F468013

General Info

Members Datasets Scaffolds Average Seq Length
600 313 587 440

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0018039|Ga0495671_0018039_549_1925
Length 458
Sequence MSPYAERRARLMAQMEPGSVAVIATAPEVLRNGDSDYPYRHDSSFYYLTGFTEPEAVLLLVAGRGTSQPQSILFCREKNIEHEIWEGYRYGPEAARAEFGLDFAYPIGQLDEHMTRQLANASALYCSLARNTTLDAQVMRWLESVRRMARSGVTAPSSVRDLLPLIDEMRLLKDEGEQATMLRAGEIAGGAHERAMRAARPGMFEYEIEAELLYEFRRHGAQFPAYTPIVASGANACVLHYNSNNRQTQDGDLVLIDAGCELNGYASDITRTFPVNGKFSGPQRALYDLVLASQDASAAATKAGNRFTDPHDAAVRVLAQGMLDFGLLDANKVGSVDDVIDSRAYFQFYMHRTGHWLGMDVHDCGSYVEPTQVGEVSERKDPLSNELIKNRPSRILQPGMVLTLEPGIYVRPADGVPAQFHNIGIRIEDDAIVTSTGCELISRGVPVKADEIEALMRA

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543030 Massilia sp. GV097 Isolate Unclassified
11 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
12 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
13 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
271 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 0.33
Rhizoplane 2.67
Rhizosphere 83.17
Stem 0
Stem Tuber 0
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001321 3300002739 Bacteria 4399
2 JGI25152J39213_1000263 3300002773 Bacteria 35142
3 JGI25150J39212_1000764 3300002774 Bacteria 11096
4 JGI25159J45721_1000645 3300002987 Bacteria 15469
5 JGI25153J46596_10000821 3300003215 Bacteria 18951
6 rootL2_10018597 3300003322 Bacteria 4294
7 JGI25161J50226_1002622 3300003374 Bacteria 4514
8 Ga0055525_1000081 3300003759 Bacteria 161329
9 Ga0055526_1003162 3300003771 Bacteria 10670
10 Ga0055526_1003633 3300003771 Bacteria 9660
11 Ga0055526_1011821 3300003771 Bacteria 3877
12 Ga0055537_1000128 3300003773 Bacteria 58218
13 Ga0055537_1004883 3300003773 Bacteria 3716
14 Ga0055524_1000026 3300003775 Bacteria 214653
15 Ga0055524_1001343 3300003775 Bacteria 14339
16 Ga0055524_1002841 3300003775 Bacteria 8681
17 Ga0055524_1004326 3300003775 Bacteria 6583
18 Ga0055524_1030565 3300003775 Bacteria 1567
19 Ga0055534_1000120 3300003784 Bacteria 57897
20 Ga0055534_1003227 3300003784 Bacteria 5234
21 Ga0055528_1000069 3300003790 Bacteria 83002
22 Ga0055528_1009531 3300003790 Bacteria 4045
23 Ga0055530_10007411 3300003791 Bacteria 4630
24 Ga0055531_10007725 3300003794 Bacteria 5806
25 Ga0055531_10012841 3300003794 Bacteria 3904
26 Ga0055543_1003202 3300004625 Bacteria 4978
27 Ga0055543_1007174 3300004625 Bacteria 2603
28 Ga0065165_1000067 3300005262 Bacteria 170811
29 Ga0065165_1008156 3300005262 Bacteria 4978
30 Ga0065165_1027766 3300005262 Bacteria 1838
31 Ga0070658_10105090 3300005327 Bacteria 2336
32 Ga0070690_100002693 3300005330 Bacteria 9580
33 Ga0070670_100000420 3300005331 Bacteria 34942
34 Ga0068869_100000049 3300005334 Bacteria 50658
35 Ga0068869_100002298 3300005334 Bacteria 11499
36 Ga0070666_10027648 3300005335 Bacteria 3717
37 Ga0070680_100003537 3300005336 Bacteria 11657
38 Ga0070680_100016773 3300005336 Bacteria 5764
39 Ga0068868_100000341 3300005338 Bacteria 31563
40 Ga0068868_100000481 3300005338 Bacteria 26493
41 Ga0070660_100055058 3300005339 Bacteria 3073
42 Ga0070660_100071518 3300005339 Bacteria 2708
43 Ga0070689_100003497 3300005340 Bacteria 10451
44 Ga0070689_100027300 3300005340 Bacteria 4303
45 Ga0070691_10000934 3300005341 Bacteria 11862
46 Ga0070687_100000369 3300005343 Bacteria 15363
47 Ga0070692_10000874 3300005345 Bacteria 10149
48 Ga0070675_100011753 3300005354 Bacteria 6857
49 Ga0070671_100000233 3300005355 Bacteria 37258
50 Ga0070674_100150105 3300005356 Bacteria 1758
51 Ga0070673_100034846 3300005364 Bacteria 3814
52 Ga0070659_100072178 3300005366 Bacteria 2746
53 Ga0070701_10000173 3300005438 Bacteria 20020
54 Ga0070705_100002026 3300005440 Bacteria 10362
55 Ga0070694_100000045 3300005444 Bacteria 57135
56 Ga0070694_100024371 3300005444 Bacteria 3905
57 Ga0070708_100182284 3300005445 Bacteria 1963
58 Ga0068867_100004883 3300005459 Bacteria 9437
59 Ga0070707_100224731 3300005468 Bacteria 1828
60 Ga0070698_100018197 3300005471 Bacteria 7398
61 Ga0070684_100002834 3300005535 Bacteria 12880
62 Ga0070686_100054240 3300005544 Bacteria 2563
63 Ga0070695_100000126 3300005545 Bacteria 34457
64 Ga0070695_100043879 3300005545 Bacteria 2844
65 Ga0070696_100003057 3300005546 Bacteria 11117
66 Ga0070693_100000731 3300005547 Bacteria 14461
67 Ga0070704_100000195 3300005549 Bacteria 24991
68 Ga0070704_100000303 3300005549 Bacteria 21834
69 Ga0068855_100007080 3300005563 Bacteria 13604
70 Ga0068855_100021589 3300005563 Bacteria 7721
71 Ga0070664_100052561 3300005564 Bacteria 3452
72 Ga0068854_100003263 3300005578 Bacteria 10104
73 Ga0068856_100015746 3300005614 Bacteria 7311
74 Ga0070702_100000019 3300005615 Bacteria 46900
75 Ga0068852_100004168 3300005616 Bacteria 10185
76 Ga0068859_100111961 3300005617 Bacteria 2793
77 Ga0068864_100079465 3300005618 Bacteria 2872
78 Ga0068866_10001065 3300005718 Bacteria 12079
79 Ga0068861_100002221 3300005719 Bacteria 12602
80 Ga0068851_10019420 3300005834 Bacteria 3284
81 Ga0068863_100012296 3300005841 Bacteria 8263
82 Ga0068858_100000751 3300005842 Bacteria 33969
83 Ga0068860_100005413 3300005843 Bacteria 12953
84 Ga0068860_100118453 3300005843 Bacteria 2535
85 Ga0068862_100005525 3300005844 Bacteria 10561
86 Ga0081539_10000226 3300005985 Bacteria 132618
87 Ga0070715_10066419 3300006163 Bacteria 1599
88 Ga0097621_100002059 3300006237 Bacteria 13752
89 Ga0097621_100026445 3300006237 Bacteria 4552
90 Ga0068871_100003308 3300006358 Bacteria 11060
91 Ga0075428_100002204 3300006844 Bacteria 21090
92 Ga0075430_100028919 3300006846 Bacteria 4705
93 Ga0075431_100039747 3300006847 Bacteria 4847
94 Ga0075433_10001856 3300006852 Bacteria 15871
95 Ga0075433_10108451 3300006852 Bacteria 2463
96 Ga0075434_100001295 3300006871 Bacteria 20857
97 Ga0075434_100081623 3300006871 Bacteria 3231
98 Ga0075429_100000015 3300006880 Bacteria 78823
99 Ga0075429_100000143 3300006880 Bacteria 43584
100 Ga0068865_100001242 3300006881 Bacteria 14825
101 Ga0075436_100000475 3300006914 Bacteria 26074
102 Ga0075436_100073466 3300006914 Bacteria 2367
103 Ga0097620_100111962 3300006931 Bacteria 2793
104 Ga0099826_10000003 3300006948 Bacteria 1067817
105 Ga0075435_100000811 3300007076 Bacteria 19470
106 Ga0075435_100001385 3300007076 Bacteria 15654
107 Ga0075435_100018574 3300007076 Bacteria 5293
108 Ga0111539_10020073 3300009094 Bacteria 8232
109 Ga0111539_10064434 3300009094 Bacteria 4335
110 Ga0105245_10005835 3300009098 Bacteria 10810
111 Ga0114129_10001740 3300009147 Bacteria 29637
112 Ga0114129_10049912 3300009147 Bacteria 5878
113 Ga0105243_10004530 3300009148 Bacteria 10982
114 Ga0105243_10076465 3300009148 Bacteria 2720
115 Ga0105243_10082673 3300009148 Bacteria 2625
116 Ga0105241_10014386 3300009174 Bacteria 5794
117 Ga0105242_10020708 3300009176 Bacteria 5158
118 Ga0105242_10141356 3300009176 Bacteria 2089
119 Ga0105238_10175054 3300009551 Bacteria 2122
120 Ga0157374_10079072 3300013296 Bacteria 3115
121 Ga0157378_10000579 3300013297 Bacteria 34490
122 Ga0163162_10380998 3300013306 Bacteria 1544
123 Ga0157375_10001103 3300013308 Bacteria 23426
124 Ga0157380_10266469 3300014326 Bacteria 1559
125 Ga0157376_10007532 3300014969 Bacteria 7780
126 Ga0209436_100496 3300025208 Bacteria 17304
127 Ga0209436_101174 3300025208 Bacteria 9642
128 Ga0209563_100015 3300025230 Bacteria 879901
129 Ga0207425_1000006 3300025245 Bacteria 808854
130 Ga0207425_1000531 3300025245 Bacteria 23148
131 Ga0209148_1000413 3300025254 Bacteria 48939
132 Ga0209129_1000009 3300025258 Bacteria 633100
133 Ga0209565_1000006 3300025263 Bacteria 897294
134 Ga0209565_1000163 3300025263 Bacteria 87185
135 Ga0209565_1000562 3300025263 Bacteria 25566
136 Ga0209565_1000674 3300025263 Bacteria 21593
137 Ga0209565_1003189 3300025263 Bacteria 5432
138 Ga0209565_1010193 3300025263 Bacteria 2341
139 Ga0209565_1010863 3300025263 Bacteria 2243
140 Ga0209673_1000004 3300025273 Bacteria 896155
141 Ga0209130_1000223 3300025284 Bacteria 74374
142 Ga0209130_1001753 3300025284 Bacteria 12876
143 Ga0209675_1000224 3300025291 Bacteria 57961
144 Ga0209675_1000292 3300025291 Bacteria 46656
145 Ga0209675_1003337 3300025291 Bacteria 7705
146 Ga0209564_1000098 3300025295 Bacteria 228906
147 Ga0209564_1000102 3300025295 Bacteria 222597
148 Ga0209564_1001497 3300025295 Bacteria 23484
149 Ga0209564_1001667 3300025295 Bacteria 21297
150 Ga0209564_1017469 3300025295 Bacteria 2793
151 Ga0209758_1000071 3300025297 Bacteria 283749
152 Ga0209050_1000183 3300025298 Bacteria 142357
153 Ga0209050_1000731 3300025298 Bacteria 47889
154 Ga0209256_1000372 3300025299 Bacteria 71907
155 Ga0209256_1000495 3300025299 Bacteria 57952
156 Ga0209256_1001594 3300025299 Bacteria 22196
157 Ga0209256_1002381 3300025299 Bacteria 15508
158 Ga0209257_1000010 3300025304 Bacteria 1158682
159 Ga0207642_10001096 3300025899 Bacteria 8394
160 Ga0207685_10042791 3300025905 Bacteria 1703
161 Ga0207705_10007248 3300025909 Bacteria 8162
162 Ga0207707_10054759 3300025912 Bacteria 3472
163 Ga0207660_10004091 3300025917 Bacteria 9500
164 Ga0207662_10000049 3300025918 Bacteria 51921
165 Ga0207657_10028630 3300025919 Bacteria 5078
166 Ga0207650_10034709 3300025925 Bacteria 3659
167 Ga0207659_10031167 3300025926 Bacteria 3647
168 Ga0207687_10004654 3300025927 Bacteria 9127
169 Ga0207644_10018061 3300025931 Bacteria 4768
170 Ga0207644_10149854 3300025931 Bacteria 1804
171 Ga0207706_10202715 3300025933 Bacteria 1740
172 Ga0207686_10011152 3300025934 Bacteria 4913
173 Ga0207670_10001257 3300025936 Bacteria 13387
174 Ga0207670_10107355 3300025936 Bacteria 2004
175 Ga0207704_10013921 3300025938 Bacteria 4046
176 Ga0207689_10005474 3300025942 Bacteria 11362
177 Ga0207689_10129476 3300025942 Bacteria 2077
178 Ga0207667_10013470 3300025949 Bacteria 9358
179 Ga0207667_10016028 3300025949 Bacteria 8484
180 Ga0207712_10009645 3300025961 Bacteria 6117
181 Ga0207703_10019959 3300026035 Bacteria 5237
182 Ga0207639_10171155 3300026041 Bacteria 1839
183 Ga0207648_10000265 3300026089 Bacteria 56755
184 Ga0207648_10014180 3300026089 Bacteria 7370
185 Ga0207675_100000182 3300026118 Bacteria 56879
186 Ga0207698_10001809 3300026142 Bacteria 12492
187 Ga0209282_1000002 3300027666 Bacteria 1067825
188 Ga0207428_10001034 3300027907 Bacteria 30690
189 Ga0268265_10004295 3300028380 Bacteria 9943
190 Ga0268264_10006840 3300028381 Bacteria 9575
191 Ga0268264_10065283 3300028381 Bacteria 3066
192 Ga0307408_100006870 3300031548 Bacteria 7543
193 Ga0307408_100013254 3300031548 Bacteria 5471
194 Ga0307408_100019088 3300031548 Bacteria 4613
195 Ga0307408_100031244 3300031548 Bacteria 3707
196 Ga0307408_100164761 3300031548 Bacteria 1764
197 Ga0307518_10007601 3300031838 Bacteria 7755
198 Ga0307416_100060623 3300032002 Bacteria 3082
199 Ga0373930_0013137 3300034816 Bacteria 1522
200 Ga0373934_0012223 3300035086 Bacteria 3241
201 Ga0373940_0004497 3300035088 Bacteria 2949
202 Ga0373944_0023243 3300035089 Bacteria 1807
203 Ga0373923_0009299 3300035111 Bacteria 3543
204 Ga0373932_0003784 3300035112 Bacteria 3608
205 Ga0373936_0009286 3300035113 Bacteria 3704
206 Ga0373939_0002155 3300035114 Bacteria 4673
207 Ga0373945_0004513 3300035116 Bacteria 4424
208 Ga0373960_0024817 3300035121 Bacteria 1625
209 Ga0373943_0025865 3300035170 Bacteria 2745
210 Ga0373955_0013178 3300035172 Bacteria 3989
211 Ga0373942_0004590 3300035207 Bacteria 3204
212 Ga0373924_0016085 3300035410 Bacteria 2853
213 Ga0373931_0000062 3300035691 Bacteria 54491
214 Ga0373931_0013701 3300035691 Bacteria 3952
215 Ga0373931_0023168 3300035691 Bacteria 3134
216 Ga0373935_0026642 3300035692 Bacteria 3570
217 Ga0373933_0001438 3300035724 Bacteria 13917
218 Ga0373933_0007663 3300035724 Bacteria 5894
219 Ga0373933_0062891 3300035724 Bacteria 2243
220 Ga0373937_0003410 3300036401 Bacteria 13337
221 Ga0373937_0009139 3300036401 Bacteria 8599
222 Ga0373937_0250045 3300036401 Bacteria 1671
223 Ga0395899_0030598 3300037312 Bacteria 4048
224 Ga0395900_0000532 3300037418 Bacteria 53751
225 Ga0395900_0010039 3300037418 Bacteria 9687
226 Ga0395900_0020349 3300037418 Bacteria 6773
227 Ga0395900_0070410 3300037418 Bacteria 3595
228 Ga0395900_0070768 3300037418 Bacteria 3585
229 Ga0395900_0266732 3300037418 Bacteria 1708
230 Ga0395898_0023643 3300037466 Bacteria 6206
231 Ga0395898_0068367 3300037466 Bacteria 3437
232 Ga0395898_0157460 3300037466 Bacteria 2172
233 Ga0395905_0025537 3300037471 Bacteria 5571
234 Ga0395905_0032398 3300037471 Bacteria 4915
235 Ga0395905_0042850 3300037471 Bacteria 4246
236 Ga0395901_0000387 3300038443 Bacteria 52634
237 Ga0395901_0003072 3300038443 Bacteria 16814
238 Ga0395901_0136625 3300038443 Bacteria 2576
239 Ga0395901_0209547 3300038443 Bacteria 2040
240 Ga0451853_1159476 3300041512 Bacteria 1588
241 Ga0439441_008716 3300042001 Bacteria 1664
242 Ga0439448_0003230 3300042005 Bacteria 4500
243 Ga0451577_0018812 3300042876 Bacteria 6356
244 Ga0451577_0097648 3300042876 Bacteria 2624
245 Ga0466972_0008353 3300044658 Bacteria 5189
246 Ga0466965_0000667 3300044683 Bacteria 12598
247 Ga0466965_0081054 3300044683 Bacteria 1640
248 Ga0466966_0024006 3300044684 Bacteria 3990
249 Ga0466966_0025591 3300044684 Bacteria 3854
250 Ga0466966_0027270 3300044684 Bacteria 3725
251 Ga0466966_0055391 3300044684 Bacteria 2509
252 Ga0466961_0045812 3300044693 Bacteria 2798
253 Ga0466963_0084919 3300044694 Bacteria 2148
254 Ga0466964_0000392 3300044706 Bacteria 13313
255 Ga0466964_0009938 3300044706 Bacteria 3583
256 Ga0466968_0000256 3300044735 Bacteria 16878
257 Ga0466970_0022088 3300044765 Bacteria 3321
258 Ga0466957_0000388 3300044842 Bacteria 21542
259 Ga0466957_0024097 3300044842 Bacteria 3601
260 Ga0466959_0012486 3300045049 Bacteria 6139
261 Ga0451576_0001787 3300045051 Bacteria 35253
262 Ga0451576_0008064 3300045051 Bacteria 12423
263 Ga0451576_0012002 3300045051 Bacteria 9784
264 Ga0451576_0278373 3300045051 Bacteria 1749
265 Ga0466958_0028127 3300045836 Bacteria 3331
266 Ga0495627_000247 3300046453 Bacteria 56624
267 Ga0495627_018772 3300046453 Bacteria 2326
268 Ga0495592_0009024 3300046454 Bacteria 7493
269 Ga0495603_0011608 3300046455 Bacteria 5329
270 Ga0495603_0040983 3300046455 Bacteria 2770
271 Ga0495629_0018036 3300046459 Bacteria 5058
272 Ga0495638_0015616 3300046460 Bacteria 5097
273 Ga0495638_0043249 3300046460 Bacteria 2842
274 Ga0495638_0066858 3300046460 Bacteria 2208
275 Ga0495653_0039936 3300046463 Bacteria 3672
276 Ga0495650_0010129 3300046471 Bacteria 5287
277 Ga0495580_0006729 3300046472 Bacteria 9331
278 Ga0495582_0010843 3300046473 Bacteria 5015
279 Ga0495605_0000307 3300046474 Bacteria 52199
280 Ga0495605_0000369 3300046474 Bacteria 42654
281 Ga0495605_0029247 3300046474 Bacteria 2838
282 Ga0495639_0012157 3300046475 Bacteria 3711
283 Ga0495662_0013392 3300046476 Bacteria 3991
284 Ga0495662_0047475 3300046476 Bacteria 2072
285 Ga0495584_0000762 3300046491 Bacteria 21279
286 Ga0495584_0002453 3300046491 Bacteria 10518
287 Ga0495584_0003217 3300046491 Bacteria 9068
288 Ga0495584_0003805 3300046491 Bacteria 8210
289 Ga0495584_0016521 3300046491 Bacteria 3763
290 Ga0495584_0020747 3300046491 Bacteria 3337
291 Ga0495585_0000148 3300046492 Bacteria 76376
292 Ga0495585_0000613 3300046492 Bacteria 33250
293 Ga0495585_0001019 3300046492 Bacteria 23308
294 Ga0495585_0001344 3300046492 Bacteria 19505
295 Ga0495585_0001953 3300046492 Bacteria 15407
296 Ga0495585_0004701 3300046492 Bacteria 8798
297 Ga0495585_0009131 3300046492 Bacteria 5968
298 Ga0495585_0014629 3300046492 Bacteria 4566
299 Ga0495585_0020438 3300046492 Bacteria 3808
300 Ga0495585_0028325 3300046492 Bacteria 3195
301 Ga0495585_0028800 3300046492 Bacteria 3164
302 Ga0495585_0042845 3300046492 Bacteria 2533
303 Ga0495585_0051478 3300046492 Bacteria 2282
304 Ga0495596_0000778 3300046500 Bacteria 19414
305 Ga0495596_0000952 3300046500 Bacteria 17275
306 Ga0495596_0001117 3300046500 Bacteria 15863
307 Ga0495596_0001924 3300046500 Bacteria 11506
308 Ga0495596_0026250 3300046500 Bacteria 2348
309 Ga0495596_0038172 3300046500 Bacteria 1899
310 Ga0495607_0001816 3300046501 Bacteria 18209
311 Ga0495607_0002834 3300046501 Bacteria 13765
312 Ga0495607_0002875 3300046501 Bacteria 13606
313 Ga0495607_0060321 3300046501 Bacteria 2159
314 Ga0495583_0000268 3300046506 Bacteria 85709
315 Ga0495583_0000857 3300046506 Bacteria 36987
316 Ga0495583_0005606 3300046506 Bacteria 8460
317 Ga0495583_0028051 3300046506 Bacteria 2772
318 Ga0495583_0040003 3300046506 Bacteria 2205
319 Ga0495606_0036811 3300046507 Bacteria 3329
320 Ga0495606_0051170 3300046507 Bacteria 2696
321 Ga0495606_0083969 3300046507 Bacteria 1973
322 Ga0495608_0004731 3300046511 Bacteria 9740
323 Ga0495616_0000052 3300046513 Bacteria 105258
324 Ga0495616_0000817 3300046513 Bacteria 22704
325 Ga0495616_0003103 3300046513 Bacteria 10753
326 Ga0495616_0019052 3300046513 Bacteria 3751
327 Ga0495616_0019920 3300046513 Bacteria 3655
328 Ga0495616_0020953 3300046513 Bacteria 3549
329 Ga0495616_0031954 3300046513 Bacteria 2753
330 Ga0495618_0023201 3300046514 Bacteria 3835
331 Ga0495628_0007988 3300046516 Bacteria 9116
332 Ga0495630_0001001 3300046517 Bacteria 19663
333 Ga0495631_0000673 3300046518 Bacteria 22036
334 Ga0495631_0003570 3300046518 Bacteria 8498
335 Ga0495631_0006929 3300046518 Bacteria 5808
336 Ga0495631_0012413 3300046518 Bacteria 4160
337 Ga0495631_0021505 3300046518 Bacteria 3004
338 Ga0495631_0027394 3300046518 Bacteria 2608
339 Ga0495631_0039044 3300046518 Bacteria 2108
340 Ga0495632_0000260 3300046519 Bacteria 52561
341 Ga0495632_0000887 3300046519 Bacteria 26268
342 Ga0495632_0001388 3300046519 Bacteria 20299
343 Ga0495632_0001906 3300046519 Bacteria 16686
344 Ga0495632_0021241 3300046519 Bacteria 3501
345 Ga0495637_0045539 3300046520 Bacteria 1860
346 Ga0495643_0000079 3300046522 Bacteria 162735
347 Ga0495643_0005190 3300046522 Bacteria 8884
348 Ga0495643_0014914 3300046522 Bacteria 4608
349 Ga0495643_0021553 3300046522 Bacteria 3695
350 Ga0495643_0034661 3300046522 Bacteria 2784
351 Ga0495644_0005948 3300046523 Bacteria 4756
352 Ga0495644_0018457 3300046523 Bacteria 2665
353 Ga0495648_0000117 3300046524 Bacteria 97341
354 Ga0495648_0005389 3300046524 Bacteria 10636
355 Ga0495663_0006777 3300046525 Bacteria 3159
356 Ga0495663_0020873 3300046525 Bacteria 1882
357 Ga0495666_0001606 3300046526 Bacteria 11122
358 Ga0495666_0006235 3300046526 Bacteria 6007
359 Ga0495642_0000438 3300046528 Bacteria 21966
360 Ga0495642_0000657 3300046528 Bacteria 17307
361 Ga0495642_0002957 3300046528 Bacteria 6770
362 Ga0495642_0009583 3300046528 Bacteria 3706
363 Ga0495642_0030494 3300046528 Bacteria 2157
364 Ga0495642_0031876 3300046528 Bacteria 2114
365 Ga0495642_0051666 3300046528 Bacteria 1691
366 Ga0495652_0089281 3300046529 Bacteria 2524
367 Ga0495654_0001281 3300046530 Bacteria 17634
368 Ga0495654_0001433 3300046530 Bacteria 16412
369 Ga0495654_0012235 3300046530 Bacteria 4614
370 Ga0495665_0003893 3300046531 Bacteria 8078
371 Ga0495665_0018236 3300046531 Bacteria 3772
372 Ga0495665_0027527 3300046531 Bacteria 3051
373 Ga0495640_0004549 3300046533 Bacteria 11056
374 Ga0495586_0001499 3300046535 Bacteria 12886
375 Ga0495586_0001789 3300046535 Bacteria 11753
376 Ga0495586_0002428 3300046535 Bacteria 10100
377 Ga0495586_0021527 3300046535 Bacteria 3437
378 Ga0495587_0024366 3300046536 Bacteria 3710
379 Ga0495598_0000961 3300046537 Bacteria 5558
380 Ga0495609_0000028 3300046538 Bacteria 219908
381 Ga0495609_0001706 3300046538 Bacteria 14244
382 Ga0495609_0004384 3300046538 Bacteria 7743
383 Ga0495609_0008429 3300046538 Bacteria 5050
384 Ga0495609_0014166 3300046538 Bacteria 3754
385 Ga0495609_0020110 3300046538 Bacteria 3085
386 Ga0495597_0002300 3300046542 Bacteria 12402
387 Ga0495597_0002834 3300046542 Bacteria 10618
388 Ga0495597_0010739 3300046542 Bacteria 4463
389 Ga0495597_0023534 3300046542 Bacteria 2848
390 Ga0495597_0028110 3300046542 Bacteria 2575
391 Ga0495645_0099538 3300046543 Bacteria 2068
392 Ga0495622_0002273 3300046557 Bacteria 9341
393 Ga0495622_0004624 3300046557 Bacteria 6375
394 Ga0495622_0008654 3300046557 Bacteria 4716
395 Ga0495622_0058697 3300046557 Bacteria 1782
396 Ga0495633_0001933 3300046558 Bacteria 15072
397 Ga0495633_0008066 3300046558 Bacteria 5983
398 Ga0495633_0012332 3300046558 Bacteria 4552
399 Ga0495633_0021914 3300046558 Bacteria 3189
400 Ga0495667_0010845 3300046559 Bacteria 6160
401 Ga0495667_0141394 3300046559 Bacteria 1551
402 Ga0495656_0002755 3300046615 Bacteria 5879
403 Ga0495656_0003684 3300046615 Bacteria 5200
404 Ga0495656_0010145 3300046615 Bacteria 3414
405 Ga0495656_0017064 3300046615 Bacteria 2764
406 Ga0495668_0000008 3300046616 Bacteria 498364
407 Ga0495668_0000768 3300046616 Bacteria 37462
408 Ga0495668_0002938 3300046616 Bacteria 13450
409 Ga0495668_0006624 3300046616 Bacteria 7553
410 Ga0495668_0007764 3300046616 Bacteria 6805
411 Ga0495668_0023799 3300046616 Bacteria 3488
412 Ga0495668_0024715 3300046616 Bacteria 3416
413 Ga0495668_0041180 3300046616 Bacteria 2574
414 Ga0495634_0011090 3300046642 Bacteria 6573
415 Ga0495611_0005434 3300046648 Bacteria 5447
416 Ga0495625_0001449 3300046660 Bacteria 28796
417 Ga0495625_0010265 3300046660 Bacteria 7763
418 Ga0495625_0013090 3300046660 Bacteria 6682
419 Ga0495625_0013261 3300046660 Bacteria 6631
420 Ga0495635_0163233 3300046663 Bacteria 1516
421 Ga0495659_0000128 3300046664 Bacteria 33389
422 Ga0495659_0036067 3300046664 Bacteria 1745
423 Ga0495661_0000157 3300046665 Bacteria 80637
424 Ga0495661_0000710 3300046665 Bacteria 32881
425 Ga0495661_0000932 3300046665 Bacteria 26643
426 Ga0495661_0002284 3300046665 Bacteria 14824
427 Ga0495661_0003893 3300046665 Bacteria 10910
428 Ga0495661_0004318 3300046665 Bacteria 10295
429 Ga0495661_0023638 3300046665 Bacteria 3986
430 Ga0495661_0042382 3300046665 Bacteria 2806
431 Ga0495661_0043966 3300046665 Bacteria 2741
432 Ga0495661_0072596 3300046665 Bacteria 2007
433 Ga0495661_0091422 3300046665 Bacteria 1730
434 Ga0495588_0000113 3300046674 Bacteria 137279
435 Ga0495588_0006726 3300046674 Bacteria 5196
436 Ga0495588_0019718 3300046674 Bacteria 3307
437 Ga0495588_0033810 3300046674 Bacteria 2584
438 Ga0495599_0015568 3300046678 Bacteria 4721
439 Ga0495623_0036973 3300046679 Bacteria 3127
440 Ga0495623_0055002 3300046679 Bacteria 2510
441 Ga0495658_0011040 3300046683 Bacteria 4531
442 Ga0495669_0000218 3300046684 Bacteria 34510
443 Ga0495669_0002189 3300046684 Bacteria 8019
444 Ga0495669_0002436 3300046684 Bacteria 7605
445 Ga0495613_0006610 3300046689 Bacteria 8666
446 Ga0495624_0074815 3300046690 Bacteria 2103
447 Ga0495670_0001954 3300046691 Bacteria 10144
448 Ga0495670_0002681 3300046691 Bacteria 8785
449 Ga0495671_0000234 3300046692 Bacteria 47760
450 Ga0495671_0000358 3300046692 Bacteria 37933
451 Ga0495671_0018039 3300046692 Bacteria 3753
452 Ga0495671_0018164 3300046692 Bacteria 3734
453 Ga0495671_0037569 3300046692 Bacteria 2448
454 Ga0495649_0004762 3300046694 Bacteria 8797
455 Ga0495649_0007589 3300046694 Bacteria 6594
456 Ga0495649_0044510 3300046694 Bacteria 2423
457 Ga0495589_0000113 3300046794 Bacteria 76949
458 Ga0495589_0000117 3300046794 Bacteria 75549
459 Ga0495589_0000712 3300046794 Bacteria 21540
460 Ga0495589_0022273 3300046794 Bacteria 3233
461 Ga0495600_0004232 3300046809 Bacteria 8571
462 Ga0495660_0001770 3300046810 Bacteria 14302
463 Ga0495660_0003899 3300046810 Bacteria 9116
464 Ga0495660_0006758 3300046810 Bacteria 6767
465 Ga0495660_0024655 3300046810 Bacteria 3425
466 Ga0495660_0027227 3300046810 Bacteria 3235
467 Ga0495581_0020592 3300047315 Bacteria 3827
468 Ga0495581_0073341 3300047315 Bacteria 1980
469 Ga0495604_0027355 3300047317 Bacteria 4536
470 Ga0495604_0040259 3300047317 Bacteria 3670
471 Ga0495604_0074502 3300047317 Bacteria 2558
472 Ga0495604_0160270 3300047317 Bacteria 1590
473 Ga0495636_0004863 3300047318 Bacteria 5261
474 Ga0495636_0013453 3300047318 Bacteria 3248
475 Ga0495674_0008080 3300047319 Bacteria 10042
476 Ga0495674_0102129 3300047319 Bacteria 2439
477 Ga0495672_0000035 3300047320 Bacteria 290329
478 Ga0495672_0000423 3300047320 Bacteria 50688
479 Ga0495672_0002295 3300047320 Bacteria 17743
480 Ga0495672_0003282 3300047320 Bacteria 13998
481 Ga0495676_0000034 3300047321 Bacteria 124977
482 Ga0495676_0019334 3300047321 Bacteria 5992
483 Ga0495676_0092812 3300047321 Bacteria 2252
484 Ga0495680_0005270 3300047322 Bacteria 12208
485 Ga0495680_0021252 3300047322 Bacteria 5436
486 Ga0495683_0000275 3300047323 Bacteria 45085
487 Ga0495683_0003535 3300047323 Bacteria 9096
488 Ga0495683_0035227 3300047323 Bacteria 2544
489 Ga0495683_0039375 3300047323 Bacteria 2389
490 Ga0495687_000054 3300047443 Bacteria 194607
491 Ga0495687_000060 3300047443 Bacteria 179124
492 Ga0495687_000410 3300047443 Bacteria 53080
493 Ga0495687_001251 3300047443 Bacteria 24150
494 Ga0495687_019355 3300047443 Bacteria 3345
495 Ga0495675_0087793 3300047444 Bacteria 1954
496 Ga0495677_0000012 3300047445 Bacteria 146763
497 Ga0495677_0000316 3300047445 Bacteria 20934
498 Ga0495677_0001363 3300047445 Bacteria 9764
499 Ga0495677_0033768 3300047445 Bacteria 1864
500 Ga0495677_0050226 3300047445 Bacteria 1534
501 Ga0495679_002389 3300047446 Bacteria 9596
502 Ga0495679_004610 3300047446 Bacteria 6289
503 Ga0495685_000383 3300047447 Bacteria 13981
504 Ga0495685_006840 3300047447 Bacteria 3752
505 Ga0495673_0010194 3300047469 Bacteria 5132
506 Ga0495681_0001235 3300047470 Bacteria 19424
507 Ga0495681_0003816 3300047470 Bacteria 10432
508 Ga0495681_0010086 3300047470 Bacteria 5747
509 Ga0495681_0017378 3300047470 Bacteria 3995
510 Ga0495681_0024463 3300047470 Bacteria 3181
511 Ga0495686_0001141 3300047472 Bacteria 31302
512 Ga0495686_0001783 3300047472 Bacteria 21899
513 Ga0495686_0004197 3300047472 Bacteria 11961
514 Ga0495686_0023678 3300047472 Bacteria 4046
515 Ga0495593_0012675 3300047673 Bacteria 4814
516 Ga0495614_0004953 3300048089 Bacteria 6009
517 Ga0495615_0000815 3300048090 Bacteria 4375
518 Ga0495626_0000036 3300048091 Bacteria 180464
519 Ga0495626_0000044 3300048091 Bacteria 165533
520 Ga0495626_0001270 3300048091 Bacteria 20653
521 Ga0495626_0004212 3300048091 Bacteria 8907
522 Ga0495626_0015575 3300048091 Bacteria 3888
523 Ga0495626_0019590 3300048091 Bacteria 3383
524 Ga0495626_0029263 3300048091 Bacteria 2666
525 Ga0495626_0031582 3300048091 Bacteria 2547
526 Ga0495626_0037913 3300048091 Bacteria 2288
527 Ga0495626_0040214 3300048091 Bacteria 2209
528 Ga0495626_0054725 3300048091 Bacteria 1831
529 Ga0496100_0008941 3300048903 Bacteria 5602
530 Ga0496101_0026051 3300048904 Bacteria 4063
531 Ga0496102_0000192 3300048905 Bacteria 83166
532 Ga0496102_0001818 3300048905 Bacteria 18420
533 Ga0496102_0098690 3300048905 Bacteria 2710
534 Ga0496102_0112583 3300048905 Bacteria 2538
535 Ga0496103_0002975 3300048906 Bacteria 10494
536 Ga0496103_0042689 3300048906 Bacteria 2791
537 Ga0496104_0084096 3300048907 Bacteria 3036
538 Ga0496108_0007533 3300048911 Bacteria 8823
539 Ga0496109_0038840 3300048912 Bacteria 4306
540 Ga0496110_0000706 3300048913 Bacteria 23078
541 Ga0496110_0005159 3300048913 Bacteria 10211
542 Ga0496113_0015050 3300048916 Bacteria 5300
543 Ga0496113_0145259 3300048916 Bacteria 1868
544 Ga0496114_0045051 3300048917 Bacteria 3663
545 Ga0496122_0003307 3300048925 Bacteria 21338
546 Ga0496122_0003441 3300048925 Bacteria 20818
547 Ga0496122_0041646 3300048925 Bacteria 3627
548 Ga0496123_0000905 3300048926 Bacteria 46722
549 Ga0496123_0007158 3300048926 Bacteria 10593
550 Ga0496124_0002911 3300048927 Bacteria 21581
551 Ga0496124_0007329 3300048927 Bacteria 11751
552 Ga0496125_0002954 3300048928 Bacteria 21370
553 Ga0495678_002016 3300049459 Bacteria 14566
554 Ga0495682_0020688 3300049460 Bacteria 2469
555 Ga0501032_0058792 3300049569 Bacteria 2581
556 Ga0501034_0008329 3300049571 Bacteria 10970
557 Ga0501034_0047636 3300049571 Bacteria 4328
558 Ga0501040_0033552 3300049576 Bacteria 3478
559 Ga0501046_0042098 3300049580 Bacteria 3642
560 Ga0501068_0001055 3300049584 Bacteria 14604
561 Ga0501069_0049021 3300049585 Bacteria 2347
562 Ga0501070_0003078 3300049586 Bacteria 14519
563 Ga0501071_0116377 3300049587 Bacteria 1979
564 Ga0501072_0116010 3300049588 Bacteria 2132
565 Ga0501073_0003022 3300049589 Bacteria 12609
566 Ga0501074_0019604 3300049590 Bacteria 4909
567 Ga0501238_002466 3300049671 Bacteria 2215
568 Ga0501080_0012613 3300049742 Bacteria 7749
569 Ga0501035_0001554 3300049822 Bacteria 23406
570 Ga0501045_0150952 3300049824 Bacteria 1729
571 nmdc:mga05p37_133_c1 3300050507 Bacteria 68369
572 nmdc:mga05p37_3424_c1 3300050507 Bacteria 18509
573 nmdc:mga09592_1698_c1 3300050508 Bacteria 17757
574 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
575 nmdc:mga0qj67_325035_c1 3300050509 Bacteria 1245
576 nmdc:mga06r32_55548_c1 3300050510 Bacteria 3798
577 nmdc:mga08y16_1548_c1 3300050511 Bacteria 23173
578 nmdc:mga08y16_85765_c1 3300050511 Bacteria 3282
579 nmdc:mga0n895_28767_c1 3300050512 Bacteria 5291
580 nmdc:mga0n895_5586_c1 3300050512 Bacteria 10529
581 nmdc:mga0rr50_13378_c1 3300050513 Bacteria 5341
582 nmdc:mga0rr50_436_c1 3300050513 Bacteria 22427
583 nmdc:mga08x19_1428_c1 3300050514 Bacteria 14774
584 nmdc:mga0a205_1353_c1 3300050515 Bacteria 20648
585 nmdc:mga0a205_28199_c1 3300050515 Bacteria 5367
586 Ga0501082_0112780 3300060353 Bacteria 2354
587 Ga0501082_0167951 3300060353 Bacteria 1907

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0250045 Ga0373937_0250045_520_1644 365
2 3300050509 nmdc:mga0qj67_325035_c1 nmdc:mga0qj67_325035_c1_17_1234 396
3 3300009094 Ga0111539_10020073 Ga0111539_100200731 404
4 3300046492 Ga0495585_0009131 Ga0495585_0009131_14_1264 407
5 3300047472 Ga0495686_0023678 Ga0495686_0023678_418_1752 416
6 3300005330 Ga0070690_100002693 Ga0070690_1000026932 418
7 3300005334 Ga0068869_100002298 Ga0068869_1000022988 418
8 3300005336 Ga0070680_100003537 Ga0070680_1000035379 418
9 3300005338 Ga0068868_100000341 Ga0068868_10000034129 418
10 3300005340 Ga0070689_100003497 Ga0070689_1000034972 418
11 3300005341 Ga0070691_10000934 Ga0070691_100009345 418
12 3300005343 Ga0070687_100000369 Ga0070687_1000003697 418
13 3300005345 Ga0070692_10000874 Ga0070692_100008742 418
14 3300005438 Ga0070701_10000173 Ga0070701_1000017313 418
15 3300005440 Ga0070705_100002026 Ga0070705_1000020262 418
16 3300005444 Ga0070694_100000045 Ga0070694_10000004550 418
17 3300005445 Ga0070708_100182284 Ga0070708_1001822841 418
18 3300005459 Ga0068867_100004883 Ga0068867_1000048832 418
19 3300005545 Ga0070695_100000126 Ga0070695_10000012627 418
20 3300005546 Ga0070696_100003057 Ga0070696_1000030575 418
21 3300005547 Ga0070693_100000731 Ga0070693_10000073110 418
22 3300005549 Ga0070704_100000195 Ga0070704_10000019517 418
23 3300005563 Ga0068855_100007080 Ga0068855_1000070805 418
24 3300005578 Ga0068854_100003263 Ga0068854_1000032637 418
25 3300005614 Ga0068856_100015746 Ga0068856_1000157464 418
26 3300005615 Ga0070702_100000019 Ga0070702_1000000197 418
27 3300005718 Ga0068866_10001065 Ga0068866_100010658 418
28 3300005719 Ga0068861_100002221 Ga0068861_1000022217 418
29 3300005842 Ga0068858_100000751 Ga0068858_1000007516 418
30 3300005843 Ga0068860_100005413 Ga0068860_1000054137 418
31 3300005844 Ga0068862_100005525 Ga0068862_1000055254 418
32 3300006358 Ga0068871_100003308 Ga0068871_1000033087 418
33 3300006844 Ga0075428_100002204 Ga0075428_10000220414 418
34 3300006880 Ga0075429_100000143 Ga0075429_10000014312 418
35 3300006881 Ga0068865_100001242 Ga0068865_10000124211 418
36 3300009098 Ga0105245_10005835 Ga0105245_100058354 418
37 3300009147 Ga0114129_10001740 Ga0114129_1000174023 418
38 3300009148 Ga0105243_10004530 Ga0105243_100045308 418
39 3300009176 Ga0105242_10020708 Ga0105242_100207085 418
40 3300013297 Ga0157378_10000579 Ga0157378_100005797 418
41 3300014326 Ga0157380_10266469 Ga0157380_102664692 418
42 3300014969 Ga0157376_10007532 Ga0157376_100075327 418
43 3300025899 Ga0207642_10001096 Ga0207642_100010963 418
44 3300025912 Ga0207707_10054759 Ga0207707_100547593 418
45 3300025917 Ga0207660_10004091 Ga0207660_100040916 418
46 3300025918 Ga0207662_10000049 Ga0207662_100000498 418
47 3300025927 Ga0207687_10004654 Ga0207687_100046542 418
48 3300025931 Ga0207644_10149854 Ga0207644_101498542 418
49 3300025936 Ga0207670_10001257 Ga0207670_100012577 418
50 3300025942 Ga0207689_10005474 Ga0207689_100054744 418
51 3300025949 Ga0207667_10016028 Ga0207667_100160283 418
52 3300025961 Ga0207712_10009645 Ga0207712_100096452 418
53 3300026035 Ga0207703_10019959 Ga0207703_100199592 418
54 3300026041 Ga0207639_10171155 Ga0207639_101711551 418
55 3300026089 Ga0207648_10000265 Ga0207648_100002657 418
56 3300026118 Ga0207675_100000182 Ga0207675_1000001828 418
57 3300027907 Ga0207428_10001034 Ga0207428_100010347 418
58 3300028380 Ga0268265_10004295 Ga0268265_100042956 418
59 3300028381 Ga0268264_10006840 Ga0268264_100068403 418
60 3300034816 Ga0373930_0013137 Ga0373930_0013137_91_1410 418
61 3300035088 Ga0373940_0004497 Ga0373940_0004497_840_2159 418
62 3300035112 Ga0373932_0003784 Ga0373932_0003784_440_1759 418
63 3300035114 Ga0373939_0002155 Ga0373939_0002155_2701_4020 418
64 3300035207 Ga0373942_0004590 Ga0373942_0004590_1050_2369 418
65 3300035691 Ga0373931_0000062 Ga0373931_0000062_24330_25649 418
66 3300035691 Ga0373931_0013701 Ga0373931_0013701_2272_3591 418
67 3300042876 Ga0451577_0018812 Ga0451577_0018812_2789_4108 418
68 3300045051 Ga0451576_0001787 Ga0451576_0001787_28416_29735 418
69 3300045051 Ga0451576_0012002 Ga0451576_0012002_2315_3634 418
70 3300046506 Ga0495583_0000857 Ga0495583_0000857_10637_11968 418
71 3300050507 nmdc:mga05p37_3424_c1 nmdc:mga05p37_3424_c1_8236_9555 418
72 3300050508 nmdc:mga09592_1698_c1 nmdc:mga09592_1698_c1_10210_11529 418
73 3300050511 nmdc:mga08y16_1548_c1 nmdc:mga08y16_1548_c1_9566_10885 418
74 3300044842 Ga0466957_0024097 Ga0466957_0024097_2292_3587 421
75 3300046459 Ga0495629_0018036 Ga0495629_0018036_3287_4576 421
76 3300046492 Ga0495585_0028800 Ga0495585_0028800_1851_3140 421
77 3300046500 Ga0495596_0000952 Ga0495596_0000952_14399_15688 421
78 3300046506 Ga0495583_0005606 Ga0495583_0005606_1617_2903 421
79 3300046513 Ga0495616_0019052 Ga0495616_0019052_2334_3623 421
80 3300046522 Ga0495643_0000079 Ga0495643_0000079_53365_54651 421
81 3300046528 Ga0495642_0051666 Ga0495642_0051666_32_1321 421
82 3300046558 Ga0495633_0008066 Ga0495633_0008066_2685_3974 421
83 3300046615 Ga0495656_0010145 Ga0495656_0010145_716_2005 421
84 3300046684 Ga0495669_0002189 Ga0495669_0002189_1236_2525 421
85 3300047319 Ga0495674_0008080 Ga0495674_0008080_6851_8140 421
86 3300048912 Ga0496109_0038840 Ga0496109_0038840_35_1327 421
87 iso_pu_bacteria 2846033681 2846034626 422
88 iso_pu_bacteria 2846037992 2846038782 422
89 3300005340 Ga0070689_100027300 Ga0070689_1000273003 423
90 3300005535 Ga0070684_100002834 Ga0070684_10000283411 423
91 3300005544 Ga0070686_100054240 Ga0070686_1000542402 423
92 3300005545 Ga0070695_100043879 Ga0070695_1000438793 423
93 3300006237 Ga0097621_100026445 Ga0097621_1000264453 423
94 3300006871 Ga0075434_100081623 Ga0075434_1000816233 423
95 3300031548 Ga0307408_100164761 Ga0307408_1001647612 423
96 3300035121 Ga0373960_0024817 Ga0373960_0024817_154_1470 423
97 3300035172 Ga0373955_0013178 Ga0373955_0013178_70_1386 423
98 3300035691 Ga0373931_0023168 Ga0373931_0023168_1350_2654 423
99 3300035724 Ga0373933_0007663 Ga0373933_0007663_486_1802 423
100 3300036401 Ga0373937_0009139 Ga0373937_0009139_6964_8280 423
101 3300041512 Ga0451853_1159476 Ga0451853_1159476_150_1466 423
102 3300042876 Ga0451577_0097648 Ga0451577_0097648_587_1891 423
103 3300046454 Ga0495592_0009024 Ga0495592_0009024_3495_4811 423
104 3300046476 Ga0495662_0013392 Ga0495662_0013392_1690_3006 423
105 3300046476 Ga0495662_0047475 Ga0495662_0047475_154_1470 423
106 3300046511 Ga0495608_0004731 Ga0495608_0004731_4612_5928 423
107 3300046514 Ga0495618_0023201 Ga0495618_0023201_1513_2829 423
108 3300046516 Ga0495628_0007988 Ga0495628_0007988_4446_5762 423
109 3300046517 Ga0495630_0001001 Ga0495630_0001001_11099_12415 423
110 3300046526 Ga0495666_0006235 Ga0495666_0006235_1756_3072 423
111 3300046529 Ga0495652_0089281 Ga0495652_0089281_733_2049 423
112 3300046533 Ga0495640_0004549 Ga0495640_0004549_6141_7457 423
113 3300046535 Ga0495586_0001499 Ga0495586_0001499_4938_6254 423
114 3300046536 Ga0495587_0024366 Ga0495587_0024366_185_1501 423
115 3300046543 Ga0495645_0099538 Ga0495645_0099538_422_1738 423
116 3300046559 Ga0495667_0010845 Ga0495667_0010845_4562_5878 423
117 3300046559 Ga0495667_0141394 Ga0495667_0141394_11_1327 423
118 3300046642 Ga0495634_0011090 Ga0495634_0011090_2722_4038 423
119 3300046663 Ga0495635_0163233 Ga0495635_0163233_181_1497 423
120 3300046678 Ga0495599_0015568 Ga0495599_0015568_83_1399 423
121 3300046683 Ga0495658_0011040 Ga0495658_0011040_372_1688 423
122 3300046689 Ga0495613_0006610 Ga0495613_0006610_1049_2365 423
123 3300046809 Ga0495600_0004232 Ga0495600_0004232_3277_4593 423
124 3300047317 Ga0495604_0027355 Ga0495604_0027355_1594_2910 423
125 3300047318 Ga0495636_0004863 Ga0495636_0004863_3771_5084 423
126 3300047322 Ga0495680_0021252 Ga0495680_0021252_2861_4177 423
127 3300049576 Ga0501040_0033552 Ga0501040_0033552_523_1884 423
128 3300049580 Ga0501046_0042098 Ga0501046_0042098_2093_3409 423
129 3300049824 Ga0501045_0150952 Ga0501045_0150952_154_1470 423
130 3300050512 nmdc:mga0n895_5586_c1 nmdc:mga0n895_5586_c1_8522_9838 423
131 3300005334 Ga0068869_100000049 Ga0068869_10000004912 424
132 3300005617 Ga0068859_100111961 Ga0068859_1001119612 424
133 3300005843 Ga0068860_100118453 Ga0068860_1001184532 424
134 3300006852 Ga0075433_10001856 Ga0075433_1000185618 424
135 3300006871 Ga0075434_100001295 Ga0075434_1000012957 424
136 3300006914 Ga0075436_100000475 Ga0075436_1000004753 424
137 3300006931 Ga0097620_100111962 Ga0097620_1001119622 424
138 3300007076 Ga0075435_100001385 Ga0075435_1000013857 424
139 3300009148 Ga0105243_10082673 Ga0105243_100826732 424
140 3300025905 Ga0207685_10042791 Ga0207685_100427912 424
141 3300026089 Ga0207648_10014180 Ga0207648_100141805 424
142 3300028381 Ga0268264_10065283 Ga0268264_100652833 424
143 3300035089 Ga0373944_0023243 Ga0373944_0023243_305_1624 424
144 3300035111 Ga0373923_0009299 Ga0373923_0009299_22_1341 424
145 3300035113 Ga0373936_0009286 Ga0373936_0009286_926_2245 424
146 3300035116 Ga0373945_0004513 Ga0373945_0004513_2046_3365 424
147 3300035170 Ga0373943_0025865 Ga0373943_0025865_973_2292 424
148 3300035410 Ga0373924_0016085 Ga0373924_0016085_1005_2324 424
149 3300035692 Ga0373935_0026642 Ga0373935_0026642_597_1916 424
150 3300045051 Ga0451576_0008064 Ga0451576_0008064_7151_8470 424
151 3300046455 Ga0495603_0011608 Ga0495603_0011608_3499_4818 424
152 3300046472 Ga0495580_0006729 Ga0495580_0006729_587_1906 424
153 3300046473 Ga0495582_0010843 Ga0495582_0010843_2959_4278 424
154 3300046475 Ga0495639_0012157 Ga0495639_0012157_974_2293 424
155 3300046531 Ga0495665_0027527 Ga0495665_0027527_1651_2970 424
156 3300046535 Ga0495586_0002428 Ga0495586_0002428_4265_5584 424
157 3300046537 Ga0495598_0000961 Ga0495598_0000961_3246_4565 424
158 3300046615 Ga0495656_0002755 Ga0495656_0002755_3410_4729 424
159 3300046616 Ga0495668_0000008 Ga0495668_0000008_360398_361687 424
160 3300047315 Ga0495581_0020592 Ga0495581_0020592_957_2276 424
161 3300047321 Ga0495676_0019334 Ga0495676_0019334_930_2249 424
162 3300049569 Ga0501032_0058792 Ga0501032_0058792_129_1430 424
163 3300049571 Ga0501034_0008329 Ga0501034_0008329_2506_3807 424
164 3300049571 Ga0501034_0047636 Ga0501034_0047636_2822_4123 424
165 3300049584 Ga0501068_0001055 Ga0501068_0001055_4517_5818 424
166 3300049586 Ga0501070_0003078 Ga0501070_0003078_6335_7636 424
167 3300049587 Ga0501071_0116377 Ga0501071_0116377_586_1905 424
168 3300049588 Ga0501072_0116010 Ga0501072_0116010_668_1969 424
169 3300049589 Ga0501073_0003022 Ga0501073_0003022_3695_4996 424
170 3300049590 Ga0501074_0019604 Ga0501074_0019604_3035_4336 424
171 3300049742 Ga0501080_0012613 Ga0501080_0012613_678_1979 424
172 3300050513 nmdc:mga0rr50_436_c1 nmdc:mga0rr50_436_c1_4462_5781 424
173 3300050514 nmdc:mga08x19_1428_c1 nmdc:mga08x19_1428_c1_586_1905 424
174 3300050515 nmdc:mga0a205_1353_c1 nmdc:mga0a205_1353_c1_8792_10111 424
175 3300060353 Ga0501082_0112780 Ga0501082_0112780_631_1932 424
176 3300005331 Ga0070670_100000420 Ga0070670_10000042027 426
177 3300005335 Ga0070666_10027648 Ga0070666_100276484 426
178 3300005336 Ga0070680_100016773 Ga0070680_1000167734 426
179 3300005338 Ga0068868_100000481 Ga0068868_10000048124 426
180 3300005354 Ga0070675_100011753 Ga0070675_1000117535 426
181 3300005355 Ga0070671_100000233 Ga0070671_10000023329 426
182 3300005356 Ga0070674_100150105 Ga0070674_1001501052 426
183 3300005364 Ga0070673_100034846 Ga0070673_1000348462 426
184 3300005444 Ga0070694_100024371 Ga0070694_1000243712 426
185 3300005468 Ga0070707_100224731 Ga0070707_1002247312 426
186 3300005471 Ga0070698_100018197 Ga0070698_1000181977 426
187 3300005549 Ga0070704_100000303 Ga0070704_10000030315 426
188 3300005616 Ga0068852_100004168 Ga0068852_1000041683 426
189 3300005618 Ga0068864_100079465 Ga0068864_1000794653 426
190 3300005834 Ga0068851_10019420 Ga0068851_100194202 426
191 3300005841 Ga0068863_100012296 Ga0068863_1000122965 426
192 3300005985 Ga0081539_10000226 Ga0081539_10000226136 426
193 3300006163 Ga0070715_10066419 Ga0070715_100664192 426
194 3300006237 Ga0097621_100002059 Ga0097621_10000205912 426
195 3300006847 Ga0075431_100039747 Ga0075431_1000397472 426
196 3300006880 Ga0075429_100000015 Ga0075429_10000001541 426
197 3300006914 Ga0075436_100073466 Ga0075436_1000734663 426
198 3300007076 Ga0075435_100018574 Ga0075435_1000185744 426
199 3300009094 Ga0111539_10064434 Ga0111539_100644342 426
200 3300009147 Ga0114129_10049912 Ga0114129_100499125 426
201 3300013296 Ga0157374_10079072 Ga0157374_100790722 426
202 3300013306 Ga0163162_10380998 Ga0163162_103809982 426
203 3300013308 Ga0157375_10001103 Ga0157375_1000110322 426
204 3300025925 Ga0207650_10034709 Ga0207650_100347093 426
205 3300025926 Ga0207659_10031167 Ga0207659_100311673 426
206 3300025931 Ga0207644_10018061 Ga0207644_100180614 426
207 3300025936 Ga0207670_10107355 Ga0207670_101073552 426
208 3300025938 Ga0207704_10013921 Ga0207704_100139214 426
209 3300025942 Ga0207689_10129476 Ga0207689_101294762 426
210 3300026142 Ga0207698_10001809 Ga0207698_1000180912 426
211 3300035086 Ga0373934_0012223 Ga0373934_0012223_1266_2591 426
212 3300035724 Ga0373933_0001438 Ga0373933_0001438_5779_7104 426
213 3300035724 Ga0373933_0062891 Ga0373933_0062891_425_1747 426
214 3300036401 Ga0373937_0003410 Ga0373937_0003410_4637_5962 426
215 3300042001 Ga0439441_008716 Ga0439441_008716_273_1592 426
216 3300045051 Ga0451576_0278373 Ga0451576_0278373_81_1406 426
217 3300046664 Ga0495659_0036067 Ga0495659_0036067_357_1688 426
218 3300048911 Ga0496108_0007533 Ga0496108_0007533_5810_7132 426
219 3300048913 Ga0496110_0000706 Ga0496110_0000706_18792_20114 426
220 3300049585 Ga0501069_0049021 Ga0501069_0049021_143_1465 426
221 3300050507 nmdc:mga05p37_133_c1 nmdc:mga05p37_133_c1_52227_53546 426
222 3300050508 nmdc:mga09592_26_c1 nmdc:mga09592_26_c1_2875_4194 426
223 3300050510 nmdc:mga06r32_55548_c1 nmdc:mga06r32_55548_c1_1913_3232 426
224 3300050511 nmdc:mga08y16_85765_c1 nmdc:mga08y16_85765_c1_466_1785 426
225 3300050512 nmdc:mga0n895_28767_c1 nmdc:mga0n895_28767_c1_344_1669 426
226 3300050513 nmdc:mga0rr50_13378_c1 nmdc:mga0rr50_13378_c1_1216_2541 426
227 3300060353 Ga0501082_0167951 Ga0501082_0167951_290_1615 426
228 3300006846 Ga0075430_100028919 Ga0075430_1000289194 428
229 3300006852 Ga0075433_10108451 Ga0075433_101084512 428
230 3300007076 Ga0075435_100000811 Ga0075435_1000008115 428
231 3300047472 Ga0495686_0001141 Ga0495686_0001141_27029_28378 428
232 3300050515 nmdc:mga0a205_28199_c1 nmdc:mga0a205_28199_c1_3830_5158 428
233 iso_pu_bacteria 8047673197 8047678753 429
234 3300002987 JGI25159J45721_1000645 JGI25159J45721_100064511 430
235 3300003775 Ga0055524_1000026 Ga0055524_1000026103 430
236 3300004625 Ga0055543_1007174 Ga0055543_10071743 430
237 3300005262 Ga0065165_1000067 Ga0065165_100006732 430
238 3300005262 Ga0065165_1027766 Ga0065165_10277662 430
239 3300006948 Ga0099826_10000003 Ga0099826_10000003958 430
240 3300025284 Ga0209130_1000223 Ga0209130_100022362 430
241 3300027666 Ga0209282_1000002 Ga0209282_100000250 430
242 3300049671 Ga0501238_002466 Ga0501238_002466_367_1686 430
243 iso_pu_bacteria 2738541280 2738740694 430
244 iso_pu_bacteria 2738541300 2738845012 430
245 iso_pu_bacteria 2738543018 2739277427 430
246 iso_pu_bacteria 2738543030 2739346470 430
247 iso_pu_bacteria 2643221556 2643800454 431
248 iso_pu_bacteria 2643221645 2644249264 431
249 iso_pu_bacteria 2643221664 2644355808 431
250 iso_pu_bacteria 2643221684 2644470363 431
251 3300046674 Ga0495588_0006726 Ga0495588_0006726_1250_2572 432
252 3300003322 rootL2_10018597 rootL2_100185973 433
253 3300037466 Ga0395898_0068367 Ga0395898_0068367_1805_3139 433
254 3300037471 Ga0395905_0032398 Ga0395905_0032398_2970_4304 433
255 3300038443 Ga0395901_0209547 Ga0395901_0209547_456_1790 433
256 3300044683 Ga0466965_0081054 Ga0466965_0081054_163_1491 433
257 3300044684 Ga0466966_0027270 Ga0466966_0027270_1288_2616 433
258 3300045049 Ga0466959_0012486 Ga0466959_0012486_4335_5663 433
259 3300046513 Ga0495616_0031954 Ga0495616_0031954_902_2230 433
260 3300048925 Ga0496122_0041646 Ga0496122_0041646_698_2026 433
261 3300048926 Ga0496123_0007158 Ga0496123_0007158_4842_6170 433
262 3300003759 Ga0055525_1000081 Ga0055525_100008144 434
263 3300005327 Ga0070658_10105090 Ga0070658_101050901 434
264 3300005339 Ga0070660_100055058 Ga0070660_1000550583 434
265 3300005339 Ga0070660_100071518 Ga0070660_1000715183 434
266 3300005366 Ga0070659_100072178 Ga0070659_1000721782 434
267 3300005563 Ga0068855_100021589 Ga0068855_1000215894 434
268 3300005564 Ga0070664_100052561 Ga0070664_1000525613 434
269 3300009148 Ga0105243_10076465 Ga0105243_100764652 434
270 3300009174 Ga0105241_10014386 Ga0105241_100143865 434
271 3300009176 Ga0105242_10141356 Ga0105242_101413562 434
272 3300009551 Ga0105238_10175054 Ga0105238_101750542 434
273 3300025230 Ga0209563_100015 Ga0209563_100015744 434
274 3300025254 Ga0209148_1000413 Ga0209148_10004135 434
275 3300025909 Ga0207705_10007248 Ga0207705_100072486 434
276 3300025919 Ga0207657_10028630 Ga0207657_100286305 434
277 3300025933 Ga0207706_10202715 Ga0207706_102027152 434
278 3300025934 Ga0207686_10011152 Ga0207686_100111522 434
279 3300025949 Ga0207667_10013470 Ga0207667_100134702 434
280 3300037312 Ga0395899_0030598 Ga0395899_0030598_2425_3759 434
281 3300037418 Ga0395900_0000532 Ga0395900_0000532_31900_33234 434
282 3300037418 Ga0395900_0010039 Ga0395900_0010039_3096_4430 434
283 3300037418 Ga0395900_0020349 Ga0395900_0020349_5266_6600 434
284 3300037418 Ga0395900_0070410 Ga0395900_0070410_1377_2711 434
285 3300037418 Ga0395900_0070768 Ga0395900_0070768_588_1922 434
286 3300037466 Ga0395898_0023643 Ga0395898_0023643_4708_6042 434
287 3300037466 Ga0395898_0157460 Ga0395898_0157460_52_1386 434
288 3300037471 Ga0395905_0042850 Ga0395905_0042850_660_2006 434
289 3300038443 Ga0395901_0000387 Ga0395901_0000387_35078_36412 434
290 3300038443 Ga0395901_0003072 Ga0395901_0003072_4646_5980 434
291 3300038443 Ga0395901_0136625 Ga0395901_0136625_1165_2511 434
292 3300042005 Ga0439448_0003230 Ga0439448_0003230_1240_2577 434
293 3300044658 Ga0466972_0008353 Ga0466972_0008353_1590_2924 434
294 3300044683 Ga0466965_0000667 Ga0466965_0000667_9863_11197 434
295 3300044684 Ga0466966_0024006 Ga0466966_0024006_2089_3423 434
296 3300044684 Ga0466966_0025591 Ga0466966_0025591_2159_3493 434
297 3300044684 Ga0466966_0055391 Ga0466966_0055391_761_2095 434
298 3300044693 Ga0466961_0045812 Ga0466961_0045812_296_1630 434
299 3300044694 Ga0466963_0084919 Ga0466963_0084919_241_1575 434
300 3300044706 Ga0466964_0000392 Ga0466964_0000392_25_1359 434
301 3300044706 Ga0466964_0009938 Ga0466964_0009938_1232_2566 434
302 3300044735 Ga0466968_0000256 Ga0466968_0000256_5130_6464 434
303 3300044765 Ga0466970_0022088 Ga0466970_0022088_1160_2491 434
304 3300044842 Ga0466957_0000388 Ga0466957_0000388_15454_16788 434
305 3300045836 Ga0466958_0028127 Ga0466958_0028127_1620_2966 434
306 3300046455 Ga0495603_0040983 Ga0495603_0040983_1407_2732 434
307 3300046474 Ga0495605_0000369 Ga0495605_0000369_5081_6412 434
308 3300046491 Ga0495584_0016521 Ga0495584_0016521_395_1729 434
309 3300046501 Ga0495607_0002834 Ga0495607_0002834_5836_7170 434
310 3300046507 Ga0495606_0051170 Ga0495606_0051170_965_2299 434
311 3300046522 Ga0495643_0014914 Ga0495643_0014914_1611_2942 434
312 3300046528 Ga0495642_0002957 Ga0495642_0002957_4930_6276 434
313 3300046538 Ga0495609_0000028 Ga0495609_0000028_89969_91303 434
314 3300046557 Ga0495622_0058697 Ga0495622_0058697_263_1588 434
315 3300046660 Ga0495625_0013261 Ga0495625_0013261_3572_4918 434
316 3300046664 Ga0495659_0000128 Ga0495659_0000128_12262_13608 434
317 3300046665 Ga0495661_0000157 Ga0495661_0000157_58557_59891 434
318 3300046665 Ga0495661_0000710 Ga0495661_0000710_12566_13912 434
319 3300046665 Ga0495661_0072596 Ga0495661_0072596_510_1844 434
320 3300046674 Ga0495588_0000113 Ga0495588_0000113_19040_20389 434
321 3300046692 Ga0495671_0000234 Ga0495671_0000234_19469_20815 434
322 3300046694 Ga0495649_0044510 Ga0495649_0044510_84_1415 434
323 3300046794 Ga0495589_0000113 Ga0495589_0000113_6027_7361 434
324 3300046794 Ga0495589_0000117 Ga0495589_0000117_59875_61206 434
325 3300046810 Ga0495660_0006758 Ga0495660_0006758_4479_5810 434
326 3300047320 Ga0495672_0000035 Ga0495672_0000035_13186_14532 434
327 3300047320 Ga0495672_0000423 Ga0495672_0000423_30309_31640 434
328 3300047323 Ga0495683_0035227 Ga0495683_0035227_414_1745 434
329 3300047443 Ga0495687_000054 Ga0495687_000054_124012_125346 434
330 3300047443 Ga0495687_001251 Ga0495687_001251_17620_18954 434
331 3300047445 Ga0495677_0000012 Ga0495677_0000012_123869_125203 434
332 3300047445 Ga0495677_0000316 Ga0495677_0000316_10401_11732 434
333 3300048091 Ga0495626_0000036 Ga0495626_0000036_62070_63401 434
334 3300048091 Ga0495626_0001270 Ga0495626_0001270_17274_18608 434
335 3300048907 Ga0496104_0084096 Ga0496104_0084096_582_1916 434
336 3300048916 Ga0496113_0015050 Ga0496113_0015050_442_1776 434
337 3300048917 Ga0496114_0045051 Ga0496114_0045051_898_2232 434
338 3300048925 Ga0496122_0003441 Ga0496122_0003441_17300_18634 434
339 3300048927 Ga0496124_0002911 Ga0496124_0002911_18257_19591 434
340 3300048927 Ga0496124_0007329 Ga0496124_0007329_5809_7143 434
341 3300049822 Ga0501035_0001554 Ga0501035_0001554_16953_18287 434
342 iso_pu_bacteria 2643221554 2643789162 434
343 iso_pu_bacteria 2643221638 2644215102 434
344 3300003771 Ga0055526_1003633 Ga0055526_10036336 435
345 3300003771 Ga0055526_1011821 Ga0055526_10118213 435
346 3300003773 Ga0055537_1000128 Ga0055537_100012837 435
347 3300003775 Ga0055524_1002841 Ga0055524_10028416 435
348 3300003775 Ga0055524_1030565 Ga0055524_10305652 435
349 3300003784 Ga0055534_1000120 Ga0055534_100012037 435
350 3300003784 Ga0055534_1003227 Ga0055534_10032273 435
351 3300003790 Ga0055528_1000069 Ga0055528_100006910 435
352 3300003790 Ga0055528_1009531 Ga0055528_10095312 435
353 3300003794 Ga0055531_10007725 Ga0055531_100077254 435
354 3300003794 Ga0055531_10012841 Ga0055531_100128412 435
355 3300025208 Ga0209436_101174 Ga0209436_1011742 435
356 3300025245 Ga0207425_1000531 Ga0207425_100053122 435
357 3300025263 Ga0209565_1000006 Ga0209565_1000006693 435
358 3300025263 Ga0209565_1000163 Ga0209565_100016365 435
359 3300025263 Ga0209565_1000562 Ga0209565_100056216 435
360 3300025263 Ga0209565_1000674 Ga0209565_100067410 435
361 3300025263 Ga0209565_1003189 Ga0209565_10031893 435
362 3300025263 Ga0209565_1010863 Ga0209565_10108632 435
363 3300025273 Ga0209673_1000004 Ga0209673_1000004136 435
364 3300025291 Ga0209675_1000224 Ga0209675_100022423 435
365 3300025291 Ga0209675_1000292 Ga0209675_100029231 435
366 3300025295 Ga0209564_1000102 Ga0209564_1000102177 435
367 3300025295 Ga0209564_1001497 Ga0209564_10014979 435
368 3300025295 Ga0209564_1001667 Ga0209564_100166716 435
369 3300025298 Ga0209050_1000183 Ga0209050_100018313 435
370 3300025299 Ga0209256_1000372 Ga0209256_100037218 435
371 3300025299 Ga0209256_1000495 Ga0209256_100049523 435
372 3300025304 Ga0209257_1000010 Ga0209257_1000010128 435
373 3300031548 Ga0307408_100019088 Ga0307408_1000190884 435
374 3300031548 Ga0307408_100031244 Ga0307408_1000312444 435
375 3300031838 Ga0307518_10007601 Ga0307518_100076014 435
376 3300037418 Ga0395900_0266732 Ga0395900_0266732_217_1551 435
377 3300037471 Ga0395905_0025537 Ga0395905_0025537_2056_3390 435
378 3300046453 Ga0495627_000247 Ga0495627_000247_53389_54723 435
379 3300046453 Ga0495627_018772 Ga0495627_018772_285_1616 435
380 3300046460 Ga0495638_0015616 Ga0495638_0015616_314_1648 435
381 3300046460 Ga0495638_0043249 Ga0495638_0043249_471_1793 435
382 3300046460 Ga0495638_0066858 Ga0495638_0066858_553_1887 435
383 3300046463 Ga0495653_0039936 Ga0495653_0039936_1063_2394 435
384 3300046471 Ga0495650_0010129 Ga0495650_0010129_1815_3149 435
385 3300046474 Ga0495605_0000307 Ga0495605_0000307_16219_17553 435
386 3300046474 Ga0495605_0029247 Ga0495605_0029247_300_1634 435
387 3300046491 Ga0495584_0000762 Ga0495584_0000762_5758_7089 435
388 3300046491 Ga0495584_0002453 Ga0495584_0002453_7595_8929 435
389 3300046491 Ga0495584_0003217 Ga0495584_0003217_6554_7885 435
390 3300046491 Ga0495584_0003805 Ga0495584_0003805_1876_3207 435
391 3300046491 Ga0495584_0020747 Ga0495584_0020747_985_2316 435
392 3300046492 Ga0495585_0000148 Ga0495585_0000148_61003_62334 435
393 3300046492 Ga0495585_0000613 Ga0495585_0000613_12821_14152 435
394 3300046492 Ga0495585_0001019 Ga0495585_0001019_5213_6544 435
395 3300046492 Ga0495585_0001344 Ga0495585_0001344_5051_6382 435
396 3300046492 Ga0495585_0001953 Ga0495585_0001953_13610_14944 435
397 3300046492 Ga0495585_0004701 Ga0495585_0004701_5183_6514 435
398 3300046492 Ga0495585_0014629 Ga0495585_0014629_1081_2412 435
399 3300046492 Ga0495585_0020438 Ga0495585_0020438_2289_3623 435
400 3300046492 Ga0495585_0028325 Ga0495585_0028325_1683_3014 435
401 3300046492 Ga0495585_0042845 Ga0495585_0042845_645_1979 435
402 3300046492 Ga0495585_0051478 Ga0495585_0051478_737_2068 435
403 3300046500 Ga0495596_0000778 Ga0495596_0000778_17553_18899 435
404 3300046500 Ga0495596_0001117 Ga0495596_0001117_1379_2710 435
405 3300046500 Ga0495596_0001924 Ga0495596_0001924_8389_9720 435
406 3300046500 Ga0495596_0026250 Ga0495596_0026250_389_1723 435
407 3300046500 Ga0495596_0038172 Ga0495596_0038172_58_1392 435
408 3300046501 Ga0495607_0001816 Ga0495607_0001816_15357_16694 435
409 3300046501 Ga0495607_0002875 Ga0495607_0002875_7747_9081 435
410 3300046501 Ga0495607_0060321 Ga0495607_0060321_451_1785 435
411 3300046506 Ga0495583_0000268 Ga0495583_0000268_16729_18060 435
412 3300046506 Ga0495583_0028051 Ga0495583_0028051_1132_2463 435
413 3300046506 Ga0495583_0040003 Ga0495583_0040003_138_1472 435
414 3300046507 Ga0495606_0036811 Ga0495606_0036811_702_2042 435
415 3300046507 Ga0495606_0083969 Ga0495606_0083969_290_1621 435
416 3300046513 Ga0495616_0000052 Ga0495616_0000052_4353_5681 435
417 3300046513 Ga0495616_0000817 Ga0495616_0000817_1916_3250 435
418 3300046513 Ga0495616_0003103 Ga0495616_0003103_8331_9662 435
419 3300046513 Ga0495616_0019920 Ga0495616_0019920_937_2271 435
420 3300046513 Ga0495616_0020953 Ga0495616_0020953_1368_2702 435
421 3300046518 Ga0495631_0000673 Ga0495631_0000673_5966_7300 435
422 3300046518 Ga0495631_0003570 Ga0495631_0003570_1096_2430 435
423 3300046518 Ga0495631_0006929 Ga0495631_0006929_259_1593 435
424 3300046518 Ga0495631_0012413 Ga0495631_0012413_1446_2777 435
425 3300046518 Ga0495631_0021505 Ga0495631_0021505_618_1949 435
426 3300046518 Ga0495631_0027394 Ga0495631_0027394_382_1713 435
427 3300046518 Ga0495631_0039044 Ga0495631_0039044_444_1778 435
428 3300046519 Ga0495632_0000260 Ga0495632_0000260_44148_45482 435
429 3300046519 Ga0495632_0000887 Ga0495632_0000887_11495_12829 435
430 3300046519 Ga0495632_0001388 Ga0495632_0001388_14411_15742 435
431 3300046519 Ga0495632_0001906 Ga0495632_0001906_15241_16578 435
432 3300046519 Ga0495632_0021241 Ga0495632_0021241_593_1930 435
433 3300046520 Ga0495637_0045539 Ga0495637_0045539_422_1756 435
434 3300046522 Ga0495643_0005190 Ga0495643_0005190_7107_8438 435
435 3300046522 Ga0495643_0021553 Ga0495643_0021553_785_2122 435
436 3300046522 Ga0495643_0034661 Ga0495643_0034661_1139_2473 435
437 3300046523 Ga0495644_0005948 Ga0495644_0005948_401_1735 435
438 3300046523 Ga0495644_0018457 Ga0495644_0018457_1050_2381 435
439 3300046524 Ga0495648_0000117 Ga0495648_0000117_68371_69702 435
440 3300046524 Ga0495648_0005389 Ga0495648_0005389_4216_5550 435
441 3300046525 Ga0495663_0006777 Ga0495663_0006777_1362_2693 435
442 3300046525 Ga0495663_0020873 Ga0495663_0020873_397_1728 435
443 3300046526 Ga0495666_0001606 Ga0495666_0001606_8562_9917 435
444 3300046528 Ga0495642_0000438 Ga0495642_0000438_16105_17439 435
445 3300046528 Ga0495642_0000657 Ga0495642_0000657_14988_16322 435
446 3300046528 Ga0495642_0009583 Ga0495642_0009583_1754_3085 435
447 3300046528 Ga0495642_0030494 Ga0495642_0030494_162_1484 435
448 3300046528 Ga0495642_0031876 Ga0495642_0031876_222_1556 435
449 3300046530 Ga0495654_0001281 Ga0495654_0001281_990_2324 435
450 3300046530 Ga0495654_0001433 Ga0495654_0001433_14933_16267 435
451 3300046530 Ga0495654_0012235 Ga0495654_0012235_693_2027 435
452 3300046531 Ga0495665_0003893 Ga0495665_0003893_6014_7348 435
453 3300046531 Ga0495665_0018236 Ga0495665_0018236_39_1394 435
454 3300046535 Ga0495586_0001789 Ga0495586_0001789_3917_5257 435
455 3300046535 Ga0495586_0021527 Ga0495586_0021527_529_1863 435
456 3300046538 Ga0495609_0001706 Ga0495609_0001706_6632_7966 435
457 3300046538 Ga0495609_0004384 Ga0495609_0004384_416_1747 435
458 3300046538 Ga0495609_0008429 Ga0495609_0008429_1290_2630 435
459 3300046538 Ga0495609_0014166 Ga0495609_0014166_159_1490 435
460 3300046538 Ga0495609_0020110 Ga0495609_0020110_1021_2352 435
461 3300046542 Ga0495597_0002300 Ga0495597_0002300_5005_6339 435
462 3300046542 Ga0495597_0002834 Ga0495597_0002834_3044_4378 435
463 3300046542 Ga0495597_0010739 Ga0495597_0010739_1484_2815 435
464 3300046542 Ga0495597_0023534 Ga0495597_0023534_1077_2408 435
465 3300046542 Ga0495597_0028110 Ga0495597_0028110_243_1577 435
466 3300046557 Ga0495622_0002273 Ga0495622_0002273_1314_2648 435
467 3300046557 Ga0495622_0004624 Ga0495622_0004624_1221_2555 435
468 3300046557 Ga0495622_0008654 Ga0495622_0008654_2511_3845 435
469 3300046558 Ga0495633_0001933 Ga0495633_0001933_12061_13392 435
470 3300046558 Ga0495633_0012332 Ga0495633_0012332_1336_2667 435
471 3300046558 Ga0495633_0021914 Ga0495633_0021914_1671_3002 435
472 3300046615 Ga0495656_0003684 Ga0495656_0003684_3304_4635 435
473 3300046615 Ga0495656_0017064 Ga0495656_0017064_264_1595 435
474 3300046616 Ga0495668_0000768 Ga0495668_0000768_15140_16474 435
475 3300046616 Ga0495668_0002938 Ga0495668_0002938_1592_2923 435
476 3300046616 Ga0495668_0006624 Ga0495668_0006624_1679_3010 435
477 3300046616 Ga0495668_0007764 Ga0495668_0007764_4554_5888 435
478 3300046616 Ga0495668_0023799 Ga0495668_0023799_1579_2913 435
479 3300046616 Ga0495668_0024715 Ga0495668_0024715_1849_3171 435
480 3300046616 Ga0495668_0041180 Ga0495668_0041180_480_1811 435
481 3300046648 Ga0495611_0005434 Ga0495611_0005434_3398_4729 435
482 3300046660 Ga0495625_0001449 Ga0495625_0001449_25837_27159 435
483 3300046660 Ga0495625_0010265 Ga0495625_0010265_13_1347 435
484 3300046660 Ga0495625_0013090 Ga0495625_0013090_1055_2389 435
485 3300046665 Ga0495661_0000932 Ga0495661_0000932_10151_11485 435
486 3300046665 Ga0495661_0002284 Ga0495661_0002284_6421_7755 435
487 3300046665 Ga0495661_0003893 Ga0495661_0003893_971_2302 435
488 3300046665 Ga0495661_0004318 Ga0495661_0004318_1583_2920 435
489 3300046665 Ga0495661_0023638 Ga0495661_0023638_1320_2654 435
490 3300046665 Ga0495661_0042382 Ga0495661_0042382_605_1936 435
491 3300046665 Ga0495661_0043966 Ga0495661_0043966_565_1896 435
492 3300046665 Ga0495661_0091422 Ga0495661_0091422_338_1669 435
493 3300046674 Ga0495588_0019718 Ga0495588_0019718_1447_2781 435
494 3300046674 Ga0495588_0033810 Ga0495588_0033810_149_1483 435
495 3300046679 Ga0495623_0036973 Ga0495623_0036973_1630_2964 435
496 3300046679 Ga0495623_0055002 Ga0495623_0055002_929_2272 435
497 3300046684 Ga0495669_0000218 Ga0495669_0000218_960_2306 435
498 3300046684 Ga0495669_0002436 Ga0495669_0002436_87_1409 435
499 3300046690 Ga0495624_0074815 Ga0495624_0074815_201_1535 435
500 3300046691 Ga0495670_0001954 Ga0495670_0001954_1154_2485 435
501 3300046691 Ga0495670_0002681 Ga0495670_0002681_1241_2572 435
502 3300046692 Ga0495671_0000358 Ga0495671_0000358_15857_17191 435
503 3300046692 Ga0495671_0018039 Ga0495671_0018039_549_1925 435
504 3300046692 Ga0495671_0018164 Ga0495671_0018164_197_1531 435
505 3300046692 Ga0495671_0037569 Ga0495671_0037569_357_1688 435
506 3300046694 Ga0495649_0004762 Ga0495649_0004762_6334_7656 435
507 3300046694 Ga0495649_0007589 Ga0495649_0007589_4482_5819 435
508 3300046794 Ga0495589_0000712 Ga0495589_0000712_5205_6539 435
509 3300046794 Ga0495589_0022273 Ga0495589_0022273_1366_2700 435
510 3300046810 Ga0495660_0001770 Ga0495660_0001770_7736_9076 435
511 3300046810 Ga0495660_0003899 Ga0495660_0003899_2555_3889 435
512 3300046810 Ga0495660_0024655 Ga0495660_0024655_185_1519 435
513 3300046810 Ga0495660_0027227 Ga0495660_0027227_1222_2544 435
514 3300047315 Ga0495581_0073341 Ga0495581_0073341_87_1421 435
515 3300047317 Ga0495604_0040259 Ga0495604_0040259_623_1957 435
516 3300047317 Ga0495604_0074502 Ga0495604_0074502_887_2242 435
517 3300047317 Ga0495604_0160270 Ga0495604_0160270_36_1370 435
518 3300047318 Ga0495636_0013453 Ga0495636_0013453_743_2074 435
519 3300047319 Ga0495674_0102129 Ga0495674_0102129_86_1420 435
520 3300047320 Ga0495672_0002295 Ga0495672_0002295_1278_2612 435
521 3300047320 Ga0495672_0003282 Ga0495672_0003282_6338_7672 435
522 3300047321 Ga0495676_0000034 Ga0495676_0000034_15702_17036 435
523 3300047321 Ga0495676_0092812 Ga0495676_0092812_212_1543 435
524 3300047322 Ga0495680_0005270 Ga0495680_0005270_796_2136 435
525 3300047323 Ga0495683_0000275 Ga0495683_0000275_27877_29208 435
526 3300047323 Ga0495683_0003535 Ga0495683_0003535_1387_2718 435
527 3300047323 Ga0495683_0039375 Ga0495683_0039375_85_1416 435
528 3300047443 Ga0495687_000060 Ga0495687_000060_146684_148018 435
529 3300047443 Ga0495687_000410 Ga0495687_000410_36810_38144 435
530 3300047443 Ga0495687_019355 Ga0495687_019355_1105_2436 435
531 3300047444 Ga0495675_0087793 Ga0495675_0087793_273_1604 435
532 3300047445 Ga0495677_0001363 Ga0495677_0001363_18_1355 435
533 3300047445 Ga0495677_0033768 Ga0495677_0033768_162_1484 435
534 3300047445 Ga0495677_0050226 Ga0495677_0050226_71_1405 435
535 3300047446 Ga0495679_002389 Ga0495679_002389_2868_4202 435
536 3300047446 Ga0495679_004610 Ga0495679_004610_4073_5395 435
537 3300047447 Ga0495685_000383 Ga0495685_000383_666_2000 435
538 3300047447 Ga0495685_006840 Ga0495685_006840_1456_2787 435
539 3300047469 Ga0495673_0010194 Ga0495673_0010194_3236_4567 435
540 3300047470 Ga0495681_0001235 Ga0495681_0001235_920_2254 435
541 3300047470 Ga0495681_0003816 Ga0495681_0003816_1867_3189 435
542 3300047470 Ga0495681_0010086 Ga0495681_0010086_2439_3773 435
543 3300047470 Ga0495681_0017378 Ga0495681_0017378_1298_2629 435
544 3300047470 Ga0495681_0024463 Ga0495681_0024463_322_1653 435
545 3300047472 Ga0495686_0001783 Ga0495686_0001783_1721_3043 435
546 3300047472 Ga0495686_0004197 Ga0495686_0004197_8732_10072 435
547 3300047673 Ga0495593_0012675 Ga0495593_0012675_2024_3358 435
548 3300048089 Ga0495614_0004953 Ga0495614_0004953_3687_5021 435
549 3300048090 Ga0495615_0000815 Ga0495615_0000815_332_1663 435
550 3300048091 Ga0495626_0000044 Ga0495626_0000044_62238_63569 435
551 3300048091 Ga0495626_0004212 Ga0495626_0004212_18_1349 435
552 3300048091 Ga0495626_0015575 Ga0495626_0015575_1342_2703 435
553 3300048091 Ga0495626_0019590 Ga0495626_0019590_536_1867 435
554 3300048091 Ga0495626_0029263 Ga0495626_0029263_985_2319 435
555 3300048091 Ga0495626_0031582 Ga0495626_0031582_859_2190 435
556 3300048091 Ga0495626_0037913 Ga0495626_0037913_109_1446 435
557 3300048091 Ga0495626_0040214 Ga0495626_0040214_347_1684 435
558 3300048091 Ga0495626_0054725 Ga0495626_0054725_344_1681 435
559 3300048903 Ga0496100_0008941 Ga0496100_0008941_3644_4978 435
560 3300048904 Ga0496101_0026051 Ga0496101_0026051_428_1762 435
561 3300048905 Ga0496102_0000192 Ga0496102_0000192_30407_31735 435
562 3300048905 Ga0496102_0001818 Ga0496102_0001818_11414_12748 435
563 3300048905 Ga0496102_0098690 Ga0496102_0098690_1197_2528 435
564 3300048905 Ga0496102_0112583 Ga0496102_0112583_719_2053 435
565 3300048906 Ga0496103_0002975 Ga0496103_0002975_6410_7738 435
566 3300048906 Ga0496103_0042689 Ga0496103_0042689_1248_2582 435
567 3300048913 Ga0496110_0005159 Ga0496110_0005159_6965_8299 435
568 3300048916 Ga0496113_0145259 Ga0496113_0145259_25_1359 435
569 3300048925 Ga0496122_0003307 Ga0496122_0003307_3720_5054 435
570 3300048926 Ga0496123_0000905 Ga0496123_0000905_29127_30461 435
571 3300048928 Ga0496125_0002954 Ga0496125_0002954_3911_5245 435
572 3300049459 Ga0495678_002016 Ga0495678_002016_1907_3241 435
573 3300049460 Ga0495682_0020688 Ga0495682_0020688_540_1871 435
574 3300002739 JGI25158J39367_1001321 JGI25158J39367_10013212 438
575 3300002773 JGI25152J39213_1000263 JGI25152J39213_100026320 438
576 3300002774 JGI25150J39212_1000764 JGI25150J39212_10007644 438
577 3300003215 JGI25153J46596_10000821 JGI25153J46596_1000082110 438
578 3300003374 JGI25161J50226_1002622 JGI25161J50226_10026224 438
579 3300003771 Ga0055526_1003162 Ga0055526_10031625 438
580 3300003773 Ga0055537_1004883 Ga0055537_10048832 438
581 3300003775 Ga0055524_1001343 Ga0055524_100134310 438
582 3300003775 Ga0055524_1004326 Ga0055524_10043264 438
583 3300003791 Ga0055530_10007411 Ga0055530_100074114 438
584 3300004625 Ga0055543_1003202 Ga0055543_10032024 438
585 3300005262 Ga0065165_1008156 Ga0065165_10081563 438
586 3300025208 Ga0209436_100496 Ga0209436_1004964 438
587 3300025245 Ga0207425_1000006 Ga0207425_1000006666 438
588 3300025258 Ga0209129_1000009 Ga0209129_1000009495 438
589 3300025263 Ga0209565_1010193 Ga0209565_10101932 438
590 3300025284 Ga0209130_1001753 Ga0209130_10017536 438
591 3300025291 Ga0209675_1003337 Ga0209675_10033376 438
592 3300025295 Ga0209564_1000098 Ga0209564_1000098129 438
593 3300025295 Ga0209564_1017469 Ga0209564_10174692 438
594 3300025297 Ga0209758_1000071 Ga0209758_1000071159 438
595 3300025298 Ga0209050_1000731 Ga0209050_100073137 438
596 3300025299 Ga0209256_1001594 Ga0209256_100159420 438
597 3300025299 Ga0209256_1002381 Ga0209256_10023814 438
598 3300031548 Ga0307408_100006870 Ga0307408_1000068704 438
599 3300031548 Ga0307408_100013254 Ga0307408_1000132543 438
600 3300032002 Ga0307416_100060623 Ga0307416_1000606232 438

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05195

AMP_N

Aminopeptidase P, N-terminal domain

4

125

0.96

PF00557

Peptidase_M24

Metallopeptidase family M24

179

435

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wze-assembly1.cif.gz_C the structure of pseudomonas aeruginosa aminopeptidase pepp 0.9357 1 437
1jaw-assembly1.cif.gz_A aminopeptidase p from e. coli low ph form 0.9352 2 437
2bwu-assembly1.cif.gz_A asp271ala escherichia coli aminopeptidase p 0.93 2 437
2bwt-assembly1.cif.gz_A asp260ala escherichia coli aminopeptidase p 0.9296 2 437
2bww-assembly1.cif.gz_A his350ala escherichia coli aminopeptidase p 0.9294 2 437
ID Description Score Start End Superfamily
af_Q4CSP6_205_383_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9661 171 344 3.90.230.10
4pv4A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9628 169 437 3.90.230.10
3ig4F02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9574 171 436 3.90.230.10
af_Q9NQH7_247_507_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9485 171 437 3.90.230.10
4pv4A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9485 169 437 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A3C1SPG2-F1-model_v4 Xaa-Pro aminopeptidase (EC 3.4.11.9) 0.9855 203 381 GO:0004177
GO:0005829
GO:0006508
GO:0046872
AF-A0A521PJ32-F1-model_v4 Xaa-Pro aminopeptidase (EC 3.4.11.9) 0.9853 217 437 GO:0004177
GO:0005829
GO:0006508
GO:0046872
AF-A0A7Y7AV82-F1-model_v4 deleted 0.981 250 437
AF-A0A3M2BWW8-F1-model_v4 Xaa-Pro aminopeptidase (EC 3.4.11.9) 0.9776 214 435 GO:0004177
GO:0005829
GO:0006508
GO:0008235
AF-A0A800EEM3-F1-model_v4 deleted 0.9773 266 434

Feature Viewer

pLDDT pTM Quality
93.72 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map