bacteria 2355
285 Ga0373943_0011392 3300035170 Bacteria 4002
286 Ga0395899_0022900 3300037312 Bacteria 4733
287 Ga0395899_0047390 3300037312 Bacteria 3200
288 Ga0395899_0059359 3300037312 Bacteria 2820
289 Ga0395899_0174910 3300037312 Bacteria 1510
290 Ga0395899_0355325 3300037312 Bacteria 979
291 Ga0395899_0548317 3300037312 Unclassified 743
292 Ga0395899_0553788 3300037312 Bacteria 739
293 Ga0395900_0000528 3300037418 Bacteria 53945
294 Ga0395900_0003881 3300037418 Bacteria 15977
295 Ga0395900_0014793 3300037418 Bacteria 7952
296 Ga0395900_0035757 3300037418 Bacteria 5118
297 Ga0395900_0054878 3300037418 Bacteria 4102
298 Ga0395900_0096139 3300037418 Bacteria 3043
299 Ga0395900_0116010 3300037418 Bacteria 2748
300 Ga0395900_0119863 3300037418 Bacteria 2700
301 Ga0395900_0134013 3300037418 Bacteria 2538
302 Ga0395900_0152633 3300037418 Bacteria 2359
303 Ga0395900_0173232 3300037418 Bacteria 2196
304 Ga0395900_0196510 3300037418 Bacteria 2043
305 Ga0395900_0279065 3300037418 Bacteria 1663
306 Ga0395900_0293444 3300037418 Bacteria 1614
307 Ga0395900_0548111 3300037418 Unclassified 1101
308 Ga0395900_0742237 3300037418 Unclassified 912
309 Ga0395898_0007329 3300037466 Bacteria 11711
310 Ga0395898_0008888 3300037466 Bacteria 10583
311 Ga0395898_0009120 3300037466 Bacteria 10449
312 Ga0395898_0012243 3300037466 Bacteria 8868
313 Ga0395898_0014330 3300037466 Bacteria 8147
314 Ga0395898_0040289 3300037466 Bacteria 4620
315 Ga0395898_0050568 3300037466 Bacteria 4067
316 Ga0395898_0052061 3300037466 Bacteria 4000
317 Ga0395898_0080162 3300037466 Bacteria 3149
318 Ga0395898_0174455 3300037466 Bacteria 2055
319 Ga0395898_0178585 3300037466 Bacteria 2029
320 Ga0395898_0238063 3300037466 Archaea 1736
321 Ga0395898_0746787 3300037466 Bacteria 920
322 Ga0395905_0000661 3300037471 Bacteria 45819
323 Ga0395905_0003053 3300037471 Bacteria 18137
324 Ga0395905_0017506 3300037471 Bacteria 6803
325 Ga0395905_0030433 3300037471 Bacteria 5086
326 Ga0395905_0056384 3300037471 Bacteria 3676
327 Ga0395905_0866389 3300037471 Unclassified 806
328 Ga0395905_1133138 3300037471 Bacteria 686
329 Ga0436364_0197195 3300037853 Bacteria 2562
330 Ga0395901_0001883 3300038443 Bacteria 21647
331 Ga0395901_0001886 3300038443 Bacteria 21635
332 Ga0395901_0004160 3300038443 Bacteria 14597
333 Ga0395901_0005294 3300038443 Bacteria 13040
334 Ga0395901_0009762 3300038443 Bacteria 9733
335 Ga0395901_0012865 3300038443 Bacteria 8487
336 Ga0395901_0022948 3300038443 Bacteria 6397
337 Ga0395901_0037025 3300038443 Bacteria 5046
338 Ga0395901_0185068 3300038443 Bacteria 2184
339 Ga0395901_0191437 3300038443 Bacteria 2145
340 Ga0395901_0233145 3300038443 Bacteria 1921
341 Ga0395901_0286783 3300038443 Bacteria 1709
342 Ga0395901_0289506 3300038443 Bacteria 1700
343 Ga0395901_0358651 3300038443 Bacteria 1504
344 Ga0395901_0401041 3300038443 Bacteria 1409
345 Ga0395901_0619309 3300038443 Bacteria 1089
346 Ga0395901_0811510 3300038443 Unclassified 924
347 Ga0395901_0994096 3300038443 Bacteria 815
348 Ga0395901_1091775 3300038443 Bacteria 769
349 Ga0436365_1828440 3300039437 Bacteria 2656
350 Ga0436360_1152069 3300039438 Bacteria 1988
351 Ga0451804_0368465 3300041463 Bacteria 815
352 Ga0451835_0581384 3300041492 Bacteria 787
353 Ga0439448_0045616 3300042005 Bacteria 1427
354 Ga0439451_017413 3300042009 Unclassified 1448
355 Ga0466969_0020610 3300044656 Bacteria 3413
356 Ga0466972_0055149 3300044658 Bacteria 1912
357 Ga0466972_0516435 3300044658 Unclassified 563
358 Ga0466965_0043874 3300044683 Bacteria 2209
359 Ga0466965_0083177 3300044683 Bacteria 1620
360 Ga0466965_0243247 3300044683 Bacteria 964
361 Ga0466965_0403011 3300044683 Bacteria 756
362 Ga0466966_0014288 3300044684 Bacteria 5256
363 Ga0466966_0129382 3300044684 Bacteria 1547
364 Ga0466961_0003261 3300044693 Bacteria 10104
365 Ga0466961_0070676 3300044693 Bacteria 2216
366 Ga0466961_0132158 3300044693 Bacteria 1564
367 Ga0466963_0002288 3300044694 Bacteria 10650
368 Ga0466963_0011538 3300044694 Bacteria 5381
369 Ga0466963_0025079 3300044694 Bacteria 3799
370 Ga0466963_0025670 3300044694 Bacteria 3760
371 Ga0466963_0048221 3300044694 Bacteria 2813
372 Ga0466963_0105608 3300044694 Bacteria 1930
373 Ga0466963_0227613 3300044694 Bacteria 1306
374 Ga0466963_0298206 3300044694 Bacteria 1133
375 Ga0466963_0312352 3300044694 Bacteria 1106
376 Ga0466964_0003042 3300044706 Bacteria 6085
377 Ga0466964_0009153 3300044706 Bacteria 3726
378 Ga0466964_0044241 3300044706 Bacteria 1808
379 Ga0466964_0231186 3300044706 Bacteria 903
380 Ga0466971_0004887 3300044719 Bacteria 5794
381 Ga0466971_0045326 3300044719 Bacteria 1975
382 Ga0466971_0056421 3300044719 Bacteria 1772
383 Ga0466971_0083978 3300044719 Bacteria 1454
384 Ga0466971_0104090 3300044719 Bacteria 1306
385 Ga0466971_0242374 3300044719 Bacteria 858
386 Ga0466968_0056140 3300044735 Bacteria 1691
387 Ga0466970_0123033 3300044765 Bacteria 1422
388 Ga0466970_0464886 3300044765 Bacteria 726
389 Ga0466957_0000806 3300044842 Bacteria 15982
390 Ga0466957_0014641 3300044842 Bacteria 4570
391 Ga0466957_0120410 3300044842 Bacteria 1673
392 Ga0466957_0250531 3300044842 Bacteria 1177
393 Ga0466957_0682102 3300044842 Bacteria 724
394 Ga0466960_0147214 3300044901 Unclassified 1255
395 Ga0466960_0311427 3300044901 Unclassified 889
396 Ga0466959_0009826 3300045049 Bacteria 6817
397 Ga0466959_0023901 3300045049 Bacteria 4524
398 Ga0466959_0182609 3300045049 Bacteria 1467
399 Ga0466959_0216804 3300045049 Bacteria 1328
400 Ga0466958_0009266 3300045836 Bacteria 5481
401 Ga0466958_0033843 3300045836 Bacteria 3046
402 Ga0466958_0044488 3300045836 Bacteria 2676
403 Ga0466958_0165414 3300045836 Bacteria 1399
404 Ga0466958_0356624 3300045836 Bacteria 942
405 Ga0466967_0002124 3300045976 Bacteria 12152
406 Ga0466967_0002856 3300045976 Bacteria 10972
407 Ga0466967_0003602 3300045976 Bacteria 10170
408 Ga0466967_0005947 3300045976 Bacteria 8561
409 Ga0466967_0007612 3300045976 Bacteria 7833
410 Ga0466967_0023094 3300045976 Bacteria 5091
411 Ga0466967_0026759 3300045976 Bacteria 4784
412 Ga0466967_0037188 3300045976 Bacteria 4163
413 Ga0466967_0042602 3300045976 Bacteria 3924
414 Ga0466967_0056485 3300045976 Bacteria 3462
415 Ga0466967_0063248 3300045976 Bacteria 3287
416 Ga0466967_0088341 3300045976 Bacteria 2813
417 Ga0466967_0137081 3300045976 Bacteria 2276
418 Ga0466967_0252031 3300045976 Bacteria 1686
419 Ga0466967_0290229 3300045976 Bacteria 1571
420 Ga0466967_0429549 3300045976 Bacteria 1288
421 Ga0466967_0599289 3300045976 Bacteria 1087
422 Ga0466967_0704738 3300045976 Bacteria 1000
423 Ga0466967_0740476 3300045976 Unclassified 975
424 Ga0495629_0007333 3300046459 Bacteria 8127
425 Ga0495629_0142081 3300046459 Bacteria 1670
426 Ga0495641_0232553 3300046461 Bacteria 827
427 Ga0495651_0026302 3300046462 Bacteria 4533
428 Ga0495653_0012836 3300046463 Bacteria 6839
429 Ga0495653_0150263 3300046463 Bacteria 1628
430 Ga0495582_0276047 3300046473 Bacteria 965
431 Ga0495662_0040686 3300046476 Bacteria 2245
432 Ga0495662_0106341 3300046476 Bacteria 1374
433 Ga0495664_0131427 3300046477 Bacteria 1516
434 Ga0495594_0105498 3300046499 Bacteria 1587
435 Ga0495594_0234726 3300046499 Archaea 1045
436 Ga0495608_0097169 3300046511 Bacteria 1901
437 Ga0495628_0263867 3300046516 Bacteria 1283
438 Ga0495630_0002134 3300046517 Bacteria 13757
439 Ga0495630_0074432 3300046517 Bacteria 2558
440 Ga0495630_0168706 3300046517 Bacteria 1667
441 Ga0495652_0203533 3300046529 Bacteria 1500
442 Ga0495640_0014274 3300046533 Bacteria 6018
443 Ga0495640_0441920 3300046533 Unclassified 795
444 Ga0495586_0059045 3300046535 Bacteria 2084
445 Ga0495587_0191728 3300046536 Bacteria 1157
446 Ga0495667_0012309 3300046559 Bacteria 5799
447 Ga0495667_0135730 3300046559 Bacteria 1586
448 Ga0495634_0032263 3300046642 Bacteria 3603
449 Ga0495611_0127139 3300046648 Archaea 1189
450 Ga0495635_0049727 3300046663 Bacteria 2890
451 Ga0495659_0005067 3300046664 Bacteria 4138
452 Ga0495657_0065250 3300046675 Bacteria 2395
453 Ga0495658_0062829 3300046683 Bacteria 2135
454 Ga0495658_0168187 3300046683 Bacteria 1355
455 Ga0495658_0200260 3300046683 Bacteria 1244
456 Ga0495613_0084508 3300046689 Bacteria 2304
457 Ga0495589_0044768 3300046794 Bacteria 2200
458 Ga0495636_0019126 3300047318 Bacteria 2751
459 Ga0495636_0533293 3300047318 Bacteria 570
460 Ga0495674_0009083 3300047319 Bacteria 9443
461 Ga0495676_0046845 3300047321 Bacteria 3504
462 Ga0495676_0069055 3300047321 Bacteria 2728
463 Ga0495684_0075522 3300047471 Bacteria 2560
464 Ga0496100_0009489 3300048903 Bacteria 5468
465 Ga0496100_0011643 3300048903 Bacteria 5013
466 Ga0496100_0043159 3300048903 Bacteria 2883
467 Ga0496100_0156471 3300048903 Bacteria 1630
468 Ga0496100_0330194 3300048903 Bacteria 1148
469 Ga0496101_0008135 3300048904 Bacteria 6844
470 Ga0496101_0009285 3300048904 Bacteria 6459
471 Ga0496101_0193482 3300048904 Bacteria 1570
472 Ga0496102_0045475 3300048905 Bacteria 3986
473 Ga0496102_0183382 3300048905 Bacteria 1972
474 Ga0496102_0195160 3300048905 Bacteria 1908
475 Ga0496102_0242164 3300048905 Bacteria 1701
476 Ga0496103_0025489 3300048906 Bacteria 3575
477 Ga0496103_0052117 3300048906 Bacteria 2534
478 Ga0496103_0100465 3300048906 Bacteria 1831
479 Ga0496103_0221789 3300048906 Bacteria 1216
480 Ga0496104_0027105 3300048907 Bacteria 5300
481 Ga0496104_0055055 3300048907 Bacteria 3761
482 Ga0496104_0129752 3300048907 Bacteria 2421
483 Ga0496105_0010552 3300048908 Bacteria 7267
484 Ga0496105_0015044 3300048908 Bacteria 6157
485 Ga0496105_0228693 3300048908 Bacteria 1512
486 Ga0496106_0004542 3300048909 Bacteria 10284
487 Ga0496106_0020981 3300048909 Bacteria 4848
488 Ga0496106_0216987 3300048909 Bacteria 1525
489 Ga0496106_0881514 3300048909 Unclassified 707
490 Ga0496107_0000242 3300048910 Bacteria 28631
491 Ga0496107_0016119 3300048910 Bacteria 5243
492 Ga0496107_0016145 3300048910 Bacteria 5239
493 Ga0496107_0151089 3300048910 Bacteria 1718
494 Ga0496107_0176594 3300048910 Bacteria 1586
495 Ga0496107_0266524 3300048910 Bacteria 1275
496 Ga0496107_0313891 3300048910 Bacteria 1167
497 Ga0496108_0003459 3300048911 Bacteria 12666
498 Ga0496108_0028596 3300048911 Bacteria 4612
499 Ga0496108_0029785 3300048911 Bacteria 4523
500 Ga0496108_0591520 3300048911 Unclassified 967
501 Ga0496109_0000288 3300048912 Bacteria 47831
502 Ga0496109_0000534 3300048912 Bacteria 32226
503 Ga0496109_0028031 3300048912 Bacteria 5034
504 Ga0496109_0117906 3300048912 Bacteria 2471
505 Ga0496109_0285557 3300048912 Bacteria 1555
506 Ga0496109_0397262 3300048912 Bacteria 1302
507 Ga0496109_0415488 3300048912 Unclassified 1271
508 Ga0496109_0881697 3300048912 Unclassified 833
509 Ga0496110_0009021 3300048913 Bacteria 8048
510 Ga0496110_0019828 3300048913 Bacteria 5667
511 Ga0496110_0067059 3300048913 Bacteria 3175
512 Ga0496110_0170675 3300048913 Bacteria 1973
513 Ga0496110_0192425 3300048913 Bacteria 1852
514 Ga0496110_0203285 3300048913 Bacteria 1800
515 Ga0496110_0218050 3300048913 Bacteria 1735
516 Ga0496110_0943498 3300048913 Bacteria 769
517 Ga0496111_0000204 3300048914 Bacteria 27767
518 Ga0496111_0003515 3300048914 Bacteria 9694
519 Ga0496111_0005855 3300048914 Bacteria 7928
520 Ga0496111_0007836 3300048914 Bacteria 7034
521 Ga0496111_0102125 3300048914 Bacteria 2108
522 Ga0496111_0176755 3300048914 Bacteria 1587
523 Ga0496111_0236356 3300048914 Unclassified 1357
524 Ga0496112_0001332 3300048915 Bacteria 18774
525 Ga0496112_0001848 3300048915 Bacteria 16642
526 Ga0496112_0003412 3300048915 Bacteria 13125
527 Ga0496112_0011398 3300048915 Bacteria 8117
528 Ga0496112_0014336 3300048915 Bacteria 7346
529 Ga0496112_0034446 3300048915 Bacteria 4928
530 Ga0496112_0035626 3300048915 Bacteria 4850
531 Ga0496112_0099695 3300048915 Bacteria 2875
532 Ga0496112_0226623 3300048915 Bacteria 1824
533 Ga0496112_0422459 3300048915 Bacteria 1272
534 Ga0496112_0525577 3300048915 Bacteria 1118
535 Ga0496113_0022276 3300048916 Bacteria 4479
536 Ga0496113_0164141 3300048916 Bacteria 1757
537 Ga0496113_0200664 3300048916 Bacteria 1585
538 Ga0496113_0433413 3300048916 Bacteria 1056
539 Ga0496113_0933080 3300048916 Unclassified 686
540 Ga0496114_0007879 3300048917 Bacteria 8428
541 Ga0496114_0060712 3300048917 Bacteria 3160
542 Ga0496114_0131751 3300048917 Bacteria 2159
543 Ga0496114_0139222 3300048917 Bacteria 2100
544 Ga0496114_0157478 3300048917 Bacteria 1973
545 Ga0496114_0539140 3300048917 Bacteria 1031
546 Ga0496115_0033167 3300048918 Bacteria 4076
547 Ga0501032_0667736 3300049569 Bacteria 660
548 Ga0501034_0028452 3300049571 Bacteria 5688
549 Ga0501040_0301690 3300049576 Bacteria 1145
550 Ga0501047_0046363 3300049581 Bacteria 4201
551 Ga0501047_0081551 3300049581 Bacteria 3109
552 Ga0501067_0045639 3300049583 Bacteria 2432
553 Ga0501067_0114172 3300049583 Bacteria 1502
554 Ga0501067_0115656 3300049583 Bacteria 1492
555 Ga0501067_0139056 3300049583 Bacteria 1352
556 Ga0501067_0269863 3300049583 Bacteria 947
557 Ga0501068_0153328 3300049584 Bacteria 1449
558 Ga0501068_0263190 3300049584 Bacteria 1100
559 Ga0501069_0064932 3300049585 Bacteria 2040
560 Ga0501070_0006916 3300049586 Bacteria 9654
561 Ga0501070_0020474 3300049586 Bacteria 5547
562 Ga0501071_0238044 3300049587 Bacteria 1372
563 Ga0501071_0999116 3300049587 Bacteria 646
564 Ga0501072_0001809 3300049588 Bacteria 15925
565 Ga0501072_0008341 3300049588 Bacteria 7868
566 Ga0501072_0099859 3300049588 Bacteria 2307
567 Ga0501072_0597273 3300049588 Bacteria 870
568 Ga0501073_0063480 3300049589 Bacteria 2576
569 Ga0501076_0070594 3300049592 Bacteria 2793
570 Ga0501076_0248199 3300049592 Unclassified 1456
571 Ga0501077_0246599 3300049593 Unclassified 1135
572 Ga0501079_0097704 3300049741 Unclassified 2276
573 Ga0501080_0006721 3300049742 Bacteria 10357
574 Ga0501080_0071783 3300049742 Bacteria 3220
575 Ga0501081_0048069 3300049743 Bacteria 2936
576 Ga0501083_0015094 3300049744 Bacteria 5407
577 Ga0501035_0770431 3300049822 Bacteria 771
578 Ga0501044_0803022 3300049823 Bacteria 820
579 nmdc:mga05p37_531223_c1 3300050507 Bacteria 1343
580 nmdc:mga06r32_1115371_c1 3300050510 Bacteria 737
581 nmdc:mga08y16_331128_c1 3300050511 Bacteria 1566
582 nmdc:mga08y16_602494_c1 3300050511 Bacteria 1107
583 nmdc:mga0n895_665104_c1 3300050512 Bacteria 1039
584 nmdc:mga0rr50_376534_c1 3300050513 Bacteria 1196
585 nmdc:mga08x19_284260_c1 3300050514 Bacteria 1147
586 nmdc:mga0a205_98464_c1 3300050515 Bacteria 1324
587 Ga0495612_0058167 3300053078 Bacteria 1598
588 Ga0501084_0092960 3300054114 Bacteria 2532
589 Ga0501084_0111046 3300054114 Bacteria 2304
590 Ga0501084_0111677 3300054114 Bacteria 2297
591 Ga0501084_0202217 3300054114 Bacteria 1676
592 Ga0501084_0585627 3300054114 Bacteria 943
593 Ga0501082_0059586 3300060353 Bacteria 3290
594 Ga0501082_0130892 3300060353 Bacteria 2177
595 Ga0466962_0002596 3300061719 Bacteria 8581
596 Ga0466962_0014635 3300061719 Bacteria 3781
597 Ga0466962_0094054 3300061719 Bacteria 1437
598 Ga0466962_0235006 3300061719 Bacteria 899
599 Ga0530510_0045956 3300061734 Bacteria 3155
600 Ga0530510_0112079 3300061734 Unclassified 1999
601 Ga0495601_0160929
602 MBSR1b_contig_7856167
603 Ga0070658_10009314
604 Ga0070683_100059606
605 Ga0070683_100090091
606 Ga0070683_100194305
607 Ga0070683_100491417
608 Ga0070683_100660921
609 Ga0070680_100052144
610 Ga0070680_100281245
611 Ga0070680_100319950
612 Ga0070682_100104654
613 Ga0070682_100248099
614 Ga0070660_100000984
615 Ga0070660_100032748
616 Ga0070660_100168287
617 Ga0070661_100046370
618 Ga0070661_100090227
619 Ga0070661_100690734
620 Ga0070675_100403441
621 Ga0070671_100170559
622 Ga0070659_100184372
623 Ga0070659_100263652
624 Ga0070659_100708414
625 Ga0070709_10355177
626 Ga0070714_100041357
627 Ga0070714_100220352
628 Ga0070714_100457659
629 Ga0070713_100049718
630 Ga0070713_100329560
631 Ga0070701_10447589
632 Ga0070705_100177309
633 Ga0070694_100257924
634 Ga0070708_100043266
635 Ga0070663_100418302
636 Ga0070678_100264808
637 Ga0070678_100295431
638 Ga0070681_10008140
639 Ga0070681_10016502
640 Ga0070681_10051912
641 Ga0070681_10063702
642 Ga0070681_10116438
643 Ga0070681_10119553
644 Ga0070685_10445593
645 Ga0070707_100005156
646 Ga0070707_100295176
647 Ga0070707_100541998
648 Ga0070698_100038579
649 Ga0070698_100090569
650 Ga0070698_100237780
651 Ga0070698_100550710
652 Ga0070698_100694037
653 Ga0070698_100755210
654 Ga0070699_100280596
655 Ga0070699_100565075
656 Ga0070679_100027515
657 Ga0070679_100047714
658 Ga0070679_100057187
659 Ga0070679_100063954
660 Ga0070679_100076254
661 Ga0070684_100024186
662 Ga0070684_100032922
663 Ga0070684_100064947
664 Ga0070684_100068643
665 Ga0070684_100147457
666 Ga0070684_100639987
667 Ga0070684_100673132
668 Ga0070697_100047383
669 Ga0070697_100337449
670 Ga0068853_100211924
671 Ga0068853_100653815
672 Ga0070672_100068999
673 Ga0070696_100027076
674 Ga0070696_100073312
675 Ga0070693_100067652
676 Ga0070704_100063673
677 Ga0070704_100140030
678 Ga0068855_100036745
679 Ga0068855_100059511
680 Ga0068855_100129663
681 Ga0068855_100200504
682 Ga0068855_100343058
683 Ga0070664_100279419
684 Ga0068856_100038352
685 Ga0068856_100475331
686 Ga0070702_100419935
687 Ga0068852_100052416
688 Ga0068852_100065755
689 Ga0068852_100145400
690 Ga0068852_100693760
691 Ga0068866_10255003
692 Ga0068861_100309067
693 Ga0068863_100838024
694 Ga0081455_10023971
695 Ga0070717_10011291
696 Ga0070717_10127386
697 Ga0075365_10020916
698 Ga0070716_100098882
699 Ga0070716_100366214
700 Ga0070712_100453682
701 Ga0075367_10079491
702 Ga0097621_100381533
703 Ga0075433_10417969
704 Ga0075434_101234566
705 Ga0068865_100235600
706 Ga0075436_100234492
707 Ga0105240_10007847
708 Ga0105240_10043546
709 Ga0105240_10240497
710 Ga0105240_10990052
711 Ga0111539_10161787
712 Ga0105245_10029924
713 Ga0105245_10168482
714 Ga0105245_10239551
715 Ga0105245_10376095
716 Ga0105245_10806040
717 Ga0114129_10201231
718 Ga0114129_10352915
719 Ga0105243_10097674
720 Ga0105243_10380858
721 Ga0105243_10956248
722 Ga0105243_11121048
723 Ga0105242_10079385
724 Ga0105242_10089259
725 Ga0105242_10475344
726 Ga0105248_10151720
727 Ga0105248_10868520
728 Ga0105248_11093138
729 Ga0105238_10768305
730 Ga0105249_10568827
731 Ga0105239_10019324
732 Ga0105239_10180960
733 Ga0105239_10769332
734 Ga0105246_10102930
735 Ga0157373_10118968
736 Ga0157373_10166076
737 Ga0157373_10633264
738 Ga0157371_10080264
739 Ga0157370_10005135
740 Ga0157370_10015554
741 Ga0157370_10130824
742 Ga0157370_10265110
743 Ga0157370_10287828
744 Ga0157370_10312525
745 Ga0157369_10001404
746 Ga0157369_10003691
747 Ga0157369_10005700
748 Ga0157369_10005810
749 Ga0157369_10014197
750 Ga0157369_10111986
751 Ga0157369_10212353
752 Ga0157369_10646461
753 Ga0157369_10724877
754 Ga0157369_10926139
755 Ga0157374_10278141
756 Ga0157374_10631684
757 Ga0157378_10922374
758 Ga0157372_10121999
759 Ga0157372_10971048
760 Ga0157372_11001019
761 Ga0157375_10043912
762 Ga0157375_10072618
763 Ga0157375_10132191
764 Ga0182008_10005917
765 Ga0157377_10020511
766 Ga0157377_10075483
767 Ga0157377_10259544
768 Ga0157376_10260787
769 Ga0182006_1034074
770 Ga0206356_10226513
771 Ga0206356_10559060
772 Ga0206356_11243275
773 Ga0206354_11488358
774 Ga0206353_10361018
775 Ga0206353_10671812
776 Ga0206353_10948189
777 Ga0213871_10032651
778 Ga0207699_10042520
779 Ga0207699_10446795
780 Ga0207699_10587615
781 Ga0207705_10424885
782 Ga0207705_10739562
783 Ga0207684_10356019
784 Ga0207707_10022570
785 Ga0207707_10032427
786 Ga0207707_10039358
787 Ga0207707_10039982
788 Ga0207707_10148733
789 Ga0207707_10155468
790 Ga0207695_10019644
791 Ga0207695_10213400
792 Ga0207695_10656142
793 Ga0207695_10716887
794 Ga0207671_10214370
795 Ga0207693_10011954
796 Ga0207693_10126798
797 Ga0207660_10113992
798 Ga0207662_10111543
799 Ga0207657_10002091
800 Ga0207657_10007705
801 Ga0207657_10008201
802 Ga0207657_10035720
803 Ga0207657_10044262
804 Ga0207657_10116791
805 Ga0207657_10213364
806 Ga0207649_10143169
807 Ga0207652_10080533
808 Ga0207652_10153472
809 Ga0207652_10161457
810 Ga0207652_10229968
811 Ga0207652_10275520
812 Ga0207652_10352742
813 Ga0207652_10378555
814 Ga0207652_10926273
815 Ga0207646_10007769
816 Ga0207646_10167035
817 Ga0207646_10190697
818 Ga0207659_10221957
819 Ga0207687_10040993
820 Ga0207700_10000039
821 Ga0207700_10566091
822 Ga0207664_10005888
823 Ga0207664_10021048
824 Ga0207664_10052028
825 Ga0207664_10228781
826 Ga0207664_10515125
827 Ga0207690_10037079
828 Ga0207690_10071023
829 Ga0207706_10064391
830 Ga0207706_10544640
831 Ga0207686_10102440
832 Ga0207686_10299625
833 Ga0207704_10302645
834 Ga0207665_10075176
835 Ga0207665_10113381
836 Ga0207665_10121104
837 Ga0207691_10085234
838 Ga0207711_10094264
839 Ga0207711_10856521
840 Ga0207661_10000846
841 Ga0207661_10004419
842 Ga0207661_10214645
843 Ga0207661_10260674
844 Ga0207661_10558425
845 Ga0207679_10121456
846 Ga0207679_10565137
847 Ga0207667_10151851
848 Ga0207667_10184238
849 Ga0207667_10687766
850 Ga0207651_10155099
851 Ga0207639_10521594
852 Ga0207702_10157783
853 Ga0207702_10162865
854 Ga0207702_10569359
855 Ga0207702_10685246
856 Ga0207641_10371131
857 Ga0207641_11106466
858 Ga0207648_10087644
859 Ga0207675_100764146
860 Ga0207683_10029199
861 Ga0207698_10045528
862 Ga0207698_10055419
863 Ga0207698_10568544
864 Ga0207698_11097875
865 Ga0268266_10832138
866 Ga0265319_1002454
867 Ga0265318_10027242
868 Ga0265323_10093777
869 Ga0265322_10015265
870 Ga0265338_10028780
871 Ga0265330_10184373
872 Ga0265320_10013704
873 Ga0265339_10236691
874 Ga0265331_10208650
875 Ga0265316_10083542
876 Ga0265314_10021108
877 Ga0307405_10146790
878 Ga0307413_10042128
879 Ga0307410_10051758
880 Ga0307407_10152931
881 Ga0307412_10478266
882 Ga0307416_100497619
883 Ga0307414_10056386
884 Ga0307411_10071221
885 Ga0373943_0011392
886 Ga0395899_0022900
887 Ga0395899_0047390
888 Ga0395899_0059359
889 Ga0395899_0174910
890 Ga0395899_0355325
891 Ga0395899_0548317
892 Ga0395899_0553788
893 Ga0395900_0000528
894 Ga0395900_0003881
895 Ga0395900_0014793
896 Ga0395900_0035757
897 Ga0395900_0054878
898 Ga0395900_0096139
899 Ga0395900_0116010
900 Ga0395900_0119863
901 Ga0395900_0134013
902 Ga0395900_0152633
903 Ga0395900_0173232
904 Ga0395900_0196510
905 Ga0395900_0279065
906 Ga0395900_0293444
907 Ga0395900_0548111
908 Ga0395900_0742237
909 Ga0395898_0007329
910 Ga0395898_0008888
911 Ga0395898_0009120
912 Ga0395898_0012243
913 Ga0395898_0014330
914 Ga0395898_0040289
915 Ga0395898_0050568
916 Ga0395898_0052061
917 Ga0395898_0080162
918 Ga0395898_0174455
919 Ga0395898_0178585
920 Ga0395898_0238063
921 Ga0395898_0746787
922 Ga0395905_0000661
923 Ga0395905_0003053
924 Ga0395905_0017506
925 Ga0395905_0030433
926 Ga0395905_0056384
927 Ga0395905_0866389
928 Ga0395905_1133138
929 Ga0436364_0197195
930 Ga0395901_0001883
931 Ga0395901_0001886
932 Ga0395901_0004160
933 Ga0395901_0005294
934 Ga0395901_0009762
935 Ga0395901_0012865
936 Ga0395901_0022948
937 Ga0395901_0037025
938 Ga0395901_0185068
939 Ga0395901_0191437
940 Ga0395901_0233145
941 Ga0395901_0286783
942 Ga0395901_0289506
943 Ga0395901_0358651
944 Ga0395901_0401041
945 Ga0395901_0619309
946 Ga0395901_0811510
947 Ga0395901_0994096
948 Ga0395901_1091775
949 Ga0436365_1828440
950 Ga0436360_1152069
951 Ga0451804_0368465
952 Ga0451835_0581384
953 Ga0439448_0045616
954 Ga0439451_017413
955 Ga0466969_0020610
956 Ga0466972_0055149
957 Ga0466972_0516435
958 Ga0466965_0043874
959 Ga0466965_0083177
960 Ga0466965_0243247
961 Ga0466965_0403011
962 Ga0466966_0014288
963 Ga0466966_0129382
964 Ga0466961_0003261
965 Ga0466961_0070676
966 Ga0466961_0132158
967 Ga0466963_0002288
968 Ga0466963_0011538
969 Ga0466963_0025079
970 Ga0466963_0025670
971 Ga0466963_0048221
972 Ga0466963_0105608
973 Ga0466963_0227613
974 Ga0466963_0298206
975 Ga0466963_0312352
976 Ga0466964_0003042
977 Ga0466964_0009153
978 Ga0466964_0044241
979 Ga0466964_0231186
980 Ga0466971_0004887
981 Ga0466971_0045326
982 Ga0466971_0056421
983 Ga0466971_0083978
984 Ga0466971_0104090
985 Ga0466971_0242374
986 Ga0466968_0056140
987 Ga0466970_0123033
988 Ga0466970_0464886
989 Ga0466957_0000806
990 Ga0466957_0014641
991 Ga0466957_0120410
992 Ga0466957_0250531
993 Ga0466957_0682102
994 Ga0466960_0147214
995 Ga0466960_0311427
996 Ga0466959_0009826
997 Ga0466959_0023901
998 Ga0466959_0182609
999 Ga0466959_0216804
1000 Ga0466958_0009266
1001 Ga0466958_0033843
1002 Ga0466958_0044488
1003 Ga0466958_0165414
1004 Ga0466958_0356624
1005 Ga0466967_0002124
1006 Ga0466967_0002856
1007 Ga0466967_0003602
1008 Ga0466967_0005947
1009 Ga0466967_0007612
1010 Ga0466967_0023094
1011 Ga0466967_0026759
1012 Ga0466967_0037188
1013 Ga0466967_0042602
1014 Ga0466967_0056485
1015 Ga0466967_0063248
1016 Ga0466967_0088341
1017 Ga0466967_0137081
1018 Ga0466967_0252031
1019 Ga0466967_0290229
1020 Ga0466967_0429549
1021 Ga0466967_0599289
1022 Ga0466967_0704738
1023 Ga0466967_0740476
1024 Ga0495629_0007333
1025 Ga0495629_0142081
1026 Ga0495641_0232553
1027 Ga0495651_0026302
1028 Ga0495653_0012836
1029 Ga0495653_0150263
1030 Ga0495582_0276047
1031 Ga0495662_0040686
1032 Ga0495662_0106341
1033 Ga0495664_0131427
1034 Ga0495594_0105498
1035 Ga0495594_0234726
1036 Ga0495608_0097169
1037 Ga0495628_0263867
1038 Ga0495630_0002134
1039 Ga0495630_0074432
1040 Ga0495630_0168706
1041 Ga0495652_0203533
1042 Ga0495640_0014274
1043 Ga0495640_0441920
1044 Ga0495586_0059045
1045 Ga0495587_0191728
1046 Ga0495667_0012309
1047 Ga0495667_0135730
1048 Ga0495634_0032263
1049 Ga0495611_0127139
1050 Ga0495635_0049727
1051 Ga0495659_0005067
1052 Ga0495657_0065250
1053 Ga0495658_0062829
1054 Ga0495658_0168187
1055 Ga0495658_0200260
1056 Ga0495613_0084508
1057 Ga0495589_0044768
1058 Ga0495636_0019126
1059 Ga0495636_0533293
1060 Ga0495674_0009083
1061 Ga0495676_0046845
1062 Ga0495676_0069055
1063 Ga0495684_0075522
1064 Ga0496100_0009489
1065 Ga0496100_0011643
1066 Ga0496100_0043159
1067 Ga0496100_0156471
1068 Ga0496100_0330194
1069 Ga0496101_0008135
1070 Ga0496101_0009285
1071 Ga0496101_0193482
1072 Ga0496102_0045475
1073 Ga0496102_0183382
1074 Ga0496102_0195160
1075 Ga0496102_0242164
1076 Ga0496103_0025489
1077 Ga0496103_0052117
1078 Ga0496103_0100465
1079 Ga0496103_0221789
1080 Ga0496104_0027105
1081 Ga0496104_0055055
1082 Ga0496104_0129752
1083 Ga0496105_0010552
1084 Ga0496105_0015044
1085 Ga0496105_0228693
1086 Ga0496106_0004542
1087 Ga0496106_0020981
1088 Ga0496106_0216987
1089 Ga0496106_0881514
1090 Ga0496107_0000242
1091 Ga0496107_0016119
1092 Ga0496107_0016145
1093 Ga0496107_0151089
1094 Ga0496107_0176594
1095 Ga0496107_0266524
1096 Ga0496107_0313891
1097 Ga0496108_0003459
1098 Ga0496108_0028596
1099 Ga0496108_0029785
1100 Ga0496108_0591520
1101 Ga0496109_0000288
1102 Ga0496109_0000534
1103 Ga0496109_0028031
1104 Ga0496109_0117906
1105 Ga0496109_0285557
1106 Ga0496109_0397262
1107 Ga0496109_0415488
1108 Ga0496109_0881697
1109 Ga0496110_0009021
1110 Ga0496110_0019828
1111 Ga0496110_0067059
1112 Ga0496110_0170675
1113 Ga0496110_0192425
1114 Ga0496110_0203285
1115 Ga0496110_0218050
1116 Ga0496110_0943498
1117 Ga0496111_0000204
1118 Ga0496111_0003515
1119 Ga0496111_0005855
1120 Ga0496111_0007836
1121 Ga0496111_0102125
1122 Ga0496111_0176755
1123 Ga0496111_0236356
1124 Ga0496112_0001332
1125 Ga0496112_0001848
1126 Ga0496112_0003412
1127 Ga0496112_0011398
1128 Ga0496112_0014336
1129 Ga0496112_0034446
1130 Ga0496112_0035626
1131 Ga0496112_0099695
1132 Ga0496112_0226623
1133 Ga0496112_0422459
1134 Ga0496112_0525577
1135 Ga0496113_0022276
1136 Ga0496113_0164141
1137 Ga0496113_0200664
1138 Ga0496113_0433413
1139 Ga0496113_0933080
1140 Ga0496114_0007879
1141 Ga0496114_0060712
1142 Ga0496114_0131751
1143 Ga0496114_0139222
1144 Ga0496114_0157478
1145 Ga0496114_0539140
1146 Ga0496115_0033167
1147 Ga0501032_0667736
1148 Ga0501034_0028452
1149 Ga0501040_0301690
1150 Ga0501047_0046363
1151 Ga0501047_0081551
1152 Ga0501067_0045639
1153 Ga0501067_0114172
1154 Ga0501067_0115656
1155 Ga0501067_0139056
1156 Ga0501067_0269863
1157 Ga0501068_0153328
1158 Ga0501068_0263190
1159 Ga0501069_0064932
1160 Ga0501070_0006916
1161 Ga0501070_0020474
1162 Ga0501071_0238044
1163 Ga0501071_0999116
1164 Ga0501072_0001809
1165 Ga0501072_0008341
1166 Ga0501072_0099859
1167 Ga0501072_0597273
1168 Ga0501073_0063480
1169 Ga0501076_0070594
1170 Ga0501076_0248199
1171 Ga0501077_0246599
1172 Ga0501079_0097704
1173 Ga0501080_0006721
1174 Ga0501080_0071783
1175 Ga0501081_0048069
1176 Ga0501083_0015094
1177 Ga0501035_0770431
1178 Ga0501044_0803022
1179 nmdc:mga05p37_531223_c1
1180 nmdc:mga06r32_1115371_c1
1181 nmdc:mga08y16_331128_c1
1182 nmdc:mga08y16_602494_c1
1183 nmdc:mga0n895_665104_c1
1184 nmdc:mga0rr50_376534_c1
1185 nmdc:mga08x19_284260_c1
1186 nmdc:mga0a205_98464_c1
1187 Ga0495612_0058167
1188 Ga0501084_0092960
1189 Ga0501084_0111046
1190 Ga0501084_0111677
1191 Ga0501084_0202217
1192 Ga0501084_0585627
1193 Ga0501082_0059586
1194 Ga0501082_0130892
1195 Ga0466962_0002596
1196 Ga0466962_0014635
1197 Ga0466962_0094054
1198 Ga0466962_0235006
1199 Ga0530510_0045956
1200 Ga0530510_0112079

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

37

235

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o90-assembly1.cif.gz_C high resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes 0.8788 5 205
3eef-assembly1.cif.gz_A crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum 0.8729 5 205
3o92-assembly1.cif.gz_C high resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes 0.8617 6 205
3o94-assembly1.cif.gz_A high resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes 0.8614 6 205
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8572 4 204
ID Description Score Start End Superfamily
3eefB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8699 5 205 3.40.50.850
af_Q55BH4_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8633 5 212 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8572 4 204 3.40.50.850
af_Q55BH4_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8545 5 212 3.40.50.850
af_I1KV55_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8533 4 212 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2V7PUE5-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.989 1 211 GO:0016810
AF-A0A2V8TR47-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.986 5 210 GO:0016787
GO:0019363
GO:0046872
AF-A0A2V9RAY9-F1-model_v4 Isochorismatase-like domain-containing protein 0.9856 3 211
AF-A0A538IJQ2-F1-model_v4 Cysteine hydrolase 0.9853 5 207 GO:0016810
AF-A0A2M6YX02-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.985 3 215 GO:0016810

Map