F468013
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 600 | 313 | 587 | 440 |
Family's Representative Sequence
| Representative Sequence | 3300046692|Ga0495671_0018039|Ga0495671_0018039_549_1925 |
| Length | 458 |
| Sequence | MSPYAERRARLMAQMEPGSVAVIATAPEVLRNGDSDYPYRHDSSFYYLTGFTEPEAVLLLVAGRGTSQPQSILFCREKNIEHEIWEGYRYGPEAARAEFGLDFAYPIGQLDEHMTRQLANASALYCSLARNTTLDAQVMRWLESVRRMARSGVTAPSSVRDLLPLIDEMRLLKDEGEQATMLRAGEIAGGAHERAMRAARPGMFEYEIEAELLYEFRRHGAQFPAYTPIVASGANACVLHYNSNNRQTQDGDLVLIDAGCELNGYASDITRTFPVNGKFSGPQRALYDLVLASQDASAAATKAGNRFTDPHDAAVRVLAQGMLDFGLLDANKVGSVDDVIDSRAYFQFYMHRTGHWLGMDVHDCGSYVEPTQVGEVSERKDPLSNELIKNRPSRILQPGMVLTLEPGIYVRPADGVPAQFHNIGIRIEDDAIVTSTGCELISRGVPVKADEIEALMRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 2 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 3 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 4 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 5 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 6 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 7 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 8 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 9 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 10 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 11 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 12 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 13 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 148 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 154 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 155 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 171 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 172 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 173 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.83 |
| Metatranscriptomes | 0 |
| Isolates | 2.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.33 |
| Nodule | 0.33 |
| Rhizoplane | 2.67 |
| Rhizosphere | 83.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1001321 | 3300002739 | Bacteria | 4399 |
| 2 | JGI25152J39213_1000263 | 3300002773 | Bacteria | 35142 |
| 3 | JGI25150J39212_1000764 | 3300002774 | Bacteria | 11096 |
| 4 | JGI25159J45721_1000645 | 3300002987 | Bacteria | 15469 |
| 5 | JGI25153J46596_10000821 | 3300003215 | Bacteria | 18951 |
| 6 | rootL2_10018597 | 3300003322 | Bacteria | 4294 |
| 7 | JGI25161J50226_1002622 | 3300003374 | Bacteria | 4514 |
| 8 | Ga0055525_1000081 | 3300003759 | Bacteria | 161329 |
| 9 | Ga0055526_1003162 | 3300003771 | Bacteria | 10670 |
| 10 | Ga0055526_1003633 | 3300003771 | Bacteria | 9660 |
| 11 | Ga0055526_1011821 | 3300003771 | Bacteria | 3877 |
| 12 | Ga0055537_1000128 | 3300003773 | Bacteria | 58218 |
| 13 | Ga0055537_1004883 | 3300003773 | Bacteria | 3716 |
| 14 | Ga0055524_1000026 | 3300003775 | Bacteria | 214653 |
| 15 | Ga0055524_1001343 | 3300003775 | Bacteria | 14339 |
| 16 | Ga0055524_1002841 | 3300003775 | Bacteria | 8681 |
| 17 | Ga0055524_1004326 | 3300003775 | Bacteria | 6583 |
| 18 | Ga0055524_1030565 | 3300003775 | Bacteria | 1567 |
| 19 | Ga0055534_1000120 | 3300003784 | Bacteria | 57897 |
| 20 | Ga0055534_1003227 | 3300003784 | Bacteria | 5234 |
| 21 | Ga0055528_1000069 | 3300003790 | Bacteria | 83002 |
| 22 | Ga0055528_1009531 | 3300003790 | Bacteria | 4045 |
| 23 | Ga0055530_10007411 | 3300003791 | Bacteria | 4630 |
| 24 | Ga0055531_10007725 | 3300003794 | Bacteria | 5806 |
| 25 | Ga0055531_10012841 | 3300003794 | Bacteria | 3904 |
| 26 | Ga0055543_1003202 | 3300004625 | Bacteria | 4978 |
| 27 | Ga0055543_1007174 | 3300004625 | Bacteria | 2603 |
| 28 | Ga0065165_1000067 | 3300005262 | Bacteria | 170811 |
| 29 | Ga0065165_1008156 | 3300005262 | Bacteria | 4978 |
| 30 | Ga0065165_1027766 | 3300005262 | Bacteria | 1838 |
| 31 | Ga0070658_10105090 | 3300005327 | Bacteria | 2336 |
| 32 | Ga0070690_100002693 | 3300005330 | Bacteria | 9580 |
| 33 | Ga0070670_100000420 | 3300005331 | Bacteria | 34942 |
| 34 | Ga0068869_100000049 | 3300005334 | Bacteria | 50658 |
| 35 | Ga0068869_100002298 | 3300005334 | Bacteria | 11499 |
| 36 | Ga0070666_10027648 | 3300005335 | Bacteria | 3717 |
| 37 | Ga0070680_100003537 | 3300005336 | Bacteria | 11657 |
| 38 | Ga0070680_100016773 | 3300005336 | Bacteria | 5764 |
| 39 | Ga0068868_100000341 | 3300005338 | Bacteria | 31563 |
| 40 | Ga0068868_100000481 | 3300005338 | Bacteria | 26493 |
| 41 | Ga0070660_100055058 | 3300005339 | Bacteria | 3073 |
| 42 | Ga0070660_100071518 | 3300005339 | Bacteria | 2708 |
| 43 | Ga0070689_100003497 | 3300005340 | Bacteria | 10451 |
| 44 | Ga0070689_100027300 | 3300005340 | Bacteria | 4303 |
| 45 | Ga0070691_10000934 | 3300005341 | Bacteria | 11862 |
| 46 | Ga0070687_100000369 | 3300005343 | Bacteria | 15363 |
| 47 | Ga0070692_10000874 | 3300005345 | Bacteria | 10149 |
| 48 | Ga0070675_100011753 | 3300005354 | Bacteria | 6857 |
| 49 | Ga0070671_100000233 | 3300005355 | Bacteria | 37258 |
| 50 | Ga0070674_100150105 | 3300005356 | Bacteria | 1758 |
| 51 | Ga0070673_100034846 | 3300005364 | Bacteria | 3814 |
| 52 | Ga0070659_100072178 | 3300005366 | Bacteria | 2746 |
| 53 | Ga0070701_10000173 | 3300005438 | Bacteria | 20020 |
| 54 | Ga0070705_100002026 | 3300005440 | Bacteria | 10362 |
| 55 | Ga0070694_100000045 | 3300005444 | Bacteria | 57135 |
| 56 | Ga0070694_100024371 | 3300005444 | Bacteria | 3905 |
| 57 | Ga0070708_100182284 | 3300005445 | Bacteria | 1963 |
| 58 | Ga0068867_100004883 | 3300005459 | Bacteria | 9437 |
| 59 | Ga0070707_100224731 | 3300005468 | Bacteria | 1828 |
| 60 | Ga0070698_100018197 | 3300005471 | Bacteria | 7398 |
| 61 | Ga0070684_100002834 | 3300005535 | Bacteria | 12880 |
| 62 | Ga0070686_100054240 | 3300005544 | Bacteria | 2563 |
| 63 | Ga0070695_100000126 | 3300005545 | Bacteria | 34457 |
| 64 | Ga0070695_100043879 | 3300005545 | Bacteria | 2844 |
| 65 | Ga0070696_100003057 | 3300005546 | Bacteria | 11117 |
| 66 | Ga0070693_100000731 | 3300005547 | Bacteria | 14461 |
| 67 | Ga0070704_100000195 | 3300005549 | Bacteria | 24991 |
| 68 | Ga0070704_100000303 | 3300005549 | Bacteria | 21834 |
| 69 | Ga0068855_100007080 | 3300005563 | Bacteria | 13604 |
| 70 | Ga0068855_100021589 | 3300005563 | Bacteria | 7721 |
| 71 | Ga0070664_100052561 | 3300005564 | Bacteria | 3452 |
| 72 | Ga0068854_100003263 | 3300005578 | Bacteria | 10104 |
| 73 | Ga0068856_100015746 | 3300005614 | Bacteria | 7311 |
| 74 | Ga0070702_100000019 | 3300005615 | Bacteria | 46900 |
| 75 | Ga0068852_100004168 | 3300005616 | Bacteria | 10185 |
| 76 | Ga0068859_100111961 | 3300005617 | Bacteria | 2793 |
| 77 | Ga0068864_100079465 | 3300005618 | Bacteria | 2872 |
| 78 | Ga0068866_10001065 | 3300005718 | Bacteria | 12079 |
| 79 | Ga0068861_100002221 | 3300005719 | Bacteria | 12602 |
| 80 | Ga0068851_10019420 | 3300005834 | Bacteria | 3284 |
| 81 | Ga0068863_100012296 | 3300005841 | Bacteria | 8263 |
| 82 | Ga0068858_100000751 | 3300005842 | Bacteria | 33969 |
| 83 | Ga0068860_100005413 | 3300005843 | Bacteria | 12953 |
| 84 | Ga0068860_100118453 | 3300005843 | Bacteria | 2535 |
| 85 | Ga0068862_100005525 | 3300005844 | Bacteria | 10561 |
| 86 | Ga0081539_10000226 | 3300005985 | Bacteria | 132618 |
| 87 | Ga0070715_10066419 | 3300006163 | Bacteria | 1599 |
| 88 | Ga0097621_100002059 | 3300006237 | Bacteria | 13752 |
| 89 | Ga0097621_100026445 | 3300006237 | Bacteria | 4552 |
| 90 | Ga0068871_100003308 | 3300006358 | Bacteria | 11060 |
| 91 | Ga0075428_100002204 | 3300006844 | Bacteria | 21090 |
| 92 | Ga0075430_100028919 | 3300006846 | Bacteria | 4705 |
| 93 | Ga0075431_100039747 | 3300006847 | Bacteria | 4847 |
| 94 | Ga0075433_10001856 | 3300006852 | Bacteria | 15871 |
| 95 | Ga0075433_10108451 | 3300006852 | Bacteria | 2463 |
| 96 | Ga0075434_100001295 | 3300006871 | Bacteria | 20857 |
| 97 | Ga0075434_100081623 | 3300006871 | Bacteria | 3231 |
| 98 | Ga0075429_100000015 | 3300006880 | Bacteria | 78823 |
| 99 | Ga0075429_100000143 | 3300006880 | Bacteria | 43584 |
| 100 | Ga0068865_100001242 | 3300006881 | Bacteria | 14825 |
| 101 | Ga0075436_100000475 | 3300006914 | Bacteria | 26074 |
| 102 | Ga0075436_100073466 | 3300006914 | Bacteria | 2367 |
| 103 | Ga0097620_100111962 | 3300006931 | Bacteria | 2793 |
| 104 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 105 | Ga0075435_100000811 | 3300007076 | Bacteria | 19470 |
| 106 | Ga0075435_100001385 | 3300007076 | Bacteria | 15654 |
| 107 | Ga0075435_100018574 | 3300007076 | Bacteria | 5293 |
| 108 | Ga0111539_10020073 | 3300009094 | Bacteria | 8232 |
| 109 | Ga0111539_10064434 | 3300009094 | Bacteria | 4335 |
| 110 | Ga0105245_10005835 | 3300009098 | Bacteria | 10810 |
| 111 | Ga0114129_10001740 | 3300009147 | Bacteria | 29637 |
| 112 | Ga0114129_10049912 | 3300009147 | Bacteria | 5878 |
| 113 | Ga0105243_10004530 | 3300009148 | Bacteria | 10982 |
| 114 | Ga0105243_10076465 | 3300009148 | Bacteria | 2720 |
| 115 | Ga0105243_10082673 | 3300009148 | Bacteria | 2625 |
| 116 | Ga0105241_10014386 | 3300009174 | Bacteria | 5794 |
| 117 | Ga0105242_10020708 | 3300009176 | Bacteria | 5158 |
| 118 | Ga0105242_10141356 | 3300009176 | Bacteria | 2089 |
| 119 | Ga0105238_10175054 | 3300009551 | Bacteria | 2122 |
| 120 | Ga0157374_10079072 | 3300013296 | Bacteria | 3115 |
| 121 | Ga0157378_10000579 | 3300013297 | Bacteria | 34490 |
| 122 | Ga0163162_10380998 | 3300013306 | Bacteria | 1544 |
| 123 | Ga0157375_10001103 | 3300013308 | Bacteria | 23426 |
| 124 | Ga0157380_10266469 | 3300014326 | Bacteria | 1559 |
| 125 | Ga0157376_10007532 | 3300014969 | Bacteria | 7780 |
| 126 | Ga0209436_100496 | 3300025208 | Bacteria | 17304 |
| 127 | Ga0209436_101174 | 3300025208 | Bacteria | 9642 |
| 128 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 129 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 130 | Ga0207425_1000531 | 3300025245 | Bacteria | 23148 |
| 131 | Ga0209148_1000413 | 3300025254 | Bacteria | 48939 |
| 132 | Ga0209129_1000009 | 3300025258 | Bacteria | 633100 |
| 133 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 134 | Ga0209565_1000163 | 3300025263 | Bacteria | 87185 |
| 135 | Ga0209565_1000562 | 3300025263 | Bacteria | 25566 |
| 136 | Ga0209565_1000674 | 3300025263 | Bacteria | 21593 |
| 137 | Ga0209565_1003189 | 3300025263 | Bacteria | 5432 |
| 138 | Ga0209565_1010193 | 3300025263 | Bacteria | 2341 |
| 139 | Ga0209565_1010863 | 3300025263 | Bacteria | 2243 |
| 140 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 141 | Ga0209130_1000223 | 3300025284 | Bacteria | 74374 |
| 142 | Ga0209130_1001753 | 3300025284 | Bacteria | 12876 |
| 143 | Ga0209675_1000224 | 3300025291 | Bacteria | 57961 |
| 144 | Ga0209675_1000292 | 3300025291 | Bacteria | 46656 |
| 145 | Ga0209675_1003337 | 3300025291 | Bacteria | 7705 |
| 146 | Ga0209564_1000098 | 3300025295 | Bacteria | 228906 |
| 147 | Ga0209564_1000102 | 3300025295 | Bacteria | 222597 |
| 148 | Ga0209564_1001497 | 3300025295 | Bacteria | 23484 |
| 149 | Ga0209564_1001667 | 3300025295 | Bacteria | 21297 |
| 150 | Ga0209564_1017469 | 3300025295 | Bacteria | 2793 |
| 151 | Ga0209758_1000071 | 3300025297 | Bacteria | 283749 |
| 152 | Ga0209050_1000183 | 3300025298 | Bacteria | 142357 |
| 153 | Ga0209050_1000731 | 3300025298 | Bacteria | 47889 |
| 154 | Ga0209256_1000372 | 3300025299 | Bacteria | 71907 |
| 155 | Ga0209256_1000495 | 3300025299 | Bacteria | 57952 |
| 156 | Ga0209256_1001594 | 3300025299 | Bacteria | 22196 |
| 157 | Ga0209256_1002381 | 3300025299 | Bacteria | 15508 |
| 158 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 159 | Ga0207642_10001096 | 3300025899 | Bacteria | 8394 |
| 160 | Ga0207685_10042791 | 3300025905 | Bacteria | 1703 |
| 161 | Ga0207705_10007248 | 3300025909 | Bacteria | 8162 |
| 162 | Ga0207707_10054759 | 3300025912 | Bacteria | 3472 |
| 163 | Ga0207660_10004091 | 3300025917 | Bacteria | 9500 |
| 164 | Ga0207662_10000049 | 3300025918 | Bacteria | 51921 |
| 165 | Ga0207657_10028630 | 3300025919 | Bacteria | 5078 |
| 166 | Ga0207650_10034709 | 3300025925 | Bacteria | 3659 |
| 167 | Ga0207659_10031167 | 3300025926 | Bacteria | 3647 |
| 168 | Ga0207687_10004654 | 3300025927 | Bacteria | 9127 |
| 169 | Ga0207644_10018061 | 3300025931 | Bacteria | 4768 |
| 170 | Ga0207644_10149854 | 3300025931 | Bacteria | 1804 |
| 171 | Ga0207706_10202715 | 3300025933 | Bacteria | 1740 |
| 172 | Ga0207686_10011152 | 3300025934 | Bacteria | 4913 |
| 173 | Ga0207670_10001257 | 3300025936 | Bacteria | 13387 |
| 174 | Ga0207670_10107355 | 3300025936 | Bacteria | 2004 |
| 175 | Ga0207704_10013921 | 3300025938 | Bacteria | 4046 |
| 176 | Ga0207689_10005474 | 3300025942 | Bacteria | 11362 |
| 177 | Ga0207689_10129476 | 3300025942 | Bacteria | 2077 |
| 178 | Ga0207667_10013470 | 3300025949 | Bacteria | 9358 |
| 179 | Ga0207667_10016028 | 3300025949 | Bacteria | 8484 |
| 180 | Ga0207712_10009645 | 3300025961 | Bacteria | 6117 |
| 181 | Ga0207703_10019959 | 3300026035 | Bacteria | 5237 |
| 182 | Ga0207639_10171155 | 3300026041 | Bacteria | 1839 |
| 183 | Ga0207648_10000265 | 3300026089 | Bacteria | 56755 |
| 184 | Ga0207648_10014180 | 3300026089 | Bacteria | 7370 |
| 185 | Ga0207675_100000182 | 3300026118 | Bacteria | 56879 |
| 186 | Ga0207698_10001809 | 3300026142 | Bacteria | 12492 |
| 187 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 188 | Ga0207428_10001034 | 3300027907 | Bacteria | 30690 |
| 189 | Ga0268265_10004295 | 3300028380 | Bacteria | 9943 |
| 190 | Ga0268264_10006840 | 3300028381 | Bacteria | 9575 |
| 191 | Ga0268264_10065283 | 3300028381 | Bacteria | 3066 |
| 192 | Ga0307408_100006870 | 3300031548 | Bacteria | 7543 |
| 193 | Ga0307408_100013254 | 3300031548 | Bacteria | 5471 |
| 194 | Ga0307408_100019088 | 3300031548 | Bacteria | 4613 |
| 195 | Ga0307408_100031244 | 3300031548 | Bacteria | 3707 |
| 196 | Ga0307408_100164761 | 3300031548 | Bacteria | 1764 |
| 197 | Ga0307518_10007601 | 3300031838 | Bacteria | 7755 |
| 198 | Ga0307416_100060623 | 3300032002 | Bacteria | 3082 |
| 199 | Ga0373930_0013137 | 3300034816 | Bacteria | 1522 |
| 200 | Ga0373934_0012223 | 3300035086 | Bacteria | 3241 |
| 201 | Ga0373940_0004497 | 3300035088 | Bacteria | 2949 |
| 202 | Ga0373944_0023243 | 3300035089 | Bacteria | 1807 |
| 203 | Ga0373923_0009299 | 3300035111 | Bacteria | 3543 |
| 204 | Ga0373932_0003784 | 3300035112 | Bacteria | 3608 |
| 205 | Ga0373936_0009286 | 3300035113 | Bacteria | 3704 |
| 206 | Ga0373939_0002155 | 3300035114 | Bacteria | 4673 |
| 207 | Ga0373945_0004513 | 3300035116 | Bacteria | 4424 |
| 208 | Ga0373960_0024817 | 3300035121 | Bacteria | 1625 |
| 209 | Ga0373943_0025865 | 3300035170 | Bacteria | 2745 |
| 210 | Ga0373955_0013178 | 3300035172 | Bacteria | 3989 |
| 211 | Ga0373942_0004590 | 3300035207 | Bacteria | 3204 |
| 212 | Ga0373924_0016085 | 3300035410 | Bacteria | 2853 |
| 213 | Ga0373931_0000062 | 3300035691 | Bacteria | 54491 |
| 214 | Ga0373931_0013701 | 3300035691 | Bacteria | 3952 |
| 215 | Ga0373931_0023168 | 3300035691 | Bacteria | 3134 |
| 216 | Ga0373935_0026642 | 3300035692 | Bacteria | 3570 |
| 217 | Ga0373933_0001438 | 3300035724 | Bacteria | 13917 |
| 218 | Ga0373933_0007663 | 3300035724 | Bacteria | 5894 |
| 219 | Ga0373933_0062891 | 3300035724 | Bacteria | 2243 |
| 220 | Ga0373937_0003410 | 3300036401 | Bacteria | 13337 |
| 221 | Ga0373937_0009139 | 3300036401 | Bacteria | 8599 |
| 222 | Ga0373937_0250045 | 3300036401 | Bacteria | 1671 |
| 223 | Ga0395899_0030598 | 3300037312 | Bacteria | 4048 |
| 224 | Ga0395900_0000532 | 3300037418 | Bacteria | 53751 |
| 225 | Ga0395900_0010039 | 3300037418 | Bacteria | 9687 |
| 226 | Ga0395900_0020349 | 3300037418 | Bacteria | 6773 |
| 227 | Ga0395900_0070410 | 3300037418 | Bacteria | 3595 |
| 228 | Ga0395900_0070768 | 3300037418 | Bacteria | 3585 |
| 229 | Ga0395900_0266732 | 3300037418 | Bacteria | 1708 |
| 230 | Ga0395898_0023643 | 3300037466 | Bacteria | 6206 |
| 231 | Ga0395898_0068367 | 3300037466 | Bacteria | 3437 |
| 232 | Ga0395898_0157460 | 3300037466 | Bacteria | 2172 |
| 233 | Ga0395905_0025537 | 3300037471 | Bacteria | 5571 |
| 234 | Ga0395905_0032398 | 3300037471 | Bacteria | 4915 |
| 235 | Ga0395905_0042850 | 3300037471 | Bacteria | 4246 |
| 236 | Ga0395901_0000387 | 3300038443 | Bacteria | 52634 |
| 237 | Ga0395901_0003072 | 3300038443 | Bacteria | 16814 |
| 238 | Ga0395901_0136625 | 3300038443 | Bacteria | 2576 |
| 239 | Ga0395901_0209547 | 3300038443 | Bacteria | 2040 |
| 240 | Ga0451853_1159476 | 3300041512 | Bacteria | 1588 |
| 241 | Ga0439441_008716 | 3300042001 | Bacteria | 1664 |
| 242 | Ga0439448_0003230 | 3300042005 | Bacteria | 4500 |
| 243 | Ga0451577_0018812 | 3300042876 | Bacteria | 6356 |
| 244 | Ga0451577_0097648 | 3300042876 | Bacteria | 2624 |
| 245 | Ga0466972_0008353 | 3300044658 | Bacteria | 5189 |
| 246 | Ga0466965_0000667 | 3300044683 | Bacteria | 12598 |
| 247 | Ga0466965_0081054 | 3300044683 | Bacteria | 1640 |
| 248 | Ga0466966_0024006 | 3300044684 | Bacteria | 3990 |
| 249 | Ga0466966_0025591 | 3300044684 | Bacteria | 3854 |
| 250 | Ga0466966_0027270 | 3300044684 | Bacteria | 3725 |
| 251 | Ga0466966_0055391 | 3300044684 | Bacteria | 2509 |
| 252 | Ga0466961_0045812 | 3300044693 | Bacteria | 2798 |
| 253 | Ga0466963_0084919 | 3300044694 | Bacteria | 2148 |
| 254 | Ga0466964_0000392 | 3300044706 | Bacteria | 13313 |
| 255 | Ga0466964_0009938 | 3300044706 | Bacteria | 3583 |
| 256 | Ga0466968_0000256 | 3300044735 | Bacteria | 16878 |
| 257 | Ga0466970_0022088 | 3300044765 | Bacteria | 3321 |
| 258 | Ga0466957_0000388 | 3300044842 | Bacteria | 21542 |
| 259 | Ga0466957_0024097 | 3300044842 | Bacteria | 3601 |
| 260 | Ga0466959_0012486 | 3300045049 | Bacteria | 6139 |
| 261 | Ga0451576_0001787 | 3300045051 | Bacteria | 35253 |
| 262 | Ga0451576_0008064 | 3300045051 | Bacteria | 12423 |
| 263 | Ga0451576_0012002 | 3300045051 | Bacteria | 9784 |
| 264 | Ga0451576_0278373 | 3300045051 | Bacteria | 1749 |
| 265 | Ga0466958_0028127 | 3300045836 | Bacteria | 3331 |
| 266 | Ga0495627_000247 | 3300046453 | Bacteria | 56624 |
| 267 | Ga0495627_018772 | 3300046453 | Bacteria | 2326 |
| 268 | Ga0495592_0009024 | 3300046454 | Bacteria | 7493 |
| 269 | Ga0495603_0011608 | 3300046455 | Bacteria | 5329 |
| 270 | Ga0495603_0040983 | 3300046455 | Bacteria | 2770 |
| 271 | Ga0495629_0018036 | 3300046459 | Bacteria | 5058 |
| 272 | Ga0495638_0015616 | 3300046460 | Bacteria | 5097 |
| 273 | Ga0495638_0043249 | 3300046460 | Bacteria | 2842 |
| 274 | Ga0495638_0066858 | 3300046460 | Bacteria | 2208 |
| 275 | Ga0495653_0039936 | 3300046463 | Bacteria | 3672 |
| 276 | Ga0495650_0010129 | 3300046471 | Bacteria | 5287 |
| 277 | Ga0495580_0006729 | 3300046472 | Bacteria | 9331 |
| 278 | Ga0495582_0010843 | 3300046473 | Bacteria | 5015 |
| 279 | Ga0495605_0000307 | 3300046474 | Bacteria | 52199 |
| 280 | Ga0495605_0000369 | 3300046474 | Bacteria | 42654 |
| 281 | Ga0495605_0029247 | 3300046474 | Bacteria | 2838 |
| 282 | Ga0495639_0012157 | 3300046475 | Bacteria | 3711 |
| 283 | Ga0495662_0013392 | 3300046476 | Bacteria | 3991 |
| 284 | Ga0495662_0047475 | 3300046476 | Bacteria | 2072 |
| 285 | Ga0495584_0000762 | 3300046491 | Bacteria | 21279 |
| 286 | Ga0495584_0002453 | 3300046491 | Bacteria | 10518 |
| 287 | Ga0495584_0003217 | 3300046491 | Bacteria | 9068 |
| 288 | Ga0495584_0003805 | 3300046491 | Bacteria | 8210 |
| 289 | Ga0495584_0016521 | 3300046491 | Bacteria | 3763 |
| 290 | Ga0495584_0020747 | 3300046491 | Bacteria | 3337 |
| 291 | Ga0495585_0000148 | 3300046492 | Bacteria | 76376 |
| 292 | Ga0495585_0000613 | 3300046492 | Bacteria | 33250 |
| 293 | Ga0495585_0001019 | 3300046492 | Bacteria | 23308 |
| 294 | Ga0495585_0001344 | 3300046492 | Bacteria | 19505 |
| 295 | Ga0495585_0001953 | 3300046492 | Bacteria | 15407 |
| 296 | Ga0495585_0004701 | 3300046492 | Bacteria | 8798 |
| 297 | Ga0495585_0009131 | 3300046492 | Bacteria | 5968 |
| 298 | Ga0495585_0014629 | 3300046492 | Bacteria | 4566 |
| 299 | Ga0495585_0020438 | 3300046492 | Bacteria | 3808 |
| 300 | Ga0495585_0028325 | 3300046492 | Bacteria | 3195 |
| 301 | Ga0495585_0028800 | 3300046492 | Bacteria | 3164 |
| 302 | Ga0495585_0042845 | 3300046492 | Bacteria | 2533 |
| 303 | Ga0495585_0051478 | 3300046492 | Bacteria | 2282 |
| 304 | Ga0495596_0000778 | 3300046500 | Bacteria | 19414 |
| 305 | Ga0495596_0000952 | 3300046500 | Bacteria | 17275 |
| 306 | Ga0495596_0001117 | 3300046500 | Bacteria | 15863 |
| 307 | Ga0495596_0001924 | 3300046500 | Bacteria | 11506 |
| 308 | Ga0495596_0026250 | 3300046500 | Bacteria | 2348 |
| 309 | Ga0495596_0038172 | 3300046500 | Bacteria | 1899 |
| 310 | Ga0495607_0001816 | 3300046501 | Bacteria | 18209 |
| 311 | Ga0495607_0002834 | 3300046501 | Bacteria | 13765 |
| 312 | Ga0495607_0002875 | 3300046501 | Bacteria | 13606 |
| 313 | Ga0495607_0060321 | 3300046501 | Bacteria | 2159 |
| 314 | Ga0495583_0000268 | 3300046506 | Bacteria | 85709 |
| 315 | Ga0495583_0000857 | 3300046506 | Bacteria | 36987 |
| 316 | Ga0495583_0005606 | 3300046506 | Bacteria | 8460 |
| 317 | Ga0495583_0028051 | 3300046506 | Bacteria | 2772 |
| 318 | Ga0495583_0040003 | 3300046506 | Bacteria | 2205 |
| 319 | Ga0495606_0036811 | 3300046507 | Bacteria | 3329 |
| 320 | Ga0495606_0051170 | 3300046507 | Bacteria | 2696 |
| 321 | Ga0495606_0083969 | 3300046507 | Bacteria | 1973 |
| 322 | Ga0495608_0004731 | 3300046511 | Bacteria | 9740 |
| 323 | Ga0495616_0000052 | 3300046513 | Bacteria | 105258 |
| 324 | Ga0495616_0000817 | 3300046513 | Bacteria | 22704 |
| 325 | Ga0495616_0003103 | 3300046513 | Bacteria | 10753 |
| 326 | Ga0495616_0019052 | 3300046513 | Bacteria | 3751 |
| 327 | Ga0495616_0019920 | 3300046513 | Bacteria | 3655 |
| 328 | Ga0495616_0020953 | 3300046513 | Bacteria | 3549 |
| 329 | Ga0495616_0031954 | 3300046513 | Bacteria | 2753 |
| 330 | Ga0495618_0023201 | 3300046514 | Bacteria | 3835 |
| 331 | Ga0495628_0007988 | 3300046516 | Bacteria | 9116 |
| 332 | Ga0495630_0001001 | 3300046517 | Bacteria | 19663 |
| 333 | Ga0495631_0000673 | 3300046518 | Bacteria | 22036 |
| 334 | Ga0495631_0003570 | 3300046518 | Bacteria | 8498 |
| 335 | Ga0495631_0006929 | 3300046518 | Bacteria | 5808 |
| 336 | Ga0495631_0012413 | 3300046518 | Bacteria | 4160 |
| 337 | Ga0495631_0021505 | 3300046518 | Bacteria | 3004 |
| 338 | Ga0495631_0027394 | 3300046518 | Bacteria | 2608 |
| 339 | Ga0495631_0039044 | 3300046518 | Bacteria | 2108 |
| 340 | Ga0495632_0000260 | 3300046519 | Bacteria | 52561 |
| 341 | Ga0495632_0000887 | 3300046519 | Bacteria | 26268 |
| 342 | Ga0495632_0001388 | 3300046519 | Bacteria | 20299 |
| 343 | Ga0495632_0001906 | 3300046519 | Bacteria | 16686 |
| 344 | Ga0495632_0021241 | 3300046519 | Bacteria | 3501 |
| 345 | Ga0495637_0045539 | 3300046520 | Bacteria | 1860 |
| 346 | Ga0495643_0000079 | 3300046522 | Bacteria | 162735 |
| 347 | Ga0495643_0005190 | 3300046522 | Bacteria | 8884 |
| 348 | Ga0495643_0014914 | 3300046522 | Bacteria | 4608 |
| 349 | Ga0495643_0021553 | 3300046522 | Bacteria | 3695 |
| 350 | Ga0495643_0034661 | 3300046522 | Bacteria | 2784 |
| 351 | Ga0495644_0005948 | 3300046523 | Bacteria | 4756 |
| 352 | Ga0495644_0018457 | 3300046523 | Bacteria | 2665 |
| 353 | Ga0495648_0000117 | 3300046524 | Bacteria | 97341 |
| 354 | Ga0495648_0005389 | 3300046524 | Bacteria | 10636 |
| 355 | Ga0495663_0006777 | 3300046525 | Bacteria | 3159 |
| 356 | Ga0495663_0020873 | 3300046525 | Bacteria | 1882 |
| 357 | Ga0495666_0001606 | 3300046526 | Bacteria | 11122 |
| 358 | Ga0495666_0006235 | 3300046526 | Bacteria | 6007 |
| 359 | Ga0495642_0000438 | 3300046528 | Bacteria | 21966 |
| 360 | Ga0495642_0000657 | 3300046528 | Bacteria | 17307 |
| 361 | Ga0495642_0002957 | 3300046528 | Bacteria | 6770 |
| 362 | Ga0495642_0009583 | 3300046528 | Bacteria | 3706 |
| 363 | Ga0495642_0030494 | 3300046528 | Bacteria | 2157 |
| 364 | Ga0495642_0031876 | 3300046528 | Bacteria | 2114 |
| 365 | Ga0495642_0051666 | 3300046528 | Bacteria | 1691 |
| 366 | Ga0495652_0089281 | 3300046529 | Bacteria | 2524 |
| 367 | Ga0495654_0001281 | 3300046530 | Bacteria | 17634 |
| 368 | Ga0495654_0001433 | 3300046530 | Bacteria | 16412 |
| 369 | Ga0495654_0012235 | 3300046530 | Bacteria | 4614 |
| 370 | Ga0495665_0003893 | 3300046531 | Bacteria | 8078 |
| 371 | Ga0495665_0018236 | 3300046531 | Bacteria | 3772 |
| 372 | Ga0495665_0027527 | 3300046531 | Bacteria | 3051 |
| 373 | Ga0495640_0004549 | 3300046533 | Bacteria | 11056 |
| 374 | Ga0495586_0001499 | 3300046535 | Bacteria | 12886 |
| 375 | Ga0495586_0001789 | 3300046535 | Bacteria | 11753 |
| 376 | Ga0495586_0002428 | 3300046535 | Bacteria | 10100 |
| 377 | Ga0495586_0021527 | 3300046535 | Bacteria | 3437 |
| 378 | Ga0495587_0024366 | 3300046536 | Bacteria | 3710 |
| 379 | Ga0495598_0000961 | 3300046537 | Bacteria | 5558 |
| 380 | Ga0495609_0000028 | 3300046538 | Bacteria | 219908 |
| 381 | Ga0495609_0001706 | 3300046538 | Bacteria | 14244 |
| 382 | Ga0495609_0004384 | 3300046538 | Bacteria | 7743 |
| 383 | Ga0495609_0008429 | 3300046538 | Bacteria | 5050 |
| 384 | Ga0495609_0014166 | 3300046538 | Bacteria | 3754 |
| 385 | Ga0495609_0020110 | 3300046538 | Bacteria | 3085 |
| 386 | Ga0495597_0002300 | 3300046542 | Bacteria | 12402 |
| 387 | Ga0495597_0002834 | 3300046542 | Bacteria | 10618 |
| 388 | Ga0495597_0010739 | 3300046542 | Bacteria | 4463 |
| 389 | Ga0495597_0023534 | 3300046542 | Bacteria | 2848 |
| 390 | Ga0495597_0028110 | 3300046542 | Bacteria | 2575 |
| 391 | Ga0495645_0099538 | 3300046543 | Bacteria | 2068 |
| 392 | Ga0495622_0002273 | 3300046557 | Bacteria | 9341 |
| 393 | Ga0495622_0004624 | 3300046557 | Bacteria | 6375 |
| 394 | Ga0495622_0008654 | 3300046557 | Bacteria | 4716 |
| 395 | Ga0495622_0058697 | 3300046557 | Bacteria | 1782 |
| 396 | Ga0495633_0001933 | 3300046558 | Bacteria | 15072 |
| 397 | Ga0495633_0008066 | 3300046558 | Bacteria | 5983 |
| 398 | Ga0495633_0012332 | 3300046558 | Bacteria | 4552 |
| 399 | Ga0495633_0021914 | 3300046558 | Bacteria | 3189 |
| 400 | Ga0495667_0010845 | 3300046559 | Bacteria | 6160 |
| 401 | Ga0495667_0141394 | 3300046559 | Bacteria | 1551 |
| 402 | Ga0495656_0002755 | 3300046615 | Bacteria | 5879 |
| 403 | Ga0495656_0003684 | 3300046615 | Bacteria | 5200 |
| 404 | Ga0495656_0010145 | 3300046615 | Bacteria | 3414 |
| 405 | Ga0495656_0017064 | 3300046615 | Bacteria | 2764 |
| 406 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 407 | Ga0495668_0000768 | 3300046616 | Bacteria | 37462 |
| 408 | Ga0495668_0002938 | 3300046616 | Bacteria | 13450 |
| 409 | Ga0495668_0006624 | 3300046616 | Bacteria | 7553 |
| 410 | Ga0495668_0007764 | 3300046616 | Bacteria | 6805 |
| 411 | Ga0495668_0023799 | 3300046616 | Bacteria | 3488 |
| 412 | Ga0495668_0024715 | 3300046616 | Bacteria | 3416 |
| 413 | Ga0495668_0041180 | 3300046616 | Bacteria | 2574 |
| 414 | Ga0495634_0011090 | 3300046642 | Bacteria | 6573 |
| 415 | Ga0495611_0005434 | 3300046648 | Bacteria | 5447 |
| 416 | Ga0495625_0001449 | 3300046660 | Bacteria | 28796 |
| 417 | Ga0495625_0010265 | 3300046660 | Bacteria | 7763 |
| 418 | Ga0495625_0013090 | 3300046660 | Bacteria | 6682 |
| 419 | Ga0495625_0013261 | 3300046660 | Bacteria | 6631 |
| 420 | Ga0495635_0163233 | 3300046663 | Bacteria | 1516 |
| 421 | Ga0495659_0000128 | 3300046664 | Bacteria | 33389 |
| 422 | Ga0495659_0036067 | 3300046664 | Bacteria | 1745 |
| 423 | Ga0495661_0000157 | 3300046665 | Bacteria | 80637 |
| 424 | Ga0495661_0000710 | 3300046665 | Bacteria | 32881 |
| 425 | Ga0495661_0000932 | 3300046665 | Bacteria | 26643 |
| 426 | Ga0495661_0002284 | 3300046665 | Bacteria | 14824 |
| 427 | Ga0495661_0003893 | 3300046665 | Bacteria | 10910 |
| 428 | Ga0495661_0004318 | 3300046665 | Bacteria | 10295 |
| 429 | Ga0495661_0023638 | 3300046665 | Bacteria | 3986 |
| 430 | Ga0495661_0042382 | 3300046665 | Bacteria | 2806 |
| 431 | Ga0495661_0043966 | 3300046665 | Bacteria | 2741 |
| 432 | Ga0495661_0072596 | 3300046665 | Bacteria | 2007 |
| 433 | Ga0495661_0091422 | 3300046665 | Bacteria | 1730 |
| 434 | Ga0495588_0000113 | 3300046674 | Bacteria | 137279 |
| 435 | Ga0495588_0006726 | 3300046674 | Bacteria | 5196 |
| 436 | Ga0495588_0019718 | 3300046674 | Bacteria | 3307 |
| 437 | Ga0495588_0033810 | 3300046674 | Bacteria | 2584 |
| 438 | Ga0495599_0015568 | 3300046678 | Bacteria | 4721 |
| 439 | Ga0495623_0036973 | 3300046679 | Bacteria | 3127 |
| 440 | Ga0495623_0055002 | 3300046679 | Bacteria | 2510 |
| 441 | Ga0495658_0011040 | 3300046683 | Bacteria | 4531 |
| 442 | Ga0495669_0000218 | 3300046684 | Bacteria | 34510 |
| 443 | Ga0495669_0002189 | 3300046684 | Bacteria | 8019 |
| 444 | Ga0495669_0002436 | 3300046684 | Bacteria | 7605 |
| 445 | Ga0495613_0006610 | 3300046689 | Bacteria | 8666 |
| 446 | Ga0495624_0074815 | 3300046690 | Bacteria | 2103 |
| 447 | Ga0495670_0001954 | 3300046691 | Bacteria | 10144 |
| 448 | Ga0495670_0002681 | 3300046691 | Bacteria | 8785 |
| 449 | Ga0495671_0000234 | 3300046692 | Bacteria | 47760 |
| 450 | Ga0495671_0000358 | 3300046692 | Bacteria | 37933 |
| 451 | Ga0495671_0018039 | 3300046692 | Bacteria | 3753 |
| 452 | Ga0495671_0018164 | 3300046692 | Bacteria | 3734 |
| 453 | Ga0495671_0037569 | 3300046692 | Bacteria | 2448 |
| 454 | Ga0495649_0004762 | 3300046694 | Bacteria | 8797 |
| 455 | Ga0495649_0007589 | 3300046694 | Bacteria | 6594 |
| 456 | Ga0495649_0044510 | 3300046694 | Bacteria | 2423 |
| 457 | Ga0495589_0000113 | 3300046794 | Bacteria | 76949 |
| 458 | Ga0495589_0000117 | 3300046794 | Bacteria | 75549 |
| 459 | Ga0495589_0000712 | 3300046794 | Bacteria | 21540 |
| 460 | Ga0495589_0022273 | 3300046794 | Bacteria | 3233 |
| 461 | Ga0495600_0004232 | 3300046809 | Bacteria | 8571 |
| 462 | Ga0495660_0001770 | 3300046810 | Bacteria | 14302 |
| 463 | Ga0495660_0003899 | 3300046810 | Bacteria | 9116 |
| 464 | Ga0495660_0006758 | 3300046810 | Bacteria | 6767 |
| 465 | Ga0495660_0024655 | 3300046810 | Bacteria | 3425 |
| 466 | Ga0495660_0027227 | 3300046810 | Bacteria | 3235 |
| 467 | Ga0495581_0020592 | 3300047315 | Bacteria | 3827 |
| 468 | Ga0495581_0073341 | 3300047315 | Bacteria | 1980 |
| 469 | Ga0495604_0027355 | 3300047317 | Bacteria | 4536 |
| 470 | Ga0495604_0040259 | 3300047317 | Bacteria | 3670 |
| 471 | Ga0495604_0074502 | 3300047317 | Bacteria | 2558 |
| 472 | Ga0495604_0160270 | 3300047317 | Bacteria | 1590 |
| 473 | Ga0495636_0004863 | 3300047318 | Bacteria | 5261 |
| 474 | Ga0495636_0013453 | 3300047318 | Bacteria | 3248 |
| 475 | Ga0495674_0008080 | 3300047319 | Bacteria | 10042 |
| 476 | Ga0495674_0102129 | 3300047319 | Bacteria | 2439 |
| 477 | Ga0495672_0000035 | 3300047320 | Bacteria | 290329 |
| 478 | Ga0495672_0000423 | 3300047320 | Bacteria | 50688 |
| 479 | Ga0495672_0002295 | 3300047320 | Bacteria | 17743 |
| 480 | Ga0495672_0003282 | 3300047320 | Bacteria | 13998 |
| 481 | Ga0495676_0000034 | 3300047321 | Bacteria | 124977 |
| 482 | Ga0495676_0019334 | 3300047321 | Bacteria | 5992 |
| 483 | Ga0495676_0092812 | 3300047321 | Bacteria | 2252 |
| 484 | Ga0495680_0005270 | 3300047322 | Bacteria | 12208 |
| 485 | Ga0495680_0021252 | 3300047322 | Bacteria | 5436 |
| 486 | Ga0495683_0000275 | 3300047323 | Bacteria | 45085 |
| 487 | Ga0495683_0003535 | 3300047323 | Bacteria | 9096 |
| 488 | Ga0495683_0035227 | 3300047323 | Bacteria | 2544 |
| 489 | Ga0495683_0039375 | 3300047323 | Bacteria | 2389 |
| 490 | Ga0495687_000054 | 3300047443 | Bacteria | 194607 |
| 491 | Ga0495687_000060 | 3300047443 | Bacteria | 179124 |
| 492 | Ga0495687_000410 | 3300047443 | Bacteria | 53080 |
| 493 | Ga0495687_001251 | 3300047443 | Bacteria | 24150 |
| 494 | Ga0495687_019355 | 3300047443 | Bacteria | 3345 |
| 495 | Ga0495675_0087793 | 3300047444 | Bacteria | 1954 |
| 496 | Ga0495677_0000012 | 3300047445 | Bacteria | 146763 |
| 497 | Ga0495677_0000316 | 3300047445 | Bacteria | 20934 |
| 498 | Ga0495677_0001363 | 3300047445 | Bacteria | 9764 |
| 499 | Ga0495677_0033768 | 3300047445 | Bacteria | 1864 |
| 500 | Ga0495677_0050226 | 3300047445 | Bacteria | 1534 |
| 501 | Ga0495679_002389 | 3300047446 | Bacteria | 9596 |
| 502 | Ga0495679_004610 | 3300047446 | Bacteria | 6289 |
| 503 | Ga0495685_000383 | 3300047447 | Bacteria | 13981 |
| 504 | Ga0495685_006840 | 3300047447 | Bacteria | 3752 |
| 505 | Ga0495673_0010194 | 3300047469 | Bacteria | 5132 |
| 506 | Ga0495681_0001235 | 3300047470 | Bacteria | 19424 |
| 507 | Ga0495681_0003816 | 3300047470 | Bacteria | 10432 |
| 508 | Ga0495681_0010086 | 3300047470 | Bacteria | 5747 |
| 509 | Ga0495681_0017378 | 3300047470 | Bacteria | 3995 |
| 510 | Ga0495681_0024463 | 3300047470 | Bacteria | 3181 |
| 511 | Ga0495686_0001141 | 3300047472 | Bacteria | 31302 |
| 512 | Ga0495686_0001783 | 3300047472 | Bacteria | 21899 |
| 513 | Ga0495686_0004197 | 3300047472 | Bacteria | 11961 |
| 514 | Ga0495686_0023678 | 3300047472 | Bacteria | 4046 |
| 515 | Ga0495593_0012675 | 3300047673 | Bacteria | 4814 |
| 516 | Ga0495614_0004953 | 3300048089 | Bacteria | 6009 |
| 517 | Ga0495615_0000815 | 3300048090 | Bacteria | 4375 |
| 518 | Ga0495626_0000036 | 3300048091 | Bacteria | 180464 |
| 519 | Ga0495626_0000044 | 3300048091 | Bacteria | 165533 |
| 520 | Ga0495626_0001270 | 3300048091 | Bacteria | 20653 |
| 521 | Ga0495626_0004212 | 3300048091 | Bacteria | 8907 |
| 522 | Ga0495626_0015575 | 3300048091 | Bacteria | 3888 |
| 523 | Ga0495626_0019590 | 3300048091 | Bacteria | 3383 |
| 524 | Ga0495626_0029263 | 3300048091 | Bacteria | 2666 |
| 525 | Ga0495626_0031582 | 3300048091 | Bacteria | 2547 |
| 526 | Ga0495626_0037913 | 3300048091 | Bacteria | 2288 |
| 527 | Ga0495626_0040214 | 3300048091 | Bacteria | 2209 |
| 528 | Ga0495626_0054725 | 3300048091 | Bacteria | 1831 |
| 529 | Ga0496100_0008941 | 3300048903 | Bacteria | 5602 |
| 530 | Ga0496101_0026051 | 3300048904 | Bacteria | 4063 |
| 531 | Ga0496102_0000192 | 3300048905 | Bacteria | 83166 |
| 532 | Ga0496102_0001818 | 3300048905 | Bacteria | 18420 |
| 533 | Ga0496102_0098690 | 3300048905 | Bacteria | 2710 |
| 534 | Ga0496102_0112583 | 3300048905 | Bacteria | 2538 |
| 535 | Ga0496103_0002975 | 3300048906 | Bacteria | 10494 |
| 536 | Ga0496103_0042689 | 3300048906 | Bacteria | 2791 |
| 537 | Ga0496104_0084096 | 3300048907 | Bacteria | 3036 |
| 538 | Ga0496108_0007533 | 3300048911 | Bacteria | 8823 |
| 539 | Ga0496109_0038840 | 3300048912 | Bacteria | 4306 |
| 540 | Ga0496110_0000706 | 3300048913 | Bacteria | 23078 |
| 541 | Ga0496110_0005159 | 3300048913 | Bacteria | 10211 |
| 542 | Ga0496113_0015050 | 3300048916 | Bacteria | 5300 |
| 543 | Ga0496113_0145259 | 3300048916 | Bacteria | 1868 |
| 544 | Ga0496114_0045051 | 3300048917 | Bacteria | 3663 |
| 545 | Ga0496122_0003307 | 3300048925 | Bacteria | 21338 |
| 546 | Ga0496122_0003441 | 3300048925 | Bacteria | 20818 |
| 547 | Ga0496122_0041646 | 3300048925 | Bacteria | 3627 |
| 548 | Ga0496123_0000905 | 3300048926 | Bacteria | 46722 |
| 549 | Ga0496123_0007158 | 3300048926 | Bacteria | 10593 |
| 550 | Ga0496124_0002911 | 3300048927 | Bacteria | 21581 |
| 551 | Ga0496124_0007329 | 3300048927 | Bacteria | 11751 |
| 552 | Ga0496125_0002954 | 3300048928 | Bacteria | 21370 |
| 553 | Ga0495678_002016 | 3300049459 | Bacteria | 14566 |
| 554 | Ga0495682_0020688 | 3300049460 | Bacteria | 2469 |
| 555 | Ga0501032_0058792 | 3300049569 | Bacteria | 2581 |
| 556 | Ga0501034_0008329 | 3300049571 | Bacteria | 10970 |
| 557 | Ga0501034_0047636 | 3300049571 | Bacteria | 4328 |
| 558 | Ga0501040_0033552 | 3300049576 | Bacteria | 3478 |
| 559 | Ga0501046_0042098 | 3300049580 | Bacteria | 3642 |
| 560 | Ga0501068_0001055 | 3300049584 | Bacteria | 14604 |
| 561 | Ga0501069_0049021 | 3300049585 | Bacteria | 2347 |
| 562 | Ga0501070_0003078 | 3300049586 | Bacteria | 14519 |
| 563 | Ga0501071_0116377 | 3300049587 | Bacteria | 1979 |
| 564 | Ga0501072_0116010 | 3300049588 | Bacteria | 2132 |
| 565 | Ga0501073_0003022 | 3300049589 | Bacteria | 12609 |
| 566 | Ga0501074_0019604 | 3300049590 | Bacteria | 4909 |
| 567 | Ga0501238_002466 | 3300049671 | Bacteria | 2215 |
| 568 | Ga0501080_0012613 | 3300049742 | Bacteria | 7749 |
| 569 | Ga0501035_0001554 | 3300049822 | Bacteria | 23406 |
| 570 | Ga0501045_0150952 | 3300049824 | Bacteria | 1729 |
| 571 | nmdc:mga05p37_133_c1 | 3300050507 | Bacteria | 68369 |
| 572 | nmdc:mga05p37_3424_c1 | 3300050507 | Bacteria | 18509 |
| 573 | nmdc:mga09592_1698_c1 | 3300050508 | Bacteria | 17757 |
| 574 | nmdc:mga09592_26_c1 | 3300050508 | Bacteria | 84260 |
| 575 | nmdc:mga0qj67_325035_c1 | 3300050509 | Bacteria | 1245 |
| 576 | nmdc:mga06r32_55548_c1 | 3300050510 | Bacteria | 3798 |
| 577 | nmdc:mga08y16_1548_c1 | 3300050511 | Bacteria | 23173 |
| 578 | nmdc:mga08y16_85765_c1 | 3300050511 | Bacteria | 3282 |
| 579 | nmdc:mga0n895_28767_c1 | 3300050512 | Bacteria | 5291 |
| 580 | nmdc:mga0n895_5586_c1 | 3300050512 | Bacteria | 10529 |
| 581 | nmdc:mga0rr50_13378_c1 | 3300050513 | Bacteria | 5341 |
| 582 | nmdc:mga0rr50_436_c1 | 3300050513 | Bacteria | 22427 |
| 583 | nmdc:mga08x19_1428_c1 | 3300050514 | Bacteria | 14774 |
| 584 | nmdc:mga0a205_1353_c1 | 3300050515 | Bacteria | 20648 |
| 585 | nmdc:mga0a205_28199_c1 | 3300050515 | Bacteria | 5367 |
| 586 | Ga0501082_0112780 | 3300060353 | Bacteria | 2354 |
| 587 | Ga0501082_0167951 | 3300060353 | Bacteria | 1907 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0250045 | Ga0373937_0250045_520_1644 | 365 |
| 2 | 3300050509 | nmdc:mga0qj67_325035_c1 | nmdc:mga0qj67_325035_c1_17_1234 | 396 |
| 3 | 3300009094 | Ga0111539_10020073 | Ga0111539_100200731 | 404 |
| 4 | 3300046492 | Ga0495585_0009131 | Ga0495585_0009131_14_1264 | 407 |
| 5 | 3300047472 | Ga0495686_0023678 | Ga0495686_0023678_418_1752 | 416 |
| 6 | 3300005330 | Ga0070690_100002693 | Ga0070690_1000026932 | 418 |
| 7 | 3300005334 | Ga0068869_100002298 | Ga0068869_1000022988 | 418 |
| 8 | 3300005336 | Ga0070680_100003537 | Ga0070680_1000035379 | 418 |
| 9 | 3300005338 | Ga0068868_100000341 | Ga0068868_10000034129 | 418 |
| 10 | 3300005340 | Ga0070689_100003497 | Ga0070689_1000034972 | 418 |
| 11 | 3300005341 | Ga0070691_10000934 | Ga0070691_100009345 | 418 |
| 12 | 3300005343 | Ga0070687_100000369 | Ga0070687_1000003697 | 418 |
| 13 | 3300005345 | Ga0070692_10000874 | Ga0070692_100008742 | 418 |
| 14 | 3300005438 | Ga0070701_10000173 | Ga0070701_1000017313 | 418 |
| 15 | 3300005440 | Ga0070705_100002026 | Ga0070705_1000020262 | 418 |
| 16 | 3300005444 | Ga0070694_100000045 | Ga0070694_10000004550 | 418 |
| 17 | 3300005445 | Ga0070708_100182284 | Ga0070708_1001822841 | 418 |
| 18 | 3300005459 | Ga0068867_100004883 | Ga0068867_1000048832 | 418 |
| 19 | 3300005545 | Ga0070695_100000126 | Ga0070695_10000012627 | 418 |
| 20 | 3300005546 | Ga0070696_100003057 | Ga0070696_1000030575 | 418 |
| 21 | 3300005547 | Ga0070693_100000731 | Ga0070693_10000073110 | 418 |
| 22 | 3300005549 | Ga0070704_100000195 | Ga0070704_10000019517 | 418 |
| 23 | 3300005563 | Ga0068855_100007080 | Ga0068855_1000070805 | 418 |
| 24 | 3300005578 | Ga0068854_100003263 | Ga0068854_1000032637 | 418 |
| 25 | 3300005614 | Ga0068856_100015746 | Ga0068856_1000157464 | 418 |
| 26 | 3300005615 | Ga0070702_100000019 | Ga0070702_1000000197 | 418 |
| 27 | 3300005718 | Ga0068866_10001065 | Ga0068866_100010658 | 418 |
| 28 | 3300005719 | Ga0068861_100002221 | Ga0068861_1000022217 | 418 |
| 29 | 3300005842 | Ga0068858_100000751 | Ga0068858_1000007516 | 418 |
| 30 | 3300005843 | Ga0068860_100005413 | Ga0068860_1000054137 | 418 |
| 31 | 3300005844 | Ga0068862_100005525 | Ga0068862_1000055254 | 418 |
| 32 | 3300006358 | Ga0068871_100003308 | Ga0068871_1000033087 | 418 |
| 33 | 3300006844 | Ga0075428_100002204 | Ga0075428_10000220414 | 418 |
| 34 | 3300006880 | Ga0075429_100000143 | Ga0075429_10000014312 | 418 |
| 35 | 3300006881 | Ga0068865_100001242 | Ga0068865_10000124211 | 418 |
| 36 | 3300009098 | Ga0105245_10005835 | Ga0105245_100058354 | 418 |
| 37 | 3300009147 | Ga0114129_10001740 | Ga0114129_1000174023 | 418 |
| 38 | 3300009148 | Ga0105243_10004530 | Ga0105243_100045308 | 418 |
| 39 | 3300009176 | Ga0105242_10020708 | Ga0105242_100207085 | 418 |
| 40 | 3300013297 | Ga0157378_10000579 | Ga0157378_100005797 | 418 |
| 41 | 3300014326 | Ga0157380_10266469 | Ga0157380_102664692 | 418 |
| 42 | 3300014969 | Ga0157376_10007532 | Ga0157376_100075327 | 418 |
| 43 | 3300025899 | Ga0207642_10001096 | Ga0207642_100010963 | 418 |
| 44 | 3300025912 | Ga0207707_10054759 | Ga0207707_100547593 | 418 |
| 45 | 3300025917 | Ga0207660_10004091 | Ga0207660_100040916 | 418 |
| 46 | 3300025918 | Ga0207662_10000049 | Ga0207662_100000498 | 418 |
| 47 | 3300025927 | Ga0207687_10004654 | Ga0207687_100046542 | 418 |
| 48 | 3300025931 | Ga0207644_10149854 | Ga0207644_101498542 | 418 |
| 49 | 3300025936 | Ga0207670_10001257 | Ga0207670_100012577 | 418 |
| 50 | 3300025942 | Ga0207689_10005474 | Ga0207689_100054744 | 418 |
| 51 | 3300025949 | Ga0207667_10016028 | Ga0207667_100160283 | 418 |
| 52 | 3300025961 | Ga0207712_10009645 | Ga0207712_100096452 | 418 |
| 53 | 3300026035 | Ga0207703_10019959 | Ga0207703_100199592 | 418 |
| 54 | 3300026041 | Ga0207639_10171155 | Ga0207639_101711551 | 418 |
| 55 | 3300026089 | Ga0207648_10000265 | Ga0207648_100002657 | 418 |
| 56 | 3300026118 | Ga0207675_100000182 | Ga0207675_1000001828 | 418 |
| 57 | 3300027907 | Ga0207428_10001034 | Ga0207428_100010347 | 418 |
| 58 | 3300028380 | Ga0268265_10004295 | Ga0268265_100042956 | 418 |
| 59 | 3300028381 | Ga0268264_10006840 | Ga0268264_100068403 | 418 |
| 60 | 3300034816 | Ga0373930_0013137 | Ga0373930_0013137_91_1410 | 418 |
| 61 | 3300035088 | Ga0373940_0004497 | Ga0373940_0004497_840_2159 | 418 |
| 62 | 3300035112 | Ga0373932_0003784 | Ga0373932_0003784_440_1759 | 418 |
| 63 | 3300035114 | Ga0373939_0002155 | Ga0373939_0002155_2701_4020 | 418 |
| 64 | 3300035207 | Ga0373942_0004590 | Ga0373942_0004590_1050_2369 | 418 |
| 65 | 3300035691 | Ga0373931_0000062 | Ga0373931_0000062_24330_25649 | 418 |
| 66 | 3300035691 | Ga0373931_0013701 | Ga0373931_0013701_2272_3591 | 418 |
| 67 | 3300042876 | Ga0451577_0018812 | Ga0451577_0018812_2789_4108 | 418 |
| 68 | 3300045051 | Ga0451576_0001787 | Ga0451576_0001787_28416_29735 | 418 |
| 69 | 3300045051 | Ga0451576_0012002 | Ga0451576_0012002_2315_3634 | 418 |
| 70 | 3300046506 | Ga0495583_0000857 | Ga0495583_0000857_10637_11968 | 418 |
| 71 | 3300050507 | nmdc:mga05p37_3424_c1 | nmdc:mga05p37_3424_c1_8236_9555 | 418 |
| 72 | 3300050508 | nmdc:mga09592_1698_c1 | nmdc:mga09592_1698_c1_10210_11529 | 418 |
| 73 | 3300050511 | nmdc:mga08y16_1548_c1 | nmdc:mga08y16_1548_c1_9566_10885 | 418 |
| 74 | 3300044842 | Ga0466957_0024097 | Ga0466957_0024097_2292_3587 | 421 |
| 75 | 3300046459 | Ga0495629_0018036 | Ga0495629_0018036_3287_4576 | 421 |
| 76 | 3300046492 | Ga0495585_0028800 | Ga0495585_0028800_1851_3140 | 421 |
| 77 | 3300046500 | Ga0495596_0000952 | Ga0495596_0000952_14399_15688 | 421 |
| 78 | 3300046506 | Ga0495583_0005606 | Ga0495583_0005606_1617_2903 | 421 |
| 79 | 3300046513 | Ga0495616_0019052 | Ga0495616_0019052_2334_3623 | 421 |
| 80 | 3300046522 | Ga0495643_0000079 | Ga0495643_0000079_53365_54651 | 421 |
| 81 | 3300046528 | Ga0495642_0051666 | Ga0495642_0051666_32_1321 | 421 |
| 82 | 3300046558 | Ga0495633_0008066 | Ga0495633_0008066_2685_3974 | 421 |
| 83 | 3300046615 | Ga0495656_0010145 | Ga0495656_0010145_716_2005 | 421 |
| 84 | 3300046684 | Ga0495669_0002189 | Ga0495669_0002189_1236_2525 | 421 |
| 85 | 3300047319 | Ga0495674_0008080 | Ga0495674_0008080_6851_8140 | 421 |
| 86 | 3300048912 | Ga0496109_0038840 | Ga0496109_0038840_35_1327 | 421 |
| 87 | iso_pu_bacteria | 2846033681 | 2846034626 | 422 |
| 88 | iso_pu_bacteria | 2846037992 | 2846038782 | 422 |
| 89 | 3300005340 | Ga0070689_100027300 | Ga0070689_1000273003 | 423 |
| 90 | 3300005535 | Ga0070684_100002834 | Ga0070684_10000283411 | 423 |
| 91 | 3300005544 | Ga0070686_100054240 | Ga0070686_1000542402 | 423 |
| 92 | 3300005545 | Ga0070695_100043879 | Ga0070695_1000438793 | 423 |
| 93 | 3300006237 | Ga0097621_100026445 | Ga0097621_1000264453 | 423 |
| 94 | 3300006871 | Ga0075434_100081623 | Ga0075434_1000816233 | 423 |
| 95 | 3300031548 | Ga0307408_100164761 | Ga0307408_1001647612 | 423 |
| 96 | 3300035121 | Ga0373960_0024817 | Ga0373960_0024817_154_1470 | 423 |
| 97 | 3300035172 | Ga0373955_0013178 | Ga0373955_0013178_70_1386 | 423 |
| 98 | 3300035691 | Ga0373931_0023168 | Ga0373931_0023168_1350_2654 | 423 |
| 99 | 3300035724 | Ga0373933_0007663 | Ga0373933_0007663_486_1802 | 423 |
| 100 | 3300036401 | Ga0373937_0009139 | Ga0373937_0009139_6964_8280 | 423 |
| 101 | 3300041512 | Ga0451853_1159476 | Ga0451853_1159476_150_1466 | 423 |
| 102 | 3300042876 | Ga0451577_0097648 | Ga0451577_0097648_587_1891 | 423 |
| 103 | 3300046454 | Ga0495592_0009024 | Ga0495592_0009024_3495_4811 | 423 |
| 104 | 3300046476 | Ga0495662_0013392 | Ga0495662_0013392_1690_3006 | 423 |
| 105 | 3300046476 | Ga0495662_0047475 | Ga0495662_0047475_154_1470 | 423 |
| 106 | 3300046511 | Ga0495608_0004731 | Ga0495608_0004731_4612_5928 | 423 |
| 107 | 3300046514 | Ga0495618_0023201 | Ga0495618_0023201_1513_2829 | 423 |
| 108 | 3300046516 | Ga0495628_0007988 | Ga0495628_0007988_4446_5762 | 423 |
| 109 | 3300046517 | Ga0495630_0001001 | Ga0495630_0001001_11099_12415 | 423 |
| 110 | 3300046526 | Ga0495666_0006235 | Ga0495666_0006235_1756_3072 | 423 |
| 111 | 3300046529 | Ga0495652_0089281 | Ga0495652_0089281_733_2049 | 423 |
| 112 | 3300046533 | Ga0495640_0004549 | Ga0495640_0004549_6141_7457 | 423 |
| 113 | 3300046535 | Ga0495586_0001499 | Ga0495586_0001499_4938_6254 | 423 |
| 114 | 3300046536 | Ga0495587_0024366 | Ga0495587_0024366_185_1501 | 423 |
| 115 | 3300046543 | Ga0495645_0099538 | Ga0495645_0099538_422_1738 | 423 |
| 116 | 3300046559 | Ga0495667_0010845 | Ga0495667_0010845_4562_5878 | 423 |
| 117 | 3300046559 | Ga0495667_0141394 | Ga0495667_0141394_11_1327 | 423 |
| 118 | 3300046642 | Ga0495634_0011090 | Ga0495634_0011090_2722_4038 | 423 |
| 119 | 3300046663 | Ga0495635_0163233 | Ga0495635_0163233_181_1497 | 423 |
| 120 | 3300046678 | Ga0495599_0015568 | Ga0495599_0015568_83_1399 | 423 |
| 121 | 3300046683 | Ga0495658_0011040 | Ga0495658_0011040_372_1688 | 423 |
| 122 | 3300046689 | Ga0495613_0006610 | Ga0495613_0006610_1049_2365 | 423 |
| 123 | 3300046809 | Ga0495600_0004232 | Ga0495600_0004232_3277_4593 | 423 |
| 124 | 3300047317 | Ga0495604_0027355 | Ga0495604_0027355_1594_2910 | 423 |
| 125 | 3300047318 | Ga0495636_0004863 | Ga0495636_0004863_3771_5084 | 423 |
| 126 | 3300047322 | Ga0495680_0021252 | Ga0495680_0021252_2861_4177 | 423 |
| 127 | 3300049576 | Ga0501040_0033552 | Ga0501040_0033552_523_1884 | 423 |
| 128 | 3300049580 | Ga0501046_0042098 | Ga0501046_0042098_2093_3409 | 423 |
| 129 | 3300049824 | Ga0501045_0150952 | Ga0501045_0150952_154_1470 | 423 |
| 130 | 3300050512 | nmdc:mga0n895_5586_c1 | nmdc:mga0n895_5586_c1_8522_9838 | 423 |
| 131 | 3300005334 | Ga0068869_100000049 | Ga0068869_10000004912 | 424 |
| 132 | 3300005617 | Ga0068859_100111961 | Ga0068859_1001119612 | 424 |
| 133 | 3300005843 | Ga0068860_100118453 | Ga0068860_1001184532 | 424 |
| 134 | 3300006852 | Ga0075433_10001856 | Ga0075433_1000185618 | 424 |
| 135 | 3300006871 | Ga0075434_100001295 | Ga0075434_1000012957 | 424 |
| 136 | 3300006914 | Ga0075436_100000475 | Ga0075436_1000004753 | 424 |
| 137 | 3300006931 | Ga0097620_100111962 | Ga0097620_1001119622 | 424 |
| 138 | 3300007076 | Ga0075435_100001385 | Ga0075435_1000013857 | 424 |
| 139 | 3300009148 | Ga0105243_10082673 | Ga0105243_100826732 | 424 |
| 140 | 3300025905 | Ga0207685_10042791 | Ga0207685_100427912 | 424 |
| 141 | 3300026089 | Ga0207648_10014180 | Ga0207648_100141805 | 424 |
| 142 | 3300028381 | Ga0268264_10065283 | Ga0268264_100652833 | 424 |
| 143 | 3300035089 | Ga0373944_0023243 | Ga0373944_0023243_305_1624 | 424 |
| 144 | 3300035111 | Ga0373923_0009299 | Ga0373923_0009299_22_1341 | 424 |
| 145 | 3300035113 | Ga0373936_0009286 | Ga0373936_0009286_926_2245 | 424 |
| 146 | 3300035116 | Ga0373945_0004513 | Ga0373945_0004513_2046_3365 | 424 |
| 147 | 3300035170 | Ga0373943_0025865 | Ga0373943_0025865_973_2292 | 424 |
| 148 | 3300035410 | Ga0373924_0016085 | Ga0373924_0016085_1005_2324 | 424 |
| 149 | 3300035692 | Ga0373935_0026642 | Ga0373935_0026642_597_1916 | 424 |
| 150 | 3300045051 | Ga0451576_0008064 | Ga0451576_0008064_7151_8470 | 424 |
| 151 | 3300046455 | Ga0495603_0011608 | Ga0495603_0011608_3499_4818 | 424 |
| 152 | 3300046472 | Ga0495580_0006729 | Ga0495580_0006729_587_1906 | 424 |
| 153 | 3300046473 | Ga0495582_0010843 | Ga0495582_0010843_2959_4278 | 424 |
| 154 | 3300046475 | Ga0495639_0012157 | Ga0495639_0012157_974_2293 | 424 |
| 155 | 3300046531 | Ga0495665_0027527 | Ga0495665_0027527_1651_2970 | 424 |
| 156 | 3300046535 | Ga0495586_0002428 | Ga0495586_0002428_4265_5584 | 424 |
| 157 | 3300046537 | Ga0495598_0000961 | Ga0495598_0000961_3246_4565 | 424 |
| 158 | 3300046615 | Ga0495656_0002755 | Ga0495656_0002755_3410_4729 | 424 |
| 159 | 3300046616 | Ga0495668_0000008 | Ga0495668_0000008_360398_361687 | 424 |
| 160 | 3300047315 | Ga0495581_0020592 | Ga0495581_0020592_957_2276 | 424 |
| 161 | 3300047321 | Ga0495676_0019334 | Ga0495676_0019334_930_2249 | 424 |
| 162 | 3300049569 | Ga0501032_0058792 | Ga0501032_0058792_129_1430 | 424 |
| 163 | 3300049571 | Ga0501034_0008329 | Ga0501034_0008329_2506_3807 | 424 |
| 164 | 3300049571 | Ga0501034_0047636 | Ga0501034_0047636_2822_4123 | 424 |
| 165 | 3300049584 | Ga0501068_0001055 | Ga0501068_0001055_4517_5818 | 424 |
| 166 | 3300049586 | Ga0501070_0003078 | Ga0501070_0003078_6335_7636 | 424 |
| 167 | 3300049587 | Ga0501071_0116377 | Ga0501071_0116377_586_1905 | 424 |
| 168 | 3300049588 | Ga0501072_0116010 | Ga0501072_0116010_668_1969 | 424 |
| 169 | 3300049589 | Ga0501073_0003022 | Ga0501073_0003022_3695_4996 | 424 |
| 170 | 3300049590 | Ga0501074_0019604 | Ga0501074_0019604_3035_4336 | 424 |
| 171 | 3300049742 | Ga0501080_0012613 | Ga0501080_0012613_678_1979 | 424 |
| 172 | 3300050513 | nmdc:mga0rr50_436_c1 | nmdc:mga0rr50_436_c1_4462_5781 | 424 |
| 173 | 3300050514 | nmdc:mga08x19_1428_c1 | nmdc:mga08x19_1428_c1_586_1905 | 424 |
| 174 | 3300050515 | nmdc:mga0a205_1353_c1 | nmdc:mga0a205_1353_c1_8792_10111 | 424 |
| 175 | 3300060353 | Ga0501082_0112780 | Ga0501082_0112780_631_1932 | 424 |
| 176 | 3300005331 | Ga0070670_100000420 | Ga0070670_10000042027 | 426 |
| 177 | 3300005335 | Ga0070666_10027648 | Ga0070666_100276484 | 426 |
| 178 | 3300005336 | Ga0070680_100016773 | Ga0070680_1000167734 | 426 |
| 179 | 3300005338 | Ga0068868_100000481 | Ga0068868_10000048124 | 426 |
| 180 | 3300005354 | Ga0070675_100011753 | Ga0070675_1000117535 | 426 |
| 181 | 3300005355 | Ga0070671_100000233 | Ga0070671_10000023329 | 426 |
| 182 | 3300005356 | Ga0070674_100150105 | Ga0070674_1001501052 | 426 |
| 183 | 3300005364 | Ga0070673_100034846 | Ga0070673_1000348462 | 426 |
| 184 | 3300005444 | Ga0070694_100024371 | Ga0070694_1000243712 | 426 |
| 185 | 3300005468 | Ga0070707_100224731 | Ga0070707_1002247312 | 426 |
| 186 | 3300005471 | Ga0070698_100018197 | Ga0070698_1000181977 | 426 |
| 187 | 3300005549 | Ga0070704_100000303 | Ga0070704_10000030315 | 426 |
| 188 | 3300005616 | Ga0068852_100004168 | Ga0068852_1000041683 | 426 |
| 189 | 3300005618 | Ga0068864_100079465 | Ga0068864_1000794653 | 426 |
| 190 | 3300005834 | Ga0068851_10019420 | Ga0068851_100194202 | 426 |
| 191 | 3300005841 | Ga0068863_100012296 | Ga0068863_1000122965 | 426 |
| 192 | 3300005985 | Ga0081539_10000226 | Ga0081539_10000226136 | 426 |
| 193 | 3300006163 | Ga0070715_10066419 | Ga0070715_100664192 | 426 |
| 194 | 3300006237 | Ga0097621_100002059 | Ga0097621_10000205912 | 426 |
| 195 | 3300006847 | Ga0075431_100039747 | Ga0075431_1000397472 | 426 |
| 196 | 3300006880 | Ga0075429_100000015 | Ga0075429_10000001541 | 426 |
| 197 | 3300006914 | Ga0075436_100073466 | Ga0075436_1000734663 | 426 |
| 198 | 3300007076 | Ga0075435_100018574 | Ga0075435_1000185744 | 426 |
| 199 | 3300009094 | Ga0111539_10064434 | Ga0111539_100644342 | 426 |
| 200 | 3300009147 | Ga0114129_10049912 | Ga0114129_100499125 | 426 |
| 201 | 3300013296 | Ga0157374_10079072 | Ga0157374_100790722 | 426 |
| 202 | 3300013306 | Ga0163162_10380998 | Ga0163162_103809982 | 426 |
| 203 | 3300013308 | Ga0157375_10001103 | Ga0157375_1000110322 | 426 |
| 204 | 3300025925 | Ga0207650_10034709 | Ga0207650_100347093 | 426 |
| 205 | 3300025926 | Ga0207659_10031167 | Ga0207659_100311673 | 426 |
| 206 | 3300025931 | Ga0207644_10018061 | Ga0207644_100180614 | 426 |
| 207 | 3300025936 | Ga0207670_10107355 | Ga0207670_101073552 | 426 |
| 208 | 3300025938 | Ga0207704_10013921 | Ga0207704_100139214 | 426 |
| 209 | 3300025942 | Ga0207689_10129476 | Ga0207689_101294762 | 426 |
| 210 | 3300026142 | Ga0207698_10001809 | Ga0207698_1000180912 | 426 |
| 211 | 3300035086 | Ga0373934_0012223 | Ga0373934_0012223_1266_2591 | 426 |
| 212 | 3300035724 | Ga0373933_0001438 | Ga0373933_0001438_5779_7104 | 426 |
| 213 | 3300035724 | Ga0373933_0062891 | Ga0373933_0062891_425_1747 | 426 |
| 214 | 3300036401 | Ga0373937_0003410 | Ga0373937_0003410_4637_5962 | 426 |
| 215 | 3300042001 | Ga0439441_008716 | Ga0439441_008716_273_1592 | 426 |
| 216 | 3300045051 | Ga0451576_0278373 | Ga0451576_0278373_81_1406 | 426 |
| 217 | 3300046664 | Ga0495659_0036067 | Ga0495659_0036067_357_1688 | 426 |
| 218 | 3300048911 | Ga0496108_0007533 | Ga0496108_0007533_5810_7132 | 426 |
| 219 | 3300048913 | Ga0496110_0000706 | Ga0496110_0000706_18792_20114 | 426 |
| 220 | 3300049585 | Ga0501069_0049021 | Ga0501069_0049021_143_1465 | 426 |
| 221 | 3300050507 | nmdc:mga05p37_133_c1 | nmdc:mga05p37_133_c1_52227_53546 | 426 |
| 222 | 3300050508 | nmdc:mga09592_26_c1 | nmdc:mga09592_26_c1_2875_4194 | 426 |
| 223 | 3300050510 | nmdc:mga06r32_55548_c1 | nmdc:mga06r32_55548_c1_1913_3232 | 426 |
| 224 | 3300050511 | nmdc:mga08y16_85765_c1 | nmdc:mga08y16_85765_c1_466_1785 | 426 |
| 225 | 3300050512 | nmdc:mga0n895_28767_c1 | nmdc:mga0n895_28767_c1_344_1669 | 426 |
| 226 | 3300050513 | nmdc:mga0rr50_13378_c1 | nmdc:mga0rr50_13378_c1_1216_2541 | 426 |
| 227 | 3300060353 | Ga0501082_0167951 | Ga0501082_0167951_290_1615 | 426 |
| 228 | 3300006846 | Ga0075430_100028919 | Ga0075430_1000289194 | 428 |
| 229 | 3300006852 | Ga0075433_10108451 | Ga0075433_101084512 | 428 |
| 230 | 3300007076 | Ga0075435_100000811 | Ga0075435_1000008115 | 428 |
| 231 | 3300047472 | Ga0495686_0001141 | Ga0495686_0001141_27029_28378 | 428 |
| 232 | 3300050515 | nmdc:mga0a205_28199_c1 | nmdc:mga0a205_28199_c1_3830_5158 | 428 |
| 233 | iso_pu_bacteria | 8047673197 | 8047678753 | 429 |
| 234 | 3300002987 | JGI25159J45721_1000645 | JGI25159J45721_100064511 | 430 |
| 235 | 3300003775 | Ga0055524_1000026 | Ga0055524_1000026103 | 430 |
| 236 | 3300004625 | Ga0055543_1007174 | Ga0055543_10071743 | 430 |
| 237 | 3300005262 | Ga0065165_1000067 | Ga0065165_100006732 | 430 |
| 238 | 3300005262 | Ga0065165_1027766 | Ga0065165_10277662 | 430 |
| 239 | 3300006948 | Ga0099826_10000003 | Ga0099826_10000003958 | 430 |
| 240 | 3300025284 | Ga0209130_1000223 | Ga0209130_100022362 | 430 |
| 241 | 3300027666 | Ga0209282_1000002 | Ga0209282_100000250 | 430 |
| 242 | 3300049671 | Ga0501238_002466 | Ga0501238_002466_367_1686 | 430 |
| 243 | iso_pu_bacteria | 2738541280 | 2738740694 | 430 |
| 244 | iso_pu_bacteria | 2738541300 | 2738845012 | 430 |
| 245 | iso_pu_bacteria | 2738543018 | 2739277427 | 430 |
| 246 | iso_pu_bacteria | 2738543030 | 2739346470 | 430 |
| 247 | iso_pu_bacteria | 2643221556 | 2643800454 | 431 |
| 248 | iso_pu_bacteria | 2643221645 | 2644249264 | 431 |
| 249 | iso_pu_bacteria | 2643221664 | 2644355808 | 431 |
| 250 | iso_pu_bacteria | 2643221684 | 2644470363 | 431 |
| 251 | 3300046674 | Ga0495588_0006726 | Ga0495588_0006726_1250_2572 | 432 |
| 252 | 3300003322 | rootL2_10018597 | rootL2_100185973 | 433 |
| 253 | 3300037466 | Ga0395898_0068367 | Ga0395898_0068367_1805_3139 | 433 |
| 254 | 3300037471 | Ga0395905_0032398 | Ga0395905_0032398_2970_4304 | 433 |
| 255 | 3300038443 | Ga0395901_0209547 | Ga0395901_0209547_456_1790 | 433 |
| 256 | 3300044683 | Ga0466965_0081054 | Ga0466965_0081054_163_1491 | 433 |
| 257 | 3300044684 | Ga0466966_0027270 | Ga0466966_0027270_1288_2616 | 433 |
| 258 | 3300045049 | Ga0466959_0012486 | Ga0466959_0012486_4335_5663 | 433 |
| 259 | 3300046513 | Ga0495616_0031954 | Ga0495616_0031954_902_2230 | 433 |
| 260 | 3300048925 | Ga0496122_0041646 | Ga0496122_0041646_698_2026 | 433 |
| 261 | 3300048926 | Ga0496123_0007158 | Ga0496123_0007158_4842_6170 | 433 |
| 262 | 3300003759 | Ga0055525_1000081 | Ga0055525_100008144 | 434 |
| 263 | 3300005327 | Ga0070658_10105090 | Ga0070658_101050901 | 434 |
| 264 | 3300005339 | Ga0070660_100055058 | Ga0070660_1000550583 | 434 |
| 265 | 3300005339 | Ga0070660_100071518 | Ga0070660_1000715183 | 434 |
| 266 | 3300005366 | Ga0070659_100072178 | Ga0070659_1000721782 | 434 |
| 267 | 3300005563 | Ga0068855_100021589 | Ga0068855_1000215894 | 434 |
| 268 | 3300005564 | Ga0070664_100052561 | Ga0070664_1000525613 | 434 |
| 269 | 3300009148 | Ga0105243_10076465 | Ga0105243_100764652 | 434 |
| 270 | 3300009174 | Ga0105241_10014386 | Ga0105241_100143865 | 434 |
| 271 | 3300009176 | Ga0105242_10141356 | Ga0105242_101413562 | 434 |
| 272 | 3300009551 | Ga0105238_10175054 | Ga0105238_101750542 | 434 |
| 273 | 3300025230 | Ga0209563_100015 | Ga0209563_100015744 | 434 |
| 274 | 3300025254 | Ga0209148_1000413 | Ga0209148_10004135 | 434 |
| 275 | 3300025909 | Ga0207705_10007248 | Ga0207705_100072486 | 434 |
| 276 | 3300025919 | Ga0207657_10028630 | Ga0207657_100286305 | 434 |
| 277 | 3300025933 | Ga0207706_10202715 | Ga0207706_102027152 | 434 |
| 278 | 3300025934 | Ga0207686_10011152 | Ga0207686_100111522 | 434 |
| 279 | 3300025949 | Ga0207667_10013470 | Ga0207667_100134702 | 434 |
| 280 | 3300037312 | Ga0395899_0030598 | Ga0395899_0030598_2425_3759 | 434 |
| 281 | 3300037418 | Ga0395900_0000532 | Ga0395900_0000532_31900_33234 | 434 |
| 282 | 3300037418 | Ga0395900_0010039 | Ga0395900_0010039_3096_4430 | 434 |
| 283 | 3300037418 | Ga0395900_0020349 | Ga0395900_0020349_5266_6600 | 434 |
| 284 | 3300037418 | Ga0395900_0070410 | Ga0395900_0070410_1377_2711 | 434 |
| 285 | 3300037418 | Ga0395900_0070768 | Ga0395900_0070768_588_1922 | 434 |
| 286 | 3300037466 | Ga0395898_0023643 | Ga0395898_0023643_4708_6042 | 434 |
| 287 | 3300037466 | Ga0395898_0157460 | Ga0395898_0157460_52_1386 | 434 |
| 288 | 3300037471 | Ga0395905_0042850 | Ga0395905_0042850_660_2006 | 434 |
| 289 | 3300038443 | Ga0395901_0000387 | Ga0395901_0000387_35078_36412 | 434 |
| 290 | 3300038443 | Ga0395901_0003072 | Ga0395901_0003072_4646_5980 | 434 |
| 291 | 3300038443 | Ga0395901_0136625 | Ga0395901_0136625_1165_2511 | 434 |
| 292 | 3300042005 | Ga0439448_0003230 | Ga0439448_0003230_1240_2577 | 434 |
| 293 | 3300044658 | Ga0466972_0008353 | Ga0466972_0008353_1590_2924 | 434 |
| 294 | 3300044683 | Ga0466965_0000667 | Ga0466965_0000667_9863_11197 | 434 |
| 295 | 3300044684 | Ga0466966_0024006 | Ga0466966_0024006_2089_3423 | 434 |
| 296 | 3300044684 | Ga0466966_0025591 | Ga0466966_0025591_2159_3493 | 434 |
| 297 | 3300044684 | Ga0466966_0055391 | Ga0466966_0055391_761_2095 | 434 |
| 298 | 3300044693 | Ga0466961_0045812 | Ga0466961_0045812_296_1630 | 434 |
| 299 | 3300044694 | Ga0466963_0084919 | Ga0466963_0084919_241_1575 | 434 |
| 300 | 3300044706 | Ga0466964_0000392 | Ga0466964_0000392_25_1359 | 434 |
| 301 | 3300044706 | Ga0466964_0009938 | Ga0466964_0009938_1232_2566 | 434 |
| 302 | 3300044735 | Ga0466968_0000256 | Ga0466968_0000256_5130_6464 | 434 |
| 303 | 3300044765 | Ga0466970_0022088 | Ga0466970_0022088_1160_2491 | 434 |
| 304 | 3300044842 | Ga0466957_0000388 | Ga0466957_0000388_15454_16788 | 434 |
| 305 | 3300045836 | Ga0466958_0028127 | Ga0466958_0028127_1620_2966 | 434 |
| 306 | 3300046455 | Ga0495603_0040983 | Ga0495603_0040983_1407_2732 | 434 |
| 307 | 3300046474 | Ga0495605_0000369 | Ga0495605_0000369_5081_6412 | 434 |
| 308 | 3300046491 | Ga0495584_0016521 | Ga0495584_0016521_395_1729 | 434 |
| 309 | 3300046501 | Ga0495607_0002834 | Ga0495607_0002834_5836_7170 | 434 |
| 310 | 3300046507 | Ga0495606_0051170 | Ga0495606_0051170_965_2299 | 434 |
| 311 | 3300046522 | Ga0495643_0014914 | Ga0495643_0014914_1611_2942 | 434 |
| 312 | 3300046528 | Ga0495642_0002957 | Ga0495642_0002957_4930_6276 | 434 |
| 313 | 3300046538 | Ga0495609_0000028 | Ga0495609_0000028_89969_91303 | 434 |
| 314 | 3300046557 | Ga0495622_0058697 | Ga0495622_0058697_263_1588 | 434 |
| 315 | 3300046660 | Ga0495625_0013261 | Ga0495625_0013261_3572_4918 | 434 |
| 316 | 3300046664 | Ga0495659_0000128 | Ga0495659_0000128_12262_13608 | 434 |
| 317 | 3300046665 | Ga0495661_0000157 | Ga0495661_0000157_58557_59891 | 434 |
| 318 | 3300046665 | Ga0495661_0000710 | Ga0495661_0000710_12566_13912 | 434 |
| 319 | 3300046665 | Ga0495661_0072596 | Ga0495661_0072596_510_1844 | 434 |
| 320 | 3300046674 | Ga0495588_0000113 | Ga0495588_0000113_19040_20389 | 434 |
| 321 | 3300046692 | Ga0495671_0000234 | Ga0495671_0000234_19469_20815 | 434 |
| 322 | 3300046694 | Ga0495649_0044510 | Ga0495649_0044510_84_1415 | 434 |
| 323 | 3300046794 | Ga0495589_0000113 | Ga0495589_0000113_6027_7361 | 434 |
| 324 | 3300046794 | Ga0495589_0000117 | Ga0495589_0000117_59875_61206 | 434 |
| 325 | 3300046810 | Ga0495660_0006758 | Ga0495660_0006758_4479_5810 | 434 |
| 326 | 3300047320 | Ga0495672_0000035 | Ga0495672_0000035_13186_14532 | 434 |
| 327 | 3300047320 | Ga0495672_0000423 | Ga0495672_0000423_30309_31640 | 434 |
| 328 | 3300047323 | Ga0495683_0035227 | Ga0495683_0035227_414_1745 | 434 |
| 329 | 3300047443 | Ga0495687_000054 | Ga0495687_000054_124012_125346 | 434 |
| 330 | 3300047443 | Ga0495687_001251 | Ga0495687_001251_17620_18954 | 434 |
| 331 | 3300047445 | Ga0495677_0000012 | Ga0495677_0000012_123869_125203 | 434 |
| 332 | 3300047445 | Ga0495677_0000316 | Ga0495677_0000316_10401_11732 | 434 |
| 333 | 3300048091 | Ga0495626_0000036 | Ga0495626_0000036_62070_63401 | 434 |
| 334 | 3300048091 | Ga0495626_0001270 | Ga0495626_0001270_17274_18608 | 434 |
| 335 | 3300048907 | Ga0496104_0084096 | Ga0496104_0084096_582_1916 | 434 |
| 336 | 3300048916 | Ga0496113_0015050 | Ga0496113_0015050_442_1776 | 434 |
| 337 | 3300048917 | Ga0496114_0045051 | Ga0496114_0045051_898_2232 | 434 |
| 338 | 3300048925 | Ga0496122_0003441 | Ga0496122_0003441_17300_18634 | 434 |
| 339 | 3300048927 | Ga0496124_0002911 | Ga0496124_0002911_18257_19591 | 434 |
| 340 | 3300048927 | Ga0496124_0007329 | Ga0496124_0007329_5809_7143 | 434 |
| 341 | 3300049822 | Ga0501035_0001554 | Ga0501035_0001554_16953_18287 | 434 |
| 342 | iso_pu_bacteria | 2643221554 | 2643789162 | 434 |
| 343 | iso_pu_bacteria | 2643221638 | 2644215102 | 434 |
| 344 | 3300003771 | Ga0055526_1003633 | Ga0055526_10036336 | 435 |
| 345 | 3300003771 | Ga0055526_1011821 | Ga0055526_10118213 | 435 |
| 346 | 3300003773 | Ga0055537_1000128 | Ga0055537_100012837 | 435 |
| 347 | 3300003775 | Ga0055524_1002841 | Ga0055524_10028416 | 435 |
| 348 | 3300003775 | Ga0055524_1030565 | Ga0055524_10305652 | 435 |
| 349 | 3300003784 | Ga0055534_1000120 | Ga0055534_100012037 | 435 |
| 350 | 3300003784 | Ga0055534_1003227 | Ga0055534_10032273 | 435 |
| 351 | 3300003790 | Ga0055528_1000069 | Ga0055528_100006910 | 435 |
| 352 | 3300003790 | Ga0055528_1009531 | Ga0055528_10095312 | 435 |
| 353 | 3300003794 | Ga0055531_10007725 | Ga0055531_100077254 | 435 |
| 354 | 3300003794 | Ga0055531_10012841 | Ga0055531_100128412 | 435 |
| 355 | 3300025208 | Ga0209436_101174 | Ga0209436_1011742 | 435 |
| 356 | 3300025245 | Ga0207425_1000531 | Ga0207425_100053122 | 435 |
| 357 | 3300025263 | Ga0209565_1000006 | Ga0209565_1000006693 | 435 |
| 358 | 3300025263 | Ga0209565_1000163 | Ga0209565_100016365 | 435 |
| 359 | 3300025263 | Ga0209565_1000562 | Ga0209565_100056216 | 435 |
| 360 | 3300025263 | Ga0209565_1000674 | Ga0209565_100067410 | 435 |
| 361 | 3300025263 | Ga0209565_1003189 | Ga0209565_10031893 | 435 |
| 362 | 3300025263 | Ga0209565_1010863 | Ga0209565_10108632 | 435 |
| 363 | 3300025273 | Ga0209673_1000004 | Ga0209673_1000004136 | 435 |
| 364 | 3300025291 | Ga0209675_1000224 | Ga0209675_100022423 | 435 |
| 365 | 3300025291 | Ga0209675_1000292 | Ga0209675_100029231 | 435 |
| 366 | 3300025295 | Ga0209564_1000102 | Ga0209564_1000102177 | 435 |
| 367 | 3300025295 | Ga0209564_1001497 | Ga0209564_10014979 | 435 |
| 368 | 3300025295 | Ga0209564_1001667 | Ga0209564_100166716 | 435 |
| 369 | 3300025298 | Ga0209050_1000183 | Ga0209050_100018313 | 435 |
| 370 | 3300025299 | Ga0209256_1000372 | Ga0209256_100037218 | 435 |
| 371 | 3300025299 | Ga0209256_1000495 | Ga0209256_100049523 | 435 |
| 372 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010128 | 435 |
| 373 | 3300031548 | Ga0307408_100019088 | Ga0307408_1000190884 | 435 |
| 374 | 3300031548 | Ga0307408_100031244 | Ga0307408_1000312444 | 435 |
| 375 | 3300031838 | Ga0307518_10007601 | Ga0307518_100076014 | 435 |
| 376 | 3300037418 | Ga0395900_0266732 | Ga0395900_0266732_217_1551 | 435 |
| 377 | 3300037471 | Ga0395905_0025537 | Ga0395905_0025537_2056_3390 | 435 |
| 378 | 3300046453 | Ga0495627_000247 | Ga0495627_000247_53389_54723 | 435 |
| 379 | 3300046453 | Ga0495627_018772 | Ga0495627_018772_285_1616 | 435 |
| 380 | 3300046460 | Ga0495638_0015616 | Ga0495638_0015616_314_1648 | 435 |
| 381 | 3300046460 | Ga0495638_0043249 | Ga0495638_0043249_471_1793 | 435 |
| 382 | 3300046460 | Ga0495638_0066858 | Ga0495638_0066858_553_1887 | 435 |
| 383 | 3300046463 | Ga0495653_0039936 | Ga0495653_0039936_1063_2394 | 435 |
| 384 | 3300046471 | Ga0495650_0010129 | Ga0495650_0010129_1815_3149 | 435 |
| 385 | 3300046474 | Ga0495605_0000307 | Ga0495605_0000307_16219_17553 | 435 |
| 386 | 3300046474 | Ga0495605_0029247 | Ga0495605_0029247_300_1634 | 435 |
| 387 | 3300046491 | Ga0495584_0000762 | Ga0495584_0000762_5758_7089 | 435 |
| 388 | 3300046491 | Ga0495584_0002453 | Ga0495584_0002453_7595_8929 | 435 |
| 389 | 3300046491 | Ga0495584_0003217 | Ga0495584_0003217_6554_7885 | 435 |
| 390 | 3300046491 | Ga0495584_0003805 | Ga0495584_0003805_1876_3207 | 435 |
| 391 | 3300046491 | Ga0495584_0020747 | Ga0495584_0020747_985_2316 | 435 |
| 392 | 3300046492 | Ga0495585_0000148 | Ga0495585_0000148_61003_62334 | 435 |
| 393 | 3300046492 | Ga0495585_0000613 | Ga0495585_0000613_12821_14152 | 435 |
| 394 | 3300046492 | Ga0495585_0001019 | Ga0495585_0001019_5213_6544 | 435 |
| 395 | 3300046492 | Ga0495585_0001344 | Ga0495585_0001344_5051_6382 | 435 |
| 396 | 3300046492 | Ga0495585_0001953 | Ga0495585_0001953_13610_14944 | 435 |
| 397 | 3300046492 | Ga0495585_0004701 | Ga0495585_0004701_5183_6514 | 435 |
| 398 | 3300046492 | Ga0495585_0014629 | Ga0495585_0014629_1081_2412 | 435 |
| 399 | 3300046492 | Ga0495585_0020438 | Ga0495585_0020438_2289_3623 | 435 |
| 400 | 3300046492 | Ga0495585_0028325 | Ga0495585_0028325_1683_3014 | 435 |
| 401 | 3300046492 | Ga0495585_0042845 | Ga0495585_0042845_645_1979 | 435 |
| 402 | 3300046492 | Ga0495585_0051478 | Ga0495585_0051478_737_2068 | 435 |
| 403 | 3300046500 | Ga0495596_0000778 | Ga0495596_0000778_17553_18899 | 435 |
| 404 | 3300046500 | Ga0495596_0001117 | Ga0495596_0001117_1379_2710 | 435 |
| 405 | 3300046500 | Ga0495596_0001924 | Ga0495596_0001924_8389_9720 | 435 |
| 406 | 3300046500 | Ga0495596_0026250 | Ga0495596_0026250_389_1723 | 435 |
| 407 | 3300046500 | Ga0495596_0038172 | Ga0495596_0038172_58_1392 | 435 |
| 408 | 3300046501 | Ga0495607_0001816 | Ga0495607_0001816_15357_16694 | 435 |
| 409 | 3300046501 | Ga0495607_0002875 | Ga0495607_0002875_7747_9081 | 435 |
| 410 | 3300046501 | Ga0495607_0060321 | Ga0495607_0060321_451_1785 | 435 |
| 411 | 3300046506 | Ga0495583_0000268 | Ga0495583_0000268_16729_18060 | 435 |
| 412 | 3300046506 | Ga0495583_0028051 | Ga0495583_0028051_1132_2463 | 435 |
| 413 | 3300046506 | Ga0495583_0040003 | Ga0495583_0040003_138_1472 | 435 |
| 414 | 3300046507 | Ga0495606_0036811 | Ga0495606_0036811_702_2042 | 435 |
| 415 | 3300046507 | Ga0495606_0083969 | Ga0495606_0083969_290_1621 | 435 |
| 416 | 3300046513 | Ga0495616_0000052 | Ga0495616_0000052_4353_5681 | 435 |
| 417 | 3300046513 | Ga0495616_0000817 | Ga0495616_0000817_1916_3250 | 435 |
| 418 | 3300046513 | Ga0495616_0003103 | Ga0495616_0003103_8331_9662 | 435 |
| 419 | 3300046513 | Ga0495616_0019920 | Ga0495616_0019920_937_2271 | 435 |
| 420 | 3300046513 | Ga0495616_0020953 | Ga0495616_0020953_1368_2702 | 435 |
| 421 | 3300046518 | Ga0495631_0000673 | Ga0495631_0000673_5966_7300 | 435 |
| 422 | 3300046518 | Ga0495631_0003570 | Ga0495631_0003570_1096_2430 | 435 |
| 423 | 3300046518 | Ga0495631_0006929 | Ga0495631_0006929_259_1593 | 435 |
| 424 | 3300046518 | Ga0495631_0012413 | Ga0495631_0012413_1446_2777 | 435 |
| 425 | 3300046518 | Ga0495631_0021505 | Ga0495631_0021505_618_1949 | 435 |
| 426 | 3300046518 | Ga0495631_0027394 | Ga0495631_0027394_382_1713 | 435 |
| 427 | 3300046518 | Ga0495631_0039044 | Ga0495631_0039044_444_1778 | 435 |
| 428 | 3300046519 | Ga0495632_0000260 | Ga0495632_0000260_44148_45482 | 435 |
| 429 | 3300046519 | Ga0495632_0000887 | Ga0495632_0000887_11495_12829 | 435 |
| 430 | 3300046519 | Ga0495632_0001388 | Ga0495632_0001388_14411_15742 | 435 |
| 431 | 3300046519 | Ga0495632_0001906 | Ga0495632_0001906_15241_16578 | 435 |
| 432 | 3300046519 | Ga0495632_0021241 | Ga0495632_0021241_593_1930 | 435 |
| 433 | 3300046520 | Ga0495637_0045539 | Ga0495637_0045539_422_1756 | 435 |
| 434 | 3300046522 | Ga0495643_0005190 | Ga0495643_0005190_7107_8438 | 435 |
| 435 | 3300046522 | Ga0495643_0021553 | Ga0495643_0021553_785_2122 | 435 |
| 436 | 3300046522 | Ga0495643_0034661 | Ga0495643_0034661_1139_2473 | 435 |
| 437 | 3300046523 | Ga0495644_0005948 | Ga0495644_0005948_401_1735 | 435 |
| 438 | 3300046523 | Ga0495644_0018457 | Ga0495644_0018457_1050_2381 | 435 |
| 439 | 3300046524 | Ga0495648_0000117 | Ga0495648_0000117_68371_69702 | 435 |
| 440 | 3300046524 | Ga0495648_0005389 | Ga0495648_0005389_4216_5550 | 435 |
| 441 | 3300046525 | Ga0495663_0006777 | Ga0495663_0006777_1362_2693 | 435 |
| 442 | 3300046525 | Ga0495663_0020873 | Ga0495663_0020873_397_1728 | 435 |
| 443 | 3300046526 | Ga0495666_0001606 | Ga0495666_0001606_8562_9917 | 435 |
| 444 | 3300046528 | Ga0495642_0000438 | Ga0495642_0000438_16105_17439 | 435 |
| 445 | 3300046528 | Ga0495642_0000657 | Ga0495642_0000657_14988_16322 | 435 |
| 446 | 3300046528 | Ga0495642_0009583 | Ga0495642_0009583_1754_3085 | 435 |
| 447 | 3300046528 | Ga0495642_0030494 | Ga0495642_0030494_162_1484 | 435 |
| 448 | 3300046528 | Ga0495642_0031876 | Ga0495642_0031876_222_1556 | 435 |
| 449 | 3300046530 | Ga0495654_0001281 | Ga0495654_0001281_990_2324 | 435 |
| 450 | 3300046530 | Ga0495654_0001433 | Ga0495654_0001433_14933_16267 | 435 |
| 451 | 3300046530 | Ga0495654_0012235 | Ga0495654_0012235_693_2027 | 435 |
| 452 | 3300046531 | Ga0495665_0003893 | Ga0495665_0003893_6014_7348 | 435 |
| 453 | 3300046531 | Ga0495665_0018236 | Ga0495665_0018236_39_1394 | 435 |
| 454 | 3300046535 | Ga0495586_0001789 | Ga0495586_0001789_3917_5257 | 435 |
| 455 | 3300046535 | Ga0495586_0021527 | Ga0495586_0021527_529_1863 | 435 |
| 456 | 3300046538 | Ga0495609_0001706 | Ga0495609_0001706_6632_7966 | 435 |
| 457 | 3300046538 | Ga0495609_0004384 | Ga0495609_0004384_416_1747 | 435 |
| 458 | 3300046538 | Ga0495609_0008429 | Ga0495609_0008429_1290_2630 | 435 |
| 459 | 3300046538 | Ga0495609_0014166 | Ga0495609_0014166_159_1490 | 435 |
| 460 | 3300046538 | Ga0495609_0020110 | Ga0495609_0020110_1021_2352 | 435 |
| 461 | 3300046542 | Ga0495597_0002300 | Ga0495597_0002300_5005_6339 | 435 |
| 462 | 3300046542 | Ga0495597_0002834 | Ga0495597_0002834_3044_4378 | 435 |
| 463 | 3300046542 | Ga0495597_0010739 | Ga0495597_0010739_1484_2815 | 435 |
| 464 | 3300046542 | Ga0495597_0023534 | Ga0495597_0023534_1077_2408 | 435 |
| 465 | 3300046542 | Ga0495597_0028110 | Ga0495597_0028110_243_1577 | 435 |
| 466 | 3300046557 | Ga0495622_0002273 | Ga0495622_0002273_1314_2648 | 435 |
| 467 | 3300046557 | Ga0495622_0004624 | Ga0495622_0004624_1221_2555 | 435 |
| 468 | 3300046557 | Ga0495622_0008654 | Ga0495622_0008654_2511_3845 | 435 |
| 469 | 3300046558 | Ga0495633_0001933 | Ga0495633_0001933_12061_13392 | 435 |
| 470 | 3300046558 | Ga0495633_0012332 | Ga0495633_0012332_1336_2667 | 435 |
| 471 | 3300046558 | Ga0495633_0021914 | Ga0495633_0021914_1671_3002 | 435 |
| 472 | 3300046615 | Ga0495656_0003684 | Ga0495656_0003684_3304_4635 | 435 |
| 473 | 3300046615 | Ga0495656_0017064 | Ga0495656_0017064_264_1595 | 435 |
| 474 | 3300046616 | Ga0495668_0000768 | Ga0495668_0000768_15140_16474 | 435 |
| 475 | 3300046616 | Ga0495668_0002938 | Ga0495668_0002938_1592_2923 | 435 |
| 476 | 3300046616 | Ga0495668_0006624 | Ga0495668_0006624_1679_3010 | 435 |
| 477 | 3300046616 | Ga0495668_0007764 | Ga0495668_0007764_4554_5888 | 435 |
| 478 | 3300046616 | Ga0495668_0023799 | Ga0495668_0023799_1579_2913 | 435 |
| 479 | 3300046616 | Ga0495668_0024715 | Ga0495668_0024715_1849_3171 | 435 |
| 480 | 3300046616 | Ga0495668_0041180 | Ga0495668_0041180_480_1811 | 435 |
| 481 | 3300046648 | Ga0495611_0005434 | Ga0495611_0005434_3398_4729 | 435 |
| 482 | 3300046660 | Ga0495625_0001449 | Ga0495625_0001449_25837_27159 | 435 |
| 483 | 3300046660 | Ga0495625_0010265 | Ga0495625_0010265_13_1347 | 435 |
| 484 | 3300046660 | Ga0495625_0013090 | Ga0495625_0013090_1055_2389 | 435 |
| 485 | 3300046665 | Ga0495661_0000932 | Ga0495661_0000932_10151_11485 | 435 |
| 486 | 3300046665 | Ga0495661_0002284 | Ga0495661_0002284_6421_7755 | 435 |
| 487 | 3300046665 | Ga0495661_0003893 | Ga0495661_0003893_971_2302 | 435 |
| 488 | 3300046665 | Ga0495661_0004318 | Ga0495661_0004318_1583_2920 | 435 |
| 489 | 3300046665 | Ga0495661_0023638 | Ga0495661_0023638_1320_2654 | 435 |
| 490 | 3300046665 | Ga0495661_0042382 | Ga0495661_0042382_605_1936 | 435 |
| 491 | 3300046665 | Ga0495661_0043966 | Ga0495661_0043966_565_1896 | 435 |
| 492 | 3300046665 | Ga0495661_0091422 | Ga0495661_0091422_338_1669 | 435 |
| 493 | 3300046674 | Ga0495588_0019718 | Ga0495588_0019718_1447_2781 | 435 |
| 494 | 3300046674 | Ga0495588_0033810 | Ga0495588_0033810_149_1483 | 435 |
| 495 | 3300046679 | Ga0495623_0036973 | Ga0495623_0036973_1630_2964 | 435 |
| 496 | 3300046679 | Ga0495623_0055002 | Ga0495623_0055002_929_2272 | 435 |
| 497 | 3300046684 | Ga0495669_0000218 | Ga0495669_0000218_960_2306 | 435 |
| 498 | 3300046684 | Ga0495669_0002436 | Ga0495669_0002436_87_1409 | 435 |
| 499 | 3300046690 | Ga0495624_0074815 | Ga0495624_0074815_201_1535 | 435 |
| 500 | 3300046691 | Ga0495670_0001954 | Ga0495670_0001954_1154_2485 | 435 |
| 501 | 3300046691 | Ga0495670_0002681 | Ga0495670_0002681_1241_2572 | 435 |
| 502 | 3300046692 | Ga0495671_0000358 | Ga0495671_0000358_15857_17191 | 435 |
| 503 | 3300046692 | Ga0495671_0018039 | Ga0495671_0018039_549_1925 | 435 |
| 504 | 3300046692 | Ga0495671_0018164 | Ga0495671_0018164_197_1531 | 435 |
| 505 | 3300046692 | Ga0495671_0037569 | Ga0495671_0037569_357_1688 | 435 |
| 506 | 3300046694 | Ga0495649_0004762 | Ga0495649_0004762_6334_7656 | 435 |
| 507 | 3300046694 | Ga0495649_0007589 | Ga0495649_0007589_4482_5819 | 435 |
| 508 | 3300046794 | Ga0495589_0000712 | Ga0495589_0000712_5205_6539 | 435 |
| 509 | 3300046794 | Ga0495589_0022273 | Ga0495589_0022273_1366_2700 | 435 |
| 510 | 3300046810 | Ga0495660_0001770 | Ga0495660_0001770_7736_9076 | 435 |
| 511 | 3300046810 | Ga0495660_0003899 | Ga0495660_0003899_2555_3889 | 435 |
| 512 | 3300046810 | Ga0495660_0024655 | Ga0495660_0024655_185_1519 | 435 |
| 513 | 3300046810 | Ga0495660_0027227 | Ga0495660_0027227_1222_2544 | 435 |
| 514 | 3300047315 | Ga0495581_0073341 | Ga0495581_0073341_87_1421 | 435 |
| 515 | 3300047317 | Ga0495604_0040259 | Ga0495604_0040259_623_1957 | 435 |
| 516 | 3300047317 | Ga0495604_0074502 | Ga0495604_0074502_887_2242 | 435 |
| 517 | 3300047317 | Ga0495604_0160270 | Ga0495604_0160270_36_1370 | 435 |
| 518 | 3300047318 | Ga0495636_0013453 | Ga0495636_0013453_743_2074 | 435 |
| 519 | 3300047319 | Ga0495674_0102129 | Ga0495674_0102129_86_1420 | 435 |
| 520 | 3300047320 | Ga0495672_0002295 | Ga0495672_0002295_1278_2612 | 435 |
| 521 | 3300047320 | Ga0495672_0003282 | Ga0495672_0003282_6338_7672 | 435 |
| 522 | 3300047321 | Ga0495676_0000034 | Ga0495676_0000034_15702_17036 | 435 |
| 523 | 3300047321 | Ga0495676_0092812 | Ga0495676_0092812_212_1543 | 435 |
| 524 | 3300047322 | Ga0495680_0005270 | Ga0495680_0005270_796_2136 | 435 |
| 525 | 3300047323 | Ga0495683_0000275 | Ga0495683_0000275_27877_29208 | 435 |
| 526 | 3300047323 | Ga0495683_0003535 | Ga0495683_0003535_1387_2718 | 435 |
| 527 | 3300047323 | Ga0495683_0039375 | Ga0495683_0039375_85_1416 | 435 |
| 528 | 3300047443 | Ga0495687_000060 | Ga0495687_000060_146684_148018 | 435 |
| 529 | 3300047443 | Ga0495687_000410 | Ga0495687_000410_36810_38144 | 435 |
| 530 | 3300047443 | Ga0495687_019355 | Ga0495687_019355_1105_2436 | 435 |
| 531 | 3300047444 | Ga0495675_0087793 | Ga0495675_0087793_273_1604 | 435 |
| 532 | 3300047445 | Ga0495677_0001363 | Ga0495677_0001363_18_1355 | 435 |
| 533 | 3300047445 | Ga0495677_0033768 | Ga0495677_0033768_162_1484 | 435 |
| 534 | 3300047445 | Ga0495677_0050226 | Ga0495677_0050226_71_1405 | 435 |
| 535 | 3300047446 | Ga0495679_002389 | Ga0495679_002389_2868_4202 | 435 |
| 536 | 3300047446 | Ga0495679_004610 | Ga0495679_004610_4073_5395 | 435 |
| 537 | 3300047447 | Ga0495685_000383 | Ga0495685_000383_666_2000 | 435 |
| 538 | 3300047447 | Ga0495685_006840 | Ga0495685_006840_1456_2787 | 435 |
| 539 | 3300047469 | Ga0495673_0010194 | Ga0495673_0010194_3236_4567 | 435 |
| 540 | 3300047470 | Ga0495681_0001235 | Ga0495681_0001235_920_2254 | 435 |
| 541 | 3300047470 | Ga0495681_0003816 | Ga0495681_0003816_1867_3189 | 435 |
| 542 | 3300047470 | Ga0495681_0010086 | Ga0495681_0010086_2439_3773 | 435 |
| 543 | 3300047470 | Ga0495681_0017378 | Ga0495681_0017378_1298_2629 | 435 |
| 544 | 3300047470 | Ga0495681_0024463 | Ga0495681_0024463_322_1653 | 435 |
| 545 | 3300047472 | Ga0495686_0001783 | Ga0495686_0001783_1721_3043 | 435 |
| 546 | 3300047472 | Ga0495686_0004197 | Ga0495686_0004197_8732_10072 | 435 |
| 547 | 3300047673 | Ga0495593_0012675 | Ga0495593_0012675_2024_3358 | 435 |
| 548 | 3300048089 | Ga0495614_0004953 | Ga0495614_0004953_3687_5021 | 435 |
| 549 | 3300048090 | Ga0495615_0000815 | Ga0495615_0000815_332_1663 | 435 |
| 550 | 3300048091 | Ga0495626_0000044 | Ga0495626_0000044_62238_63569 | 435 |
| 551 | 3300048091 | Ga0495626_0004212 | Ga0495626_0004212_18_1349 | 435 |
| 552 | 3300048091 | Ga0495626_0015575 | Ga0495626_0015575_1342_2703 | 435 |
| 553 | 3300048091 | Ga0495626_0019590 | Ga0495626_0019590_536_1867 | 435 |
| 554 | 3300048091 | Ga0495626_0029263 | Ga0495626_0029263_985_2319 | 435 |
| 555 | 3300048091 | Ga0495626_0031582 | Ga0495626_0031582_859_2190 | 435 |
| 556 | 3300048091 | Ga0495626_0037913 | Ga0495626_0037913_109_1446 | 435 |
| 557 | 3300048091 | Ga0495626_0040214 | Ga0495626_0040214_347_1684 | 435 |
| 558 | 3300048091 | Ga0495626_0054725 | Ga0495626_0054725_344_1681 | 435 |
| 559 | 3300048903 | Ga0496100_0008941 | Ga0496100_0008941_3644_4978 | 435 |
| 560 | 3300048904 | Ga0496101_0026051 | Ga0496101_0026051_428_1762 | 435 |
| 561 | 3300048905 | Ga0496102_0000192 | Ga0496102_0000192_30407_31735 | 435 |
| 562 | 3300048905 | Ga0496102_0001818 | Ga0496102_0001818_11414_12748 | 435 |
| 563 | 3300048905 | Ga0496102_0098690 | Ga0496102_0098690_1197_2528 | 435 |
| 564 | 3300048905 | Ga0496102_0112583 | Ga0496102_0112583_719_2053 | 435 |
| 565 | 3300048906 | Ga0496103_0002975 | Ga0496103_0002975_6410_7738 | 435 |
| 566 | 3300048906 | Ga0496103_0042689 | Ga0496103_0042689_1248_2582 | 435 |
| 567 | 3300048913 | Ga0496110_0005159 | Ga0496110_0005159_6965_8299 | 435 |
| 568 | 3300048916 | Ga0496113_0145259 | Ga0496113_0145259_25_1359 | 435 |
| 569 | 3300048925 | Ga0496122_0003307 | Ga0496122_0003307_3720_5054 | 435 |
| 570 | 3300048926 | Ga0496123_0000905 | Ga0496123_0000905_29127_30461 | 435 |
| 571 | 3300048928 | Ga0496125_0002954 | Ga0496125_0002954_3911_5245 | 435 |
| 572 | 3300049459 | Ga0495678_002016 | Ga0495678_002016_1907_3241 | 435 |
| 573 | 3300049460 | Ga0495682_0020688 | Ga0495682_0020688_540_1871 | 435 |
| 574 | 3300002739 | JGI25158J39367_1001321 | JGI25158J39367_10013212 | 438 |
| 575 | 3300002773 | JGI25152J39213_1000263 | JGI25152J39213_100026320 | 438 |
| 576 | 3300002774 | JGI25150J39212_1000764 | JGI25150J39212_10007644 | 438 |
| 577 | 3300003215 | JGI25153J46596_10000821 | JGI25153J46596_1000082110 | 438 |
| 578 | 3300003374 | JGI25161J50226_1002622 | JGI25161J50226_10026224 | 438 |
| 579 | 3300003771 | Ga0055526_1003162 | Ga0055526_10031625 | 438 |
| 580 | 3300003773 | Ga0055537_1004883 | Ga0055537_10048832 | 438 |
| 581 | 3300003775 | Ga0055524_1001343 | Ga0055524_100134310 | 438 |
| 582 | 3300003775 | Ga0055524_1004326 | Ga0055524_10043264 | 438 |
| 583 | 3300003791 | Ga0055530_10007411 | Ga0055530_100074114 | 438 |
| 584 | 3300004625 | Ga0055543_1003202 | Ga0055543_10032024 | 438 |
| 585 | 3300005262 | Ga0065165_1008156 | Ga0065165_10081563 | 438 |
| 586 | 3300025208 | Ga0209436_100496 | Ga0209436_1004964 | 438 |
| 587 | 3300025245 | Ga0207425_1000006 | Ga0207425_1000006666 | 438 |
| 588 | 3300025258 | Ga0209129_1000009 | Ga0209129_1000009495 | 438 |
| 589 | 3300025263 | Ga0209565_1010193 | Ga0209565_10101932 | 438 |
| 590 | 3300025284 | Ga0209130_1001753 | Ga0209130_10017536 | 438 |
| 591 | 3300025291 | Ga0209675_1003337 | Ga0209675_10033376 | 438 |
| 592 | 3300025295 | Ga0209564_1000098 | Ga0209564_1000098129 | 438 |
| 593 | 3300025295 | Ga0209564_1017469 | Ga0209564_10174692 | 438 |
| 594 | 3300025297 | Ga0209758_1000071 | Ga0209758_1000071159 | 438 |
| 595 | 3300025298 | Ga0209050_1000731 | Ga0209050_100073137 | 438 |
| 596 | 3300025299 | Ga0209256_1001594 | Ga0209256_100159420 | 438 |
| 597 | 3300025299 | Ga0209256_1002381 | Ga0209256_10023814 | 438 |
| 598 | 3300031548 | Ga0307408_100006870 | Ga0307408_1000068704 | 438 |
| 599 | 3300031548 | Ga0307408_100013254 | Ga0307408_1000132543 | 438 |
| 600 | 3300032002 | Ga0307416_100060623 | Ga0307416_1000606232 | 438 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wze-assembly1.cif.gz_C | the structure of pseudomonas aeruginosa aminopeptidase pepp | 0.9357 | 1 | 437 |
| 1jaw-assembly1.cif.gz_A | aminopeptidase p from e. coli low ph form | 0.9352 | 2 | 437 |
| 2bwu-assembly1.cif.gz_A | asp271ala escherichia coli aminopeptidase p | 0.93 | 2 | 437 |
| 2bwt-assembly1.cif.gz_A | asp260ala escherichia coli aminopeptidase p | 0.9296 | 2 | 437 |
| 2bww-assembly1.cif.gz_A | his350ala escherichia coli aminopeptidase p | 0.9294 | 2 | 437 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CSP6_205_383_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9661 | 171 | 344 | 3.90.230.10 |
| 4pv4A02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9628 | 169 | 437 | 3.90.230.10 |
| 3ig4F02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9574 | 171 | 436 | 3.90.230.10 |
| af_Q9NQH7_247_507_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9485 | 171 | 437 | 3.90.230.10 |
| 4pv4A02 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9485 | 169 | 437 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1SPG2-F1-model_v4 | Xaa-Pro aminopeptidase (EC 3.4.11.9) | 0.9855 | 203 | 381 |
GO:0004177
GO:0005829 GO:0006508 GO:0046872 |
| AF-A0A521PJ32-F1-model_v4 | Xaa-Pro aminopeptidase (EC 3.4.11.9) | 0.9853 | 217 | 437 |
GO:0004177
GO:0005829 GO:0006508 GO:0046872 |
| AF-A0A7Y7AV82-F1-model_v4 | deleted | 0.981 | 250 | 437 |
|
| AF-A0A3M2BWW8-F1-model_v4 | Xaa-Pro aminopeptidase (EC 3.4.11.9) | 0.9776 | 214 | 435 |
GO:0004177
GO:0005829 GO:0006508 GO:0008235 |
| AF-A0A800EEM3-F1-model_v4 | deleted | 0.9773 | 266 | 434 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar