F467982

General Info

Members Datasets Scaffolds Average Seq Length
600 214 562 226

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10081795|Ga0213871_100817951
Length 223
Sequence MNVLMVLTSHDQLGDTGRKTGFWLEELAAPYYVFRDAGAQITLASPKGGRPPLDPKSNDPSFQTDLTRRFEKDADANARLDSVKQEDYDTVFYPGGHGPMWDLAEDKHSIKLLESFLAAGKTIALVCHAPGVLRHVKTPDGKPLVNGKTVTGFTNGEEAEVELTKVVPFLVEDELMRLGAIFSKVKNWGVHTVTDGQLITGQNPASSGPAAKVLIDTLKKKAK

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
4 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
5 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
6 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
7 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
8 2643221664 Massilia sp. Root418 Isolate Unclassified
9 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
10 2738541297 Duganella sp. GV083 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738541357 Duganella sp. GV053 Isolate Unclassified
13 2738543003 Duganella sp. GV066 Isolate Unclassified
14 2738543026 Duganella sp. GV089 Isolate Unclassified
15 2738543029 Duganella sp. GV039 Isolate Unclassified
16 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
17 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
18 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
19 2842711865 Duganella sp. R-73148 Isolate Unclassified
20 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
21 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
22 2857553236 Duganella sp. R-74557 Isolate Unclassified
23 2857558681 Duganella sp. R-74565 Isolate Unclassified
24 2865014394 Pantoea sp. R-71966 Isolate Unclassified
25 2876601092 Pantoea endophytica 596 Isolate Unclassified
26 2904424332 Duganella sp. 1411 Isolate Rhizosphere
27 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
28 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
29 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
71 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
72 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
73 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
74 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
90 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
93 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
204 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
212 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
213 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
214 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0.67
Rhizoplane 1.33
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000910 3300002737 Bacteria 19112
2 JGI25164J39214_1000673 3300002772 Bacteria 13723
3 JGI25151J46595_10000357 3300003187 Bacteria 48666
4 JGI25165J46597_1000982 3300003214 Bacteria 19112
5 Ga0055539_1009005 3300003752 Bacteria 1243
6 Ga0058692_1000208 3300003856 Bacteria 35014
7 Ga0065714_10066983 3300005288 Bacteria 6030
8 Ga0070663_100042245 3300005455 Bacteria 3203
9 Ga0081455_10004476 3300005937 Bacteria 15647
10 Ga0070717_10044374 3300006028 Bacteria 3630
11 Ga0075364_10032718 3300006051 Bacteria 3344
12 Ga0075362_10055929 3300006177 Bacteria 1775
13 Ga0079104_1001024 3300006946 Bacteria 21528
14 Ga0105244_10001177 3300009036 Bacteria 21645
15 Ga0105244_10001181 3300009036 Bacteria 21615
16 Ga0105244_10005798 3300009036 Bacteria 8126
17 Ga0105244_10065536 3300009036 Bacteria 1819
18 Ga0105244_10069878 3300009036 Bacteria 1753
19 Ga0105243_10032197 3300009148 Bacteria 4049
20 Ga0105246_10026033 3300011119 Bacteria 3817
21 Ga0105246_10033481 3300011119 Bacteria 3416
22 Ga0105246_10113508 3300011119 Bacteria 1995
23 Ga0157373_10002972 3300013100 Bacteria 12841
24 Ga0157371_10005670 3300013102 Bacteria 10480
25 Ga0157370_10006965 3300013104 Bacteria 12348
26 Ga0157370_10102573 3300013104 Bacteria 2678
27 Ga0157370_10586365 3300013104 Bacteria 1021
28 Ga0157369_10128276 3300013105 Bacteria 2688
29 Ga0163162_10121507 3300013306 Bacteria 2716
30 Ga0163162_11021440 3300013306 Bacteria 935
31 Ga0157372_10046242 3300013307 Bacteria 4831
32 Ga0157372_10141711 3300013307 Bacteria 2770
33 Ga0182008_10010735 3300014497 Bacteria 4894
34 Ga0182006_1037263 3300015261 Bacteria 1928
35 Ga0182006_1073339 3300015261 Bacteria 1263
36 Ga0182007_10000404 3300015262 Bacteria 26657
37 Ga0163161_10004221 3300017792 Bacteria 10032
38 Ga0163161_10180389 3300017792 Bacteria 1618
39 Ga0213871_10081795 3300021441 Bacteria 926
40 Ga0213871_10110368 3300021441 Bacteria 813
41 Ga0207427_100143 3300025231 Bacteria 82800
42 Ga0209437_100255 3300025233 Bacteria 82963
43 Ga0209677_100786 3300025253 Bacteria 15957
44 Ga0209233_1000172 3300025261 Bacteria 146504
45 Ga0209025_1000003 3300025294 Bacteria 1366495
46 Ga0207696_1000042 3300025711 Bacteria 307256
47 Ga0207696_1010401 3300025711 Bacteria 3411
48 Ga0207655_1001865 3300025728 Bacteria 18163
49 Ga0207655_1005408 3300025728 Bacteria 8690
50 Ga0207655_1010470 3300025728 Bacteria 5619
51 Ga0207655_1049673 3300025728 Bacteria 1710
52 Ga0207649_10251677 3300025920 Bacteria 1273
53 Ga0207709_10019327 3300025935 Bacteria 3828
54 Ga0207678_10438855 3300026067 Bacteria 1134
55 Ga0209371_1000134 3300027312 Bacteria 121747
56 Ga0209371_1001258 3300027312 Bacteria 18008
57 Ga0209371_1013374 3300027312 Bacteria 2309
58 Ga0268266_10000356 3300028379 Bacteria 70908
59 Ga0265338_10002816 3300028800 Bacteria 25386
60 Ga0268256_1000790 3300030500 Bacteria 22804
61 Ga0268256_1015855 3300030500 Bacteria 2182
62 Ga0316176_1135288 3300030732 Bacteria 1570
63 Ga0314311_1021826 3300030733 Bacteria 3757
64 Ga0316183_1023281 3300030742 Bacteria 3470
65 Ga0316181_1287062 3300030744 Bacteria 2408
66 Ga0307405_10029935 3300031731 Bacteria 3187
67 Ga0307405_10213491 3300031731 Bacteria 1410
68 Ga0307518_10078044 3300031838 Bacteria 2392
69 Ga0307406_10002013 3300031901 Bacteria 11095
70 Ga0307407_10275758 3300031903 Bacteria 1162
71 Ga0307412_10204595 3300031911 Bacteria 1501
72 Ga0307409_100194322 3300031995 Bacteria 1809
73 Ga0307414_10516444 3300032004 Bacteria 1059
74 Ga0307411_10166935 3300032005 Bacteria 1655
75 Ga0316574_0024662 3300035398 Bacteria 3603
76 Ga0395905_0057923 3300037471 Bacteria 3624
77 Ga0436364_1370784 3300037853 Bacteria 2668
78 Ga0436360_0084702 3300039438 Bacteria 1509
79 Ga0436361_0646404 3300039447 Bacteria 2082
80 Ga0436361_0666781 3300039447 Bacteria 1587
81 Ga0439438_000035 3300041405 Bacteria 67105
82 Ga0439438_000082 3300041405 Bacteria 44059
83 Ga0439438_003497 3300041405 Bacteria 6342
84 Ga0439447_001625 3300041407 Bacteria 8245
85 Ga0439432_000585 3300042006 Bacteria 13726
86 Ga0439452_005262 3300042010 Bacteria 4195
87 Ga0450907_001474 3300042146 Bacteria 5070
88 Ga0439464_0014971 3300042439 Bacteria 2090
89 Ga0453684_0030363 3300044712 Bacteria 7636
90 Ga0466958_0238699 3300045836 Bacteria 1161
91 Ga0495617_000020 3300046452 Bacteria 230257
92 Ga0495617_000028 3300046452 Bacteria 156686
93 Ga0495617_029577 3300046452 Bacteria 1842
94 Ga0495617_051688 3300046452 Bacteria 1366
95 Ga0495627_000007 3300046453 Bacteria 575915
96 Ga0495627_003944 3300046453 Bacteria 6345
97 Ga0495627_004183 3300046453 Bacteria 6117
98 Ga0495627_027052 3300046453 Bacteria 1844
99 Ga0495627_096263 3300046453 Bacteria 848
100 Ga0495627_105823 3300046453 Bacteria 800
101 Ga0495592_0024462 3300046454 Bacteria 4590
102 Ga0495603_0025463 3300046455 Bacteria 3578
103 Ga0495590_0000001 3300046457 Bacteria 762984
104 Ga0495590_0000013 3300046457 Bacteria 271977
105 Ga0495590_0114518 3300046457 Bacteria 964
106 Ga0495591_000013 3300046458 Bacteria 268106
107 Ga0495591_000109 3300046458 Bacteria 94877
108 Ga0495591_000679 3300046458 Bacteria 24877
109 Ga0495591_002214 3300046458 Bacteria 11088
110 Ga0495591_005630 3300046458 Bacteria 5746
111 Ga0495591_019299 3300046458 Bacteria 2286
112 Ga0495591_023665 3300046458 Bacteria 1963
113 Ga0495591_039494 3300046458 Bacteria 1352
114 Ga0495629_0007591 3300046459 Bacteria 7990
115 Ga0495629_0098855 3300046459 Bacteria 2036
116 Ga0495638_0000184 3300046460 Bacteria 95341
117 Ga0495641_0121045 3300046461 Bacteria 1168
118 Ga0495651_0001767 3300046462 Bacteria 16687
119 Ga0495653_0000082 3300046463 Bacteria 80285
120 Ga0495653_0007736 3300046463 Bacteria 8794
121 Ga0495653_0014301 3300046463 Bacteria 6471
122 Ga0495653_0017087 3300046463 Bacteria 5902
123 Ga0495653_0040476 3300046463 Bacteria 3641
124 Ga0495650_0000001 3300046471 Bacteria 1085492
125 Ga0495650_0000033 3300046471 Bacteria 412188
126 Ga0495650_0000108 3300046471 Bacteria 200369
127 Ga0495650_0000462 3300046471 Bacteria 63149
128 Ga0495650_0000643 3300046471 Bacteria 46325
129 Ga0495650_0002761 3300046471 Bacteria 13545
130 Ga0495650_0022896 3300046471 Bacteria 2986
131 Ga0495580_0003497 3300046472 Bacteria 13364
132 Ga0495580_0117528 3300046472 Bacteria 1846
133 Ga0495605_0000008 3300046474 Bacteria 334602
134 Ga0495605_0000056 3300046474 Bacteria 155610
135 Ga0495605_0006763 3300046474 Bacteria 6553
136 Ga0495605_0025453 3300046474 Bacteria 3084
137 Ga0495605_0026465 3300046474 Bacteria 3015
138 Ga0495605_0041710 3300046474 Bacteria 2285
139 Ga0495605_0137784 3300046474 Bacteria 1096
140 Ga0495605_0213141 3300046474 Bacteria 837
141 Ga0495664_0031270 3300046477 Bacteria 3120
142 Ga0495584_0000074 3300046491 Bacteria 71485
143 Ga0495584_0000158 3300046491 Bacteria 47396
144 Ga0495584_0012453 3300046491 Bacteria 4341
145 Ga0495584_0021973 3300046491 Bacteria 3239
146 Ga0495584_0028083 3300046491 Bacteria 2849
147 Ga0495584_0043918 3300046491 Bacteria 2256
148 Ga0495584_0058764 3300046491 Bacteria 1934
149 Ga0495584_0125781 3300046491 Bacteria 1299
150 Ga0495585_0000048 3300046492 Bacteria 120031
151 Ga0495585_0000424 3300046492 Bacteria 40738
152 Ga0495585_0000726 3300046492 Bacteria 29412
153 Ga0495585_0005179 3300046492 Bacteria 8275
154 Ga0495585_0014320 3300046492 Bacteria 4622
155 Ga0495585_0040925 3300046492 Bacteria 2600
156 Ga0495585_0108897 3300046492 Bacteria 1475
157 Ga0495585_0136357 3300046492 Bacteria 1288
158 Ga0495585_0186631 3300046492 Bacteria 1063
159 Ga0495594_0000625 3300046499 Bacteria 18226
160 Ga0495594_0013754 3300046499 Bacteria 4229
161 Ga0495594_0028369 3300046499 Bacteria 3020
162 Ga0495596_0003828 3300046500 Bacteria 7487
163 Ga0495596_0006325 3300046500 Bacteria 5468
164 Ga0495596_0007719 3300046500 Bacteria 4834
165 Ga0495596_0019847 3300046500 Bacteria 2756
166 Ga0495596_0025226 3300046500 Bacteria 2404
167 Ga0495596_0050990 3300046500 Bacteria 1621
168 Ga0495596_0194825 3300046500 Bacteria 787
169 Ga0495607_0000324 3300046501 Bacteria 49450
170 Ga0495607_0000479 3300046501 Bacteria 40004
171 Ga0495607_0001178 3300046501 Bacteria 23602
172 Ga0495607_0001248 3300046501 Bacteria 22826
173 Ga0495607_0002143 3300046501 Bacteria 16463
174 Ga0495607_0002148 3300046501 Bacteria 16437
175 Ga0495607_0004315 3300046501 Bacteria 10490
176 Ga0495607_0028018 3300046501 Bacteria 3479
177 Ga0495607_0080935 3300046501 Bacteria 1784
178 Ga0495607_0268541 3300046501 Bacteria 814
179 Ga0495583_0000039 3300046506 Bacteria 241501
180 Ga0495583_0000119 3300046506 Bacteria 133447
181 Ga0495583_0001888 3300046506 Bacteria 19427
182 Ga0495583_0008530 3300046506 Bacteria 6253
183 Ga0495583_0013518 3300046506 Bacteria 4549
184 Ga0495583_0054230 3300046506 Bacteria 1816
185 Ga0495583_0121013 3300046506 Bacteria 1102
186 Ga0495606_0000007 3300046507 Bacteria 323713
187 Ga0495606_0000070 3300046507 Bacteria 177343
188 Ga0495606_0000161 3300046507 Bacteria 117607
189 Ga0495606_0000408 3300046507 Bacteria 72620
190 Ga0495606_0000440 3300046507 Bacteria 68395
191 Ga0495606_0001523 3300046507 Bacteria 30685
192 Ga0495606_0004327 3300046507 Bacteria 14287
193 Ga0495606_0012272 3300046507 Bacteria 6892
194 Ga0495606_0013928 3300046507 Bacteria 6311
195 Ga0495606_0078854 3300046507 Bacteria 2053
196 Ga0495606_0190110 3300046507 Bacteria 1177
197 Ga0495608_0018485 3300046511 Bacteria 4807
198 Ga0495610_0000014 3300046512 Bacteria 444708
199 Ga0495610_0000313 3300046512 Bacteria 51404
200 Ga0495610_0005896 3300046512 Bacteria 8585
201 Ga0495610_0007336 3300046512 Bacteria 7368
202 Ga0495610_0015587 3300046512 Bacteria 4408
203 Ga0495610_0018777 3300046512 Bacteria 3889
204 Ga0495616_0000273 3300046513 Bacteria 41880
205 Ga0495616_0000705 3300046513 Bacteria 24761
206 Ga0495616_0003218 3300046513 Bacteria 10525
207 Ga0495616_0005194 3300046513 Bacteria 8056
208 Ga0495616_0032621 3300046513 Bacteria 2718
209 Ga0495616_0111219 3300046513 Bacteria 1272
210 Ga0495616_0206469 3300046513 Bacteria 861
211 Ga0495618_0003519 3300046514 Bacteria 9728
212 Ga0495620_0000046 3300046515 Bacteria 108205
213 Ga0495620_0000068 3300046515 Bacteria 86731
214 Ga0495628_0036114 3300046516 Bacteria 3968
215 Ga0495630_0002157 3300046517 Bacteria 13699
216 Ga0495631_0002669 3300046518 Bacteria 9929
217 Ga0495631_0003716 3300046518 Bacteria 8322
218 Ga0495631_0004385 3300046518 Bacteria 7517
219 Ga0495631_0006672 3300046518 Bacteria 5935
220 Ga0495631_0015151 3300046518 Bacteria 3703
221 Ga0495631_0015402 3300046518 Bacteria 3665
222 Ga0495631_0076168 3300046518 Bacteria 1448
223 Ga0495631_0137187 3300046518 Bacteria 1050
224 Ga0495631_0215214 3300046518 Bacteria 820
225 Ga0495632_0000503 3300046519 Bacteria 36843
226 Ga0495632_0000555 3300046519 Bacteria 34929
227 Ga0495632_0001943 3300046519 Bacteria 16506
228 Ga0495632_0034670 3300046519 Bacteria 2580
229 Ga0495637_0000008 3300046520 Bacteria 404658
230 Ga0495637_0000443 3300046520 Bacteria 30281
231 Ga0495637_0000528 3300046520 Bacteria 27567
232 Ga0495637_0005975 3300046520 Bacteria 6156
233 Ga0495637_0114357 3300046520 Bacteria 1043
234 Ga0495643_0000361 3300046522 Bacteria 61853
235 Ga0495643_0000459 3300046522 Bacteria 51854
236 Ga0495643_0000505 3300046522 Bacteria 48848
237 Ga0495643_0021148 3300046522 Bacteria 3738
238 Ga0495643_0024129 3300046522 Bacteria 3452
239 Ga0495643_0033376 3300046522 Bacteria 2848
240 Ga0495643_0038355 3300046522 Bacteria 2624
241 Ga0495643_0043129 3300046522 Bacteria 2456
242 Ga0495643_0153271 3300046522 Bacteria 1139
243 Ga0495644_0010652 3300046523 Bacteria 3541
244 Ga0495644_0013925 3300046523 Bacteria 3083
245 Ga0495644_0021679 3300046523 Bacteria 2449
246 Ga0495644_0108511 3300046523 Bacteria 1052
247 Ga0495648_0000001 3300046524 Bacteria 696872
248 Ga0495648_0001043 3300046524 Bacteria 28117
249 Ga0495648_0001083 3300046524 Bacteria 27678
250 Ga0495648_0011562 3300046524 Bacteria 6639
251 Ga0495648_0012949 3300046524 Bacteria 6194
252 Ga0495648_0018753 3300046524 Bacteria 4884
253 Ga0495648_0019418 3300046524 Bacteria 4778
254 Ga0495648_0021220 3300046524 Bacteria 4505
255 Ga0495648_0055877 3300046524 Bacteria 2378
256 Ga0495663_0001261 3300046525 Bacteria 8044
257 Ga0495666_0000847 3300046526 Bacteria 14183
258 Ga0495666_0001810 3300046526 Bacteria 10562
259 Ga0495666_0123782 3300046526 Bacteria 1210
260 Ga0495642_0000191 3300046528 Bacteria 36297
261 Ga0495642_0001888 3300046528 Bacteria 8929
262 Ga0495642_0004660 3300046528 Bacteria 5312
263 Ga0495642_0007488 3300046528 Bacteria 4182
264 Ga0495642_0011959 3300046528 Bacteria 3342
265 Ga0495642_0031155 3300046528 Bacteria 2137
266 Ga0495642_0066632 3300046528 Bacteria 1501
267 Ga0495642_0113602 3300046528 Bacteria 1159
268 Ga0495642_0200825 3300046528 Bacteria 869
269 Ga0495652_0003824 3300046529 Bacteria 14696
270 Ga0495652_0352060 3300046529 Bacteria 1055
271 Ga0495654_0000002 3300046530 Bacteria 1021205
272 Ga0495654_0000020 3300046530 Bacteria 284814
273 Ga0495654_0000038 3300046530 Bacteria 185693
274 Ga0495654_0000041 3300046530 Bacteria 174733
275 Ga0495654_0000807 3300046530 Bacteria 24034
276 Ga0495654_0001662 3300046530 Bacteria 15055
277 Ga0495654_0003890 3300046530 Bacteria 9027
278 Ga0495654_0012222 3300046530 Bacteria 4618
279 Ga0495654_0012437 3300046530 Bacteria 4570
280 Ga0495654_0047148 3300046530 Bacteria 2119
281 Ga0495665_0007388 3300046531 Bacteria 5941
282 Ga0495665_0017320 3300046531 Bacteria 3875
283 Ga0495640_0000889 3300046533 Bacteria 22941
284 Ga0495640_0149961 3300046533 Bacteria 1499
285 Ga0495640_0476140 3300046533 Bacteria 761
286 Ga0495586_0015854 3300046535 Bacteria 4008
287 Ga0495587_0007121 3300046536 Bacteria 7256
288 Ga0495587_0080390 3300046536 Bacteria 1889
289 Ga0495609_0000031 3300046538 Bacteria 213813
290 Ga0495609_0000095 3300046538 Bacteria 104807
291 Ga0495609_0001197 3300046538 Bacteria 17857
292 Ga0495609_0004440 3300046538 Bacteria 7669
293 Ga0495609_0007887 3300046538 Bacteria 5263
294 Ga0495609_0030218 3300046538 Bacteria 2466
295 Ga0495609_0032900 3300046538 Bacteria 2354
296 Ga0495609_0035465 3300046538 Bacteria 2258
297 Ga0495609_0036430 3300046538 Bacteria 2221
298 Ga0495609_0064384 3300046538 Bacteria 1617
299 Ga0495597_0004891 3300046542 Bacteria 7210
300 Ga0495597_0012324 3300046542 Bacteria 4125
301 Ga0495622_0000276 3300046557 Bacteria 39002
302 Ga0495622_0020782 3300046557 Bacteria 3056
303 Ga0495633_0000011 3300046558 Bacteria 268237
304 Ga0495633_0000132 3300046558 Bacteria 100231
305 Ga0495633_0000171 3300046558 Bacteria 86031
306 Ga0495633_0000792 3300046558 Bacteria 28178
307 Ga0495633_0002160 3300046558 Bacteria 14100
308 Ga0495633_0007057 3300046558 Bacteria 6540
309 Ga0495633_0064061 3300046558 Bacteria 1719
310 Ga0495656_0022925 3300046615 Bacteria 2451
311 Ga0495656_0122377 3300046615 Bacteria 1230
312 Ga0495656_0216678 3300046615 Bacteria 956
313 Ga0495656_0294489 3300046615 Bacteria 830
314 Ga0495668_0000146 3300046616 Bacteria 106276
315 Ga0495668_0000487 3300046616 Bacteria 49686
316 Ga0495668_0000579 3300046616 Bacteria 44604
317 Ga0495668_0011759 3300046616 Bacteria 5222
318 Ga0495668_0027156 3300046616 Bacteria 3244
319 Ga0495668_0054328 3300046616 Bacteria 2214
320 Ga0495668_0288307 3300046616 Bacteria 899
321 Ga0495634_0001994 3300046642 Bacteria 17391
322 Ga0495634_0023001 3300046642 Bacteria 4387
323 Ga0495611_0000214 3300046648 Bacteria 40851
324 Ga0495611_0002426 3300046648 Bacteria 8535
325 Ga0495611_0003086 3300046648 Bacteria 7397
326 Ga0495611_0005403 3300046648 Bacteria 5467
327 Ga0495611_0247343 3300046648 Bacteria 827
328 Ga0495625_0000483 3300046660 Bacteria 59571
329 Ga0495625_0020252 3300046660 Bacteria 5139
330 Ga0495625_0034279 3300046660 Bacteria 3747
331 Ga0495625_0063553 3300046660 Bacteria 2606
332 Ga0495625_0066735 3300046660 Bacteria 2534
333 Ga0495625_0206263 3300046660 Bacteria 1294
334 Ga0495625_0301861 3300046660 Bacteria 1024
335 Ga0495635_0022236 3300046663 Bacteria 4416
336 Ga0495635_0104832 3300046663 Bacteria 1932
337 Ga0495661_0000012 3300046665 Bacteria 276804
338 Ga0495661_0000493 3300046665 Bacteria 41154
339 Ga0495661_0000591 3300046665 Bacteria 37505
340 Ga0495661_0001091 3300046665 Bacteria 23846
341 Ga0495661_0002208 3300046665 Bacteria 15179
342 Ga0495661_0002775 3300046665 Bacteria 13270
343 Ga0495661_0002864 3300046665 Bacteria 13046
344 Ga0495661_0009220 3300046665 Bacteria 6782
345 Ga0495661_0011222 3300046665 Bacteria 6080
346 Ga0495661_0030741 3300046665 Bacteria 3417
347 Ga0495661_0049395 3300046665 Bacteria 2551
348 Ga0495661_0057056 3300046665 Bacteria 2333
349 Ga0495661_0064923 3300046665 Bacteria 2152
350 Ga0495661_0122667 3300046665 Bacteria 1433
351 Ga0495588_0005068 3300046674 Bacteria 5851
352 Ga0495588_0012626 3300046674 Bacteria 3998
353 Ga0495588_0077750 3300046674 Bacteria 1731
354 Ga0495588_0100825 3300046674 Bacteria 1517
355 Ga0495599_0016376 3300046678 Bacteria 4602
356 Ga0495623_0003308 3300046679 Bacteria 10650
357 Ga0495623_0005569 3300046679 Bacteria 8222
358 Ga0495623_0014267 3300046679 Bacteria 5147
359 Ga0495623_0203120 3300046679 Bacteria 1138
360 Ga0495646_0001168 3300046680 Bacteria 15336
361 Ga0495669_0005169 3300046684 Bacteria 5427
362 Ga0495669_0008660 3300046684 Bacteria 4281
363 Ga0495613_0029128 3300046689 Bacteria 4105
364 Ga0495613_0092323 3300046689 Bacteria 2192
365 Ga0495624_0002313 3300046690 Bacteria 14509
366 Ga0495624_0247337 3300046690 Bacteria 1079
367 Ga0495670_0004445 3300046691 Bacteria 6879
368 Ga0495670_0007409 3300046691 Bacteria 5389
369 Ga0495670_0017252 3300046691 Bacteria 3552
370 Ga0495670_0057396 3300046691 Bacteria 1954
371 Ga0495670_0162235 3300046691 Bacteria 1175
372 Ga0495670_0172886 3300046691 Bacteria 1138
373 Ga0495670_0226107 3300046691 Bacteria 994
374 Ga0495671_0000005 3300046692 Bacteria 509397
375 Ga0495671_0007573 3300046692 Bacteria 6176
376 Ga0495671_0009682 3300046692 Bacteria 5374
377 Ga0495671_0014256 3300046692 Bacteria 4283
378 Ga0495671_0033699 3300046692 Bacteria 2607
379 Ga0495671_0046775 3300046692 Bacteria 2163
380 Ga0495671_0054682 3300046692 Bacteria 1978
381 Ga0495671_0067057 3300046692 Bacteria 1765
382 Ga0495649_0000535 3300046694 Bacteria 32186
383 Ga0495649_0096039 3300046694 Bacteria 1577
384 Ga0495649_0237063 3300046694 Bacteria 940
385 Ga0495589_0000007 3300046794 Bacteria 276444
386 Ga0495589_0000054 3300046794 Bacteria 111355
387 Ga0495589_0000293 3300046794 Bacteria 40161
388 Ga0495589_0000550 3300046794 Bacteria 25890
389 Ga0495589_0001653 3300046794 Bacteria 12766
390 Ga0495589_0016350 3300046794 Bacteria 3814
391 Ga0495589_0017358 3300046794 Bacteria 3694
392 Ga0495589_0019173 3300046794 Bacteria 3509
393 Ga0495589_0043559 3300046794 Bacteria 2233
394 Ga0495589_0045759 3300046794 Bacteria 2173
395 Ga0495589_0120362 3300046794 Bacteria 1264
396 Ga0495589_0136818 3300046794 Bacteria 1174
397 Ga0495600_0000280 3300046809 Bacteria 27638
398 Ga0495600_0068268 3300046809 Bacteria 2323
399 Ga0495660_0000011 3300046810 Bacteria 361397
400 Ga0495660_0000055 3300046810 Bacteria 134615
401 Ga0495660_0000172 3300046810 Bacteria 69913
402 Ga0495660_0000779 3300046810 Bacteria 23870
403 Ga0495660_0002144 3300046810 Bacteria 12721
404 Ga0495660_0003099 3300046810 Bacteria 10364
405 Ga0495660_0024399 3300046810 Bacteria 3445
406 Ga0495660_0026237 3300046810 Bacteria 3304
407 Ga0495660_0061324 3300046810 Bacteria 2018
408 Ga0495660_0099465 3300046810 Bacteria 1499
409 Ga0495604_0008804 3300047317 Bacteria 7976
410 Ga0495604_0014677 3300047317 Bacteria 6244
411 Ga0495604_0050382 3300047317 Bacteria 3233
412 Ga0495636_0219534 3300047318 Bacteria 872
413 Ga0495674_0003883 3300047319 Bacteria 14514
414 Ga0495672_0000004 3300047320 Bacteria 631810
415 Ga0495672_0000013 3300047320 Bacteria 511827
416 Ga0495672_0000032 3300047320 Bacteria 295356
417 Ga0495672_0000033 3300047320 Bacteria 291992
418 Ga0495672_0000096 3300047320 Bacteria 143686
419 Ga0495672_0000386 3300047320 Bacteria 54325
420 Ga0495672_0000580 3300047320 Bacteria 41398
421 Ga0495672_0016673 3300047320 Bacteria 4936
422 Ga0495672_0130749 3300047320 Bacteria 1321
423 Ga0495672_0218796 3300047320 Bacteria 941
424 Ga0495676_0000273 3300047321 Bacteria 41772
425 Ga0495676_0077590 3300047321 Bacteria 2533
426 Ga0495680_0003145 3300047322 Bacteria 16453
427 Ga0495680_0003552 3300047322 Bacteria 15283
428 Ga0495683_0000114 3300047323 Bacteria 82525
429 Ga0495683_0000301 3300047323 Bacteria 41920
430 Ga0495683_0000345 3300047323 Bacteria 38519
431 Ga0495683_0000819 3300047323 Bacteria 22130
432 Ga0495683_0019864 3300047323 Bacteria 3465
433 Ga0495683_0042630 3300047323 Bacteria 2287
434 Ga0495683_0043935 3300047323 Bacteria 2248
435 Ga0495683_0074368 3300047323 Bacteria 1665
436 Ga0495683_0101924 3300047323 Bacteria 1379
437 Ga0495687_000003 3300047443 Bacteria 859509
438 Ga0495687_000474 3300047443 Bacteria 48718
439 Ga0495687_000704 3300047443 Bacteria 37263
440 Ga0495687_000843 3300047443 Bacteria 32659
441 Ga0495687_003092 3300047443 Bacteria 12465
442 Ga0495675_0000447 3300047444 Bacteria 27413
443 Ga0495675_0005942 3300047444 Bacteria 7460
444 Ga0495675_0242883 3300047444 Bacteria 1083
445 Ga0495677_0000005 3300047445 Bacteria 243336
446 Ga0495677_0000270 3300047445 Bacteria 22801
447 Ga0495677_0001551 3300047445 Bacteria 9265
448 Ga0495677_0002228 3300047445 Bacteria 7669
449 Ga0495677_0003101 3300047445 Bacteria 6473
450 Ga0495677_0010955 3300047445 Bacteria 3321
451 Ga0495677_0047928 3300047445 Bacteria 1569
452 Ga0495677_0085060 3300047445 Bacteria 1188
453 Ga0495677_0128430 3300047445 Bacteria 969
454 Ga0495679_000043 3300047446 Bacteria 142160
455 Ga0495679_000304 3300047446 Bacteria 39542
456 Ga0495679_002632 3300047446 Bacteria 9014
457 Ga0495679_005248 3300047446 Bacteria 5779
458 Ga0495685_045432 3300047447 Bacteria 1496
459 Ga0495673_0000009 3300047469 Bacteria 731993
460 Ga0495673_0000023 3300047469 Bacteria 539904
461 Ga0495673_0000028 3300047469 Bacteria 473418
462 Ga0495673_0016244 3300047469 Bacteria 3811
463 Ga0495673_0018474 3300047469 Bacteria 3513
464 Ga0495681_0002816 3300047470 Bacteria 12304
465 Ga0495681_0004589 3300047470 Bacteria 9404
466 Ga0495681_0012673 3300047470 Bacteria 4941
467 Ga0495681_0017640 3300047470 Bacteria 3956
468 Ga0495681_0018426 3300047470 Bacteria 3846
469 Ga0495681_0020104 3300047470 Bacteria 3629
470 Ga0495681_0132112 3300047470 Bacteria 1061
471 Ga0495684_0072338 3300047471 Bacteria 2620
472 Ga0495686_0000054 3300047472 Bacteria 259400
473 Ga0495686_0001166 3300047472 Bacteria 30748
474 Ga0495686_0015119 3300047472 Bacteria 5286
475 Ga0495686_0055268 3300047472 Bacteria 2483
476 Ga0495686_0311015 3300047472 Bacteria 866
477 Ga0495593_0001373 3300047673 Bacteria 14235
478 Ga0495593_0006309 3300047673 Bacteria 6955
479 Ga0495602_0003973 3300048088 Bacteria 15405
480 Ga0495602_0202551 3300048088 Bacteria 1513
481 Ga0495614_0026580 3300048089 Bacteria 2495
482 Ga0495626_0000017 3300048091 Bacteria 231648
483 Ga0495626_0000053 3300048091 Bacteria 155543
484 Ga0495626_0000543 3300048091 Bacteria 37476
485 Ga0495626_0001020 3300048091 Bacteria 24084
486 Ga0495626_0007202 3300048091 Bacteria 6218
487 Ga0495626_0014143 3300048091 Bacteria 4128
488 Ga0495626_0030393 3300048091 Bacteria 2605
489 Ga0495626_0051413 3300048091 Bacteria 1900
490 Ga0495626_0131097 3300048091 Bacteria 1070
491 Ga0496100_0593667 3300048903 Bacteria 859
492 Ga0496101_0000324 3300048904 Bacteria 32661
493 Ga0496101_0002266 3300048904 Bacteria 11752
494 Ga0496103_0003365 3300048906 Bacteria 9782
495 Ga0496105_0024276 3300048908 Bacteria 4927
496 Ga0496111_0002901 3300048914 Bacteria 10472
497 Ga0496114_0024682 3300048917 Bacteria 4908
498 Ga0496116_0013844 3300048919 Bacteria 6476
499 Ga0496116_0022952 3300048919 Bacteria 4658
500 Ga0496116_0113161 3300048919 Bacteria 1589
501 Ga0496117_0000145 3300048920 Bacteria 153289
502 Ga0496117_0007273 3300048920 Bacteria 10879
503 Ga0496117_0129892 3300048920 Bacteria 1529
504 Ga0496118_0000397 3300048921 Bacteria 73353
505 Ga0496118_0094118 3300048921 Bacteria 2050
506 Ga0496118_0171283 3300048921 Bacteria 1326
507 Ga0496119_0023566 3300048922 Bacteria 4358
508 Ga0496120_0001585 3300048923 Bacteria 26456
509 Ga0496120_0066232 3300048923 Bacteria 1998
510 Ga0496121_0007569 3300048924 Bacteria 13079
511 Ga0496121_0014071 3300048924 Bacteria 8535
512 Ga0496121_0029716 3300048924 Bacteria 5042
513 Ga0496122_0008873 3300048925 Bacteria 10722
514 Ga0496122_0014290 3300048925 Bacteria 7689
515 Ga0496122_0030935 3300048925 Bacteria 4470
516 Ga0496122_0107965 3300048925 Bacteria 1837
517 Ga0496123_0002194 3300048926 Bacteria 24832
518 Ga0496123_0002866 3300048926 Bacteria 20263
519 Ga0496123_0007807 3300048926 Bacteria 9961
520 Ga0496123_0114638 3300048926 Bacteria 1531
521 Ga0496124_0005010 3300048927 Bacteria 15149
522 Ga0496124_0022664 3300048927 Bacteria 5751
523 Ga0496124_0024811 3300048927 Bacteria 5443
524 Ga0496124_0039688 3300048927 Bacteria 4078
525 Ga0496124_0144447 3300048927 Bacteria 1874
526 Ga0496124_0146091 3300048927 Bacteria 1860
527 Ga0496124_0154806 3300048927 Bacteria 1794
528 Ga0496124_0284988 3300048927 Bacteria 1202
529 Ga0496124_0401940 3300048927 Bacteria 951
530 Ga0496125_0075693 3300048928 Bacteria 2603
531 Ga0496126_0000248 3300048929 Bacteria 116557
532 Ga0496126_0022569 3300048929 Bacteria 6119
533 Ga0496126_0030527 3300048929 Bacteria 5104
534 Ga0495678_000004 3300049459 Bacteria 532920
535 Ga0495678_000018 3300049459 Bacteria 279747
536 Ga0495678_000024 3300049459 Bacteria 229034
537 Ga0495678_000203 3300049459 Bacteria 69724
538 Ga0495678_000459 3300049459 Bacteria 40493
539 Ga0495678_000835 3300049459 Bacteria 27526
540 Ga0495678_002374 3300049459 Bacteria 12907
541 Ga0495678_002971 3300049459 Bacteria 10823
542 Ga0495678_007634 3300049459 Bacteria 5580
543 Ga0495678_015031 3300049459 Bacteria 3577
544 Ga0495678_041881 3300049459 Bacteria 1829
545 Ga0495678_064746 3300049459 Bacteria 1360
546 Ga0495682_0000004 3300049460 Bacteria 378337
547 Ga0495682_0000716 3300049460 Bacteria 21678
548 Ga0495682_0074820 3300049460 Bacteria 1218
549 Ga0495682_0104585 3300049460 Bacteria 1015
550 Ga0501222_000230 3300049662 Bacteria 9670
551 Ga0501269_000543 3300049766 Bacteria 7315
552 nmdc:mga03683_47888_c1 3300050489 Bacteria 1775
553 nmdc:mga00v17_108346_c1 3300050491 Bacteria 1760
554 Ga0500650_0000107 3300053098 Bacteria 22912
555 Ga0500618_000165 3300053125 Bacteria 55300
556 Ga0500618_000294 3300053125 Bacteria 38052
557 Ga0500618_002626 3300053125 Bacteria 6621
558 Ga0500618_017464 3300053125 Bacteria 1785
559 Ga0500621_000001 3300053126 Bacteria 1049698
560 Ga0500559_0000432 3300053136 Bacteria 29680
561 Ga0500559_0028463 3300053136 Bacteria 2388
562 Ga0500586_031043 3300053145 Bacteria 1761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10004476 Ga0081455_100044762 203
2 3300013307 Ga0157372_10141711 Ga0157372_101417112 213
3 3300046463 Ga0495653_0000082 Ga0495653_0000082_57918_58598 213
4 3300046492 Ga0495585_0000048 Ga0495585_0000048_98703_99383 213
5 3300046499 Ga0495594_0013754 Ga0495594_0013754_1379_2170 213
6 3300046500 Ga0495596_0019847 Ga0495596_0019847_2011_2691 213
7 3300046501 Ga0495607_0004315 Ga0495607_0004315_4129_4809 213
8 3300046507 Ga0495606_0000007 Ga0495606_0000007_15875_16555 213
9 3300046507 Ga0495606_0000161 Ga0495606_0000161_97773_98453 213
10 3300046518 Ga0495631_0006672 Ga0495631_0006672_2582_3373 213
11 3300046522 Ga0495643_0021148 Ga0495643_0021148_1827_2507 213
12 3300046522 Ga0495643_0153271 Ga0495643_0153271_282_962 213
13 3300046523 Ga0495644_0010652 Ga0495644_0010652_1971_2651 213
14 3300046528 Ga0495642_0000191 Ga0495642_0000191_27741_28421 213
15 3300046538 Ga0495609_0030218 Ga0495609_0030218_929_1609 213
16 3300046648 Ga0495611_0003086 Ga0495611_0003086_5097_5888 213
17 3300046665 Ga0495661_0009220 Ga0495661_0009220_447_1127 213
18 3300046665 Ga0495661_0011222 Ga0495661_0011222_1807_2487 213
19 3300046665 Ga0495661_0030741 Ga0495661_0030741_1729_2409 213
20 3300046674 Ga0495588_0077750 Ga0495588_0077750_665_1456 213
21 3300046674 Ga0495588_0100825 Ga0495588_0100825_18_698 213
22 3300046684 Ga0495669_0008660 Ga0495669_0008660_328_1119 213
23 3300046691 Ga0495670_0172886 Ga0495670_0172886_113_793 213
24 3300047318 Ga0495636_0219534 Ga0495636_0219534_152_832 213
25 3300047445 Ga0495677_0003101 Ga0495677_0003101_5564_6244 213
26 3300047445 Ga0495677_0085060 Ga0495677_0085060_456_1136 213
27 3300048091 Ga0495626_0051413 Ga0495626_0051413_979_1770 213
28 3300048919 Ga0496116_0113161 Ga0496116_0113161_518_1198 213
29 3300048921 Ga0496118_0171283 Ga0496118_0171283_366_1046 213
30 3300048925 Ga0496122_0030935 Ga0496122_0030935_2341_3021 213
31 3300048926 Ga0496123_0007807 Ga0496123_0007807_6322_7002 213
32 3300048927 Ga0496124_0401940 Ga0496124_0401940_240_920 213
33 3300046810 Ga0495660_0099465 Ga0495660_0099465_77_754 214
34 3300046452 Ga0495617_000020 Ga0495617_000020_216946_217626 215
35 3300046453 Ga0495627_105823 Ga0495627_105823_94_774 215
36 3300046471 Ga0495650_0000462 Ga0495650_0000462_44082_44762 215
37 3300046471 Ga0495650_0022896 Ga0495650_0022896_2177_2857 215
38 3300046492 Ga0495585_0000424 Ga0495585_0000424_25837_26517 215
39 3300046501 Ga0495607_0002143 Ga0495607_0002143_3688_4368 215
40 3300046507 Ga0495606_0000070 Ga0495606_0000070_75138_75818 215
41 3300046507 Ga0495606_0000440 Ga0495606_0000440_8266_8946 215
42 3300046512 Ga0495610_0000014 Ga0495610_0000014_39978_40658 215
43 3300046520 Ga0495637_0114357 Ga0495637_0114357_289_963 215
44 3300046524 Ga0495648_0001083 Ga0495648_0001083_25126_25806 215
45 3300046524 Ga0495648_0018753 Ga0495648_0018753_2544_3224 215
46 3300046530 Ga0495654_0003890 Ga0495654_0003890_1569_2249 215
47 3300046558 Ga0495633_0000132 Ga0495633_0000132_2548_3255 215
48 3300046616 Ga0495668_0000579 Ga0495668_0000579_31605_32285 215
49 3300046665 Ga0495661_0049395 Ga0495661_0049395_1303_1983 215
50 3300046692 Ga0495671_0000005 Ga0495671_0000005_408005_408685 215
51 3300046810 Ga0495660_0000779 Ga0495660_0000779_18103_18783 215
52 3300047446 Ga0495679_005248 Ga0495679_005248_4979_5659 215
53 3300047469 Ga0495673_0000009 Ga0495673_0000009_384947_385627 215
54 3300047472 Ga0495686_0000054 Ga0495686_0000054_84440_85120 215
55 3300053145 Ga0500586_031043 Ga0500586_031043_762_1442 215
56 3300046471 Ga0495650_0000001 Ga0495650_0000001_239400_240092 216
57 3300046522 Ga0495643_0043129 Ga0495643_0043129_1286_1966 216
58 3300047323 Ga0495683_0074368 Ga0495683_0074368_793_1473 216
59 3300046459 Ga0495629_0098855 Ga0495629_0098855_1232_1912 217
60 3300046463 Ga0495653_0007736 Ga0495653_0007736_653_1333 217
61 3300046535 Ga0495586_0015854 Ga0495586_0015854_3228_3908 217
62 3300046536 Ga0495587_0080390 Ga0495587_0080390_1149_1829 217
63 3300046663 Ga0495635_0022236 Ga0495635_0022236_499_1179 217
64 3300046689 Ga0495613_0092323 Ga0495613_0092323_414_1094 217
65 3300047317 Ga0495604_0014677 Ga0495604_0014677_919_1599 217
66 3300047322 Ga0495680_0003145 Ga0495680_0003145_8544_9224 217
67 3300047444 Ga0495675_0005942 Ga0495675_0005942_6025_6705 217
68 3300047673 Ga0495593_0006309 Ga0495593_0006309_334_1014 217
69 3300013104 Ga0157370_10586365 Ga0157370_105863651 218
70 3300003187 JGI25151J46595_10000357 JGI25151J46595_1000035719 219
71 3300021441 Ga0213871_10081795 Ga0213871_100817951 219
72 3300025294 Ga0209025_1000003 Ga0209025_1000003982 219
73 3300039438 Ga0436360_0084702 Ga0436360_0084702_532_1221 219
74 3300046520 Ga0495637_0000528 Ga0495637_0000528_21223_21903 219
75 3300046530 Ga0495654_0000038 Ga0495654_0000038_66523_67203 219
76 3300025920 Ga0207649_10251677 Ga0207649_102516771 220
77 3300046692 Ga0495671_0046775 Ga0495671_0046775_1071_1751 220
78 iso_pu_bacteria 2904479285 2904479304 220
79 3300041405 Ga0439438_000035 Ga0439438_000035_37869_38540 221
80 3300046453 Ga0495627_004183 Ga0495627_004183_1513_2184 221
81 3300046457 Ga0495590_0000001 Ga0495590_0000001_714342_715007 221
82 3300046458 Ga0495591_019299 Ga0495591_019299_966_1637 221
83 3300046471 Ga0495650_0002761 Ga0495650_0002761_11960_12631 221
84 3300046474 Ga0495605_0000008 Ga0495605_0000008_298889_299560 221
85 3300046499 Ga0495594_0000625 Ga0495594_0000625_2896_3567 221
86 3300046501 Ga0495607_0268541 Ga0495607_0268541_89_760 221
87 3300046506 Ga0495583_0000039 Ga0495583_0000039_34715_35386 221
88 3300046512 Ga0495610_0015587 Ga0495610_0015587_3006_3677 221
89 3300046515 Ga0495620_0000068 Ga0495620_0000068_34914_35585 221
90 3300046518 Ga0495631_0002669 Ga0495631_0002669_5546_6217 221
91 3300046524 Ga0495648_0021220 Ga0495648_0021220_2626_3297 221
92 3300046530 Ga0495654_0001662 Ga0495654_0001662_13938_14609 221
93 3300046538 Ga0495609_0000031 Ga0495609_0000031_12394_13065 221
94 3300046558 Ga0495633_0000011 Ga0495633_0000011_232957_233628 221
95 3300046616 Ga0495668_0000487 Ga0495668_0000487_2045_2710 221
96 3300046648 Ga0495611_0005403 Ga0495611_0005403_1238_1909 221
97 3300046665 Ga0495661_0000493 Ga0495661_0000493_34850_35521 221
98 3300046691 Ga0495670_0007409 Ga0495670_0007409_3134_3805 221
99 3300046692 Ga0495671_0067057 Ga0495671_0067057_312_983 221
100 3300046794 Ga0495589_0001653 Ga0495589_0001653_7707_8378 221
101 3300046810 Ga0495660_0024399 Ga0495660_0024399_1184_1855 221
102 3300047323 Ga0495683_0000345 Ga0495683_0000345_1250_1921 221
103 3300047446 Ga0495679_000043 Ga0495679_000043_106803_107474 221
104 3300047469 Ga0495673_0018474 Ga0495673_0018474_29_700 221
105 3300047470 Ga0495681_0012673 Ga0495681_0012673_3636_4307 221
106 3300048926 Ga0496123_0114638 Ga0496123_0114638_236_907 221
107 3300049459 Ga0495678_000018 Ga0495678_000018_244189_244860 221
108 3300049459 Ga0495678_015031 Ga0495678_015031_903_1568 221
109 3300050489 nmdc:mga03683_47888_c1 nmdc:mga03683_47888_c1_516_1181 221
110 iso_pu_bacteria 2508501125 2509127341 221
111 iso_pu_bacteria 2511231025 2511380504 221
112 iso_pu_bacteria 2511231035 2511432832 221
113 iso_pu_bacteria 2511231035 2511434499 221
114 iso_pu_bacteria 2513237351 2514588621 221
115 iso_pu_bacteria 2585427591 2585828802 221
116 iso_pu_bacteria 2585427592 2585834364 221
117 iso_pu_bacteria 2599185155 2599330559 221
118 iso_pu_bacteria 2718218334 2721025269 221
119 iso_pu_bacteria 2738541307 2738883045 221
120 iso_pu_bacteria 2775507266 2778178584 221
121 iso_pu_bacteria 2791355010 2792313856 221
122 iso_pu_bacteria 2811994881 2812367408 221
123 iso_pu_bacteria 2842711865 2842716776 221
124 iso_pu_bacteria 2842757796 2842760760 221
125 iso_pu_bacteria 2842914999 2842916087 221
126 iso_pu_bacteria 2857558681 2857563890 221
127 iso_pu_bacteria 2865014394 2865014803 221
128 iso_pu_bacteria 2923519811 2923521456 221
129 iso_pu_bacteria 8047673197 8047677433 221
130 3300046453 Ga0495627_003944 Ga0495627_003944_3089_3757 222
131 3300046491 Ga0495584_0043918 Ga0495584_0043918_811_1479 222
132 3300046492 Ga0495585_0186631 Ga0495585_0186631_314_985 222
133 3300046506 Ga0495583_0008530 Ga0495583_0008530_4451_5119 222
134 3300046506 Ga0495583_0054230 Ga0495583_0054230_665_1333 222
135 3300046513 Ga0495616_0005194 Ga0495616_0005194_4977_5645 222
136 3300046648 Ga0495611_0247343 Ga0495611_0247343_143_811 222
137 3300046691 Ga0495670_0017252 Ga0495670_0017252_1356_2024 222
138 3300046691 Ga0495670_0226107 Ga0495670_0226107_110_778 222
139 3300046692 Ga0495671_0007573 Ga0495671_0007573_4904_5572 222
140 3300047445 Ga0495677_0128430 Ga0495677_0128430_159_827 222
141 3300047470 Ga0495681_0002816 Ga0495681_0002816_4931_5599 222
142 iso_pu_bacteria 2643221664 2644354822 222
143 iso_pu_bacteria 2738541297 2738826353 222
144 iso_pu_bacteria 2738541357 2739150150 222
145 iso_pu_bacteria 2738543003 2739192069 222
146 iso_pu_bacteria 2738543026 2739318546 222
147 iso_pu_bacteria 2738543029 2739336787 222
148 iso_pu_bacteria 2857553236 2857554517 222
149 iso_pu_bacteria 2876601092 2876604240 222
150 iso_pu_bacteria 2904424332 2904426964 222
151 iso_pu_bacteria 8016733728 8016735924 222
152 iso_pu_bacteria 8019499862 8019500681 222
153 3300044712 Ga0453684_0030363 Ga0453684_0030363_4935_5609 224
154 3300046615 Ga0495656_0294489 Ga0495656_0294489_77_754 224
155 3300047469 Ga0495673_0000028 Ga0495673_0000028_248517_249194 224
156 3300002737 JGI25162J39368_1000910 JGI25162J39368_100091011 225
157 3300002772 JGI25164J39214_1000673 JGI25164J39214_10006732 225
158 3300003214 JGI25165J46597_1000982 JGI25165J46597_100098213 225
159 3300003752 Ga0055539_1009005 Ga0055539_10090051 225
160 3300003856 Ga0058692_1000208 Ga0058692_100020833 225
161 3300005288 Ga0065714_10066983 Ga0065714_100669836 225
162 3300005455 Ga0070663_100042245 Ga0070663_1000422453 225
163 3300006028 Ga0070717_10044374 Ga0070717_100443742 225
164 3300006051 Ga0075364_10032718 Ga0075364_100327184 225
165 3300006177 Ga0075362_10055929 Ga0075362_100559292 225
166 3300006946 Ga0079104_1001024 Ga0079104_10010247 225
167 3300009036 Ga0105244_10001177 Ga0105244_1000117712 225
168 3300009036 Ga0105244_10001181 Ga0105244_100011813 225
169 3300009036 Ga0105244_10005798 Ga0105244_100057984 225
170 3300009036 Ga0105244_10065536 Ga0105244_100655361 225
171 3300009036 Ga0105244_10069878 Ga0105244_100698781 225
172 3300009148 Ga0105243_10032197 Ga0105243_100321972 225
173 3300011119 Ga0105246_10026033 Ga0105246_100260334 225
174 3300011119 Ga0105246_10033481 Ga0105246_100334814 225
175 3300011119 Ga0105246_10113508 Ga0105246_101135082 225
176 3300013100 Ga0157373_10002972 Ga0157373_1000297210 225
177 3300013102 Ga0157371_10005670 Ga0157371_100056703 225
178 3300013104 Ga0157370_10006965 Ga0157370_1000696512 225
179 3300013104 Ga0157370_10102573 Ga0157370_101025733 225
180 3300013105 Ga0157369_10128276 Ga0157369_101282763 225
181 3300013306 Ga0163162_10121507 Ga0163162_101215073 225
182 3300013306 Ga0163162_11021440 Ga0163162_110214401 225
183 3300013307 Ga0157372_10046242 Ga0157372_100462425 225
184 3300014497 Ga0182008_10010735 Ga0182008_100107353 225
185 3300015261 Ga0182006_1037263 Ga0182006_10372631 225
186 3300015261 Ga0182006_1073339 Ga0182006_10733391 225
187 3300015262 Ga0182007_10000404 Ga0182007_1000040422 225
188 3300017792 Ga0163161_10004221 Ga0163161_100042219 225
189 3300017792 Ga0163161_10180389 Ga0163161_101803891 225
190 3300021441 Ga0213871_10110368 Ga0213871_101103681 225
191 3300025231 Ga0207427_100143 Ga0207427_10014318 225
192 3300025233 Ga0209437_100255 Ga0209437_10025549 225
193 3300025253 Ga0209677_100786 Ga0209677_10078617 225
194 3300025261 Ga0209233_1000172 Ga0209233_1000172108 225
195 3300025711 Ga0207696_1000042 Ga0207696_100004295 225
196 3300025711 Ga0207696_1010401 Ga0207696_10104013 225
197 3300025728 Ga0207655_1001865 Ga0207655_10018657 225
198 3300025728 Ga0207655_1005408 Ga0207655_10054087 225
199 3300025728 Ga0207655_1010470 Ga0207655_10104704 225
200 3300025728 Ga0207655_1049673 Ga0207655_10496732 225
201 3300025935 Ga0207709_10019327 Ga0207709_100193274 225
202 3300026067 Ga0207678_10438855 Ga0207678_104388551 225
203 3300027312 Ga0209371_1000134 Ga0209371_100013498 225
204 3300027312 Ga0209371_1001258 Ga0209371_100125814 225
205 3300027312 Ga0209371_1013374 Ga0209371_10133741 225
206 3300028379 Ga0268266_10000356 Ga0268266_100003561 225
207 3300028800 Ga0265338_10002816 Ga0265338_1000281624 225
208 3300030500 Ga0268256_1000790 Ga0268256_10007902 225
209 3300030500 Ga0268256_1015855 Ga0268256_10158551 225
210 3300030732 Ga0316176_1135288 Ga0316176_11352882 225
211 3300030733 Ga0314311_1021826 Ga0314311_10218265 225
212 3300030742 Ga0316183_1023281 Ga0316183_10232813 225
213 3300030744 Ga0316181_1287062 Ga0316181_12870623 225
214 3300031731 Ga0307405_10029935 Ga0307405_100299353 225
215 3300031731 Ga0307405_10213491 Ga0307405_102134912 225
216 3300031838 Ga0307518_10078044 Ga0307518_100780443 225
217 3300031901 Ga0307406_10002013 Ga0307406_1000201312 225
218 3300031903 Ga0307407_10275758 Ga0307407_102757581 225
219 3300031911 Ga0307412_10204595 Ga0307412_102045951 225
220 3300031995 Ga0307409_100194322 Ga0307409_1001943222 225
221 3300032004 Ga0307414_10516444 Ga0307414_105164441 225
222 3300032005 Ga0307411_10166935 Ga0307411_101669351 225
223 3300035398 Ga0316574_0024662 Ga0316574_0024662_760_1437 225
224 3300037471 Ga0395905_0057923 Ga0395905_0057923_2698_3399 225
225 3300037853 Ga0436364_1370784 Ga0436364_1370784_23_712 225
226 3300039447 Ga0436361_0646404 Ga0436361_0646404_46_807 225
227 3300039447 Ga0436361_0666781 Ga0436361_0666781_542_1231 225
228 3300041405 Ga0439438_000082 Ga0439438_000082_34977_35660 225
229 3300041405 Ga0439438_003497 Ga0439438_003497_5455_6132 225
230 3300041407 Ga0439447_001625 Ga0439447_001625_7432_8115 225
231 3300042006 Ga0439432_000585 Ga0439432_000585_6870_7553 225
232 3300042010 Ga0439452_005262 Ga0439452_005262_1869_2552 225
233 3300042146 Ga0450907_001474 Ga0450907_001474_2844_3524 225
234 3300042439 Ga0439464_0014971 Ga0439464_0014971_517_1197 225
235 3300045836 Ga0466958_0238699 Ga0466958_0238699_108_800 225
236 3300046452 Ga0495617_000028 Ga0495617_000028_54321_55001 225
237 3300046452 Ga0495617_029577 Ga0495617_029577_913_1593 225
238 3300046452 Ga0495617_051688 Ga0495617_051688_371_1135 225
239 3300046453 Ga0495627_000007 Ga0495627_000007_384512_385192 225
240 3300046453 Ga0495627_027052 Ga0495627_027052_306_1022 225
241 3300046453 Ga0495627_096263 Ga0495627_096263_17_703 225
242 3300046454 Ga0495592_0024462 Ga0495592_0024462_3227_3916 225
243 3300046455 Ga0495603_0025463 Ga0495603_0025463_641_1327 225
244 3300046457 Ga0495590_0000013 Ga0495590_0000013_227453_228217 225
245 3300046457 Ga0495590_0114518 Ga0495590_0114518_174_884 225
246 3300046458 Ga0495591_000013 Ga0495591_000013_1643_2323 225
247 3300046458 Ga0495591_000109 Ga0495591_000109_56865_57545 225
248 3300046458 Ga0495591_000679 Ga0495591_000679_12533_13213 225
249 3300046458 Ga0495591_002214 Ga0495591_002214_910_1599 225
250 3300046458 Ga0495591_005630 Ga0495591_005630_3483_4163 225
251 3300046458 Ga0495591_023665 Ga0495591_023665_591_1271 225
252 3300046458 Ga0495591_039494 Ga0495591_039494_358_1041 225
253 3300046459 Ga0495629_0007591 Ga0495629_0007591_4809_5498 225
254 3300046460 Ga0495638_0000184 Ga0495638_0000184_47899_48579 225
255 3300046461 Ga0495641_0121045 Ga0495641_0121045_259_939 225
256 3300046462 Ga0495651_0001767 Ga0495651_0001767_6453_7142 225
257 3300046463 Ga0495653_0014301 Ga0495653_0014301_4863_5543 225
258 3300046463 Ga0495653_0017087 Ga0495653_0017087_2576_3256 225
259 3300046463 Ga0495653_0040476 Ga0495653_0040476_2489_3178 225
260 3300046471 Ga0495650_0000033 Ga0495650_0000033_147643_148323 225
261 3300046471 Ga0495650_0000108 Ga0495650_0000108_167910_168590 225
262 3300046471 Ga0495650_0000643 Ga0495650_0000643_25389_26069 225
263 3300046472 Ga0495580_0003497 Ga0495580_0003497_2658_3347 225
264 3300046472 Ga0495580_0117528 Ga0495580_0117528_953_1633 225
265 3300046474 Ga0495605_0000056 Ga0495605_0000056_87997_88677 225
266 3300046474 Ga0495605_0006763 Ga0495605_0006763_570_1250 225
267 3300046474 Ga0495605_0025453 Ga0495605_0025453_1866_2552 225
268 3300046474 Ga0495605_0026465 Ga0495605_0026465_689_1399 225
269 3300046474 Ga0495605_0041710 Ga0495605_0041710_658_1338 225
270 3300046474 Ga0495605_0137784 Ga0495605_0137784_197_877 225
271 3300046474 Ga0495605_0213141 Ga0495605_0213141_102_782 225
272 3300046477 Ga0495664_0031270 Ga0495664_0031270_978_1667 225
273 3300046491 Ga0495584_0000074 Ga0495584_0000074_31704_32384 225
274 3300046491 Ga0495584_0000158 Ga0495584_0000158_38021_38701 225
275 3300046491 Ga0495584_0012453 Ga0495584_0012453_941_1621 225
276 3300046491 Ga0495584_0021973 Ga0495584_0021973_189_869 225
277 3300046491 Ga0495584_0028083 Ga0495584_0028083_1483_2193 225
278 3300046491 Ga0495584_0058764 Ga0495584_0058764_134_829 225
279 3300046491 Ga0495584_0125781 Ga0495584_0125781_387_1067 225
280 3300046492 Ga0495585_0000726 Ga0495585_0000726_19121_19801 225
281 3300046492 Ga0495585_0005179 Ga0495585_0005179_865_1629 225
282 3300046492 Ga0495585_0014320 Ga0495585_0014320_2683_3363 225
283 3300046492 Ga0495585_0040925 Ga0495585_0040925_24_710 225
284 3300046492 Ga0495585_0108897 Ga0495585_0108897_202_912 225
285 3300046492 Ga0495585_0136357 Ga0495585_0136357_572_1261 225
286 3300046499 Ga0495594_0028369 Ga0495594_0028369_1497_2183 225
287 3300046500 Ga0495596_0003828 Ga0495596_0003828_3393_4073 225
288 3300046500 Ga0495596_0006325 Ga0495596_0006325_831_1520 225
289 3300046500 Ga0495596_0007719 Ga0495596_0007719_4075_4755 225
290 3300046500 Ga0495596_0025226 Ga0495596_0025226_850_1614 225
291 3300046500 Ga0495596_0050990 Ga0495596_0050990_227_937 225
292 3300046500 Ga0495596_0194825 Ga0495596_0194825_76_756 225
293 3300046501 Ga0495607_0000324 Ga0495607_0000324_22233_22913 225
294 3300046501 Ga0495607_0000479 Ga0495607_0000479_1606_2286 225
295 3300046501 Ga0495607_0001178 Ga0495607_0001178_13364_14059 225
296 3300046501 Ga0495607_0001248 Ga0495607_0001248_10433_11140 225
297 3300046501 Ga0495607_0002148 Ga0495607_0002148_976_1662 225
298 3300046501 Ga0495607_0028018 Ga0495607_0028018_202_885 225
299 3300046501 Ga0495607_0080935 Ga0495607_0080935_795_1505 225
300 3300046506 Ga0495583_0000119 Ga0495583_0000119_46695_47375 225
301 3300046506 Ga0495583_0001888 Ga0495583_0001888_7853_8533 225
302 3300046506 Ga0495583_0013518 Ga0495583_0013518_2599_3279 225
303 3300046506 Ga0495583_0121013 Ga0495583_0121013_226_936 225
304 3300046507 Ga0495606_0000408 Ga0495606_0000408_31404_32084 225
305 3300046507 Ga0495606_0001523 Ga0495606_0001523_23937_24617 225
306 3300046507 Ga0495606_0004327 Ga0495606_0004327_10959_11639 225
307 3300046507 Ga0495606_0004327 Ga0495606_0004327_11737_12444 225
308 3300046507 Ga0495606_0012272 Ga0495606_0012272_3004_3684 225
309 3300046507 Ga0495606_0013928 Ga0495606_0013928_3636_4316 225
310 3300046507 Ga0495606_0078854 Ga0495606_0078854_714_1403 225
311 3300046507 Ga0495606_0190110 Ga0495606_0190110_464_1144 225
312 3300046511 Ga0495608_0018485 Ga0495608_0018485_3211_3900 225
313 3300046512 Ga0495610_0000313 Ga0495610_0000313_22990_23670 225
314 3300046512 Ga0495610_0005896 Ga0495610_0005896_2511_3191 225
315 3300046512 Ga0495610_0007336 Ga0495610_0007336_5315_5995 225
316 3300046512 Ga0495610_0018777 Ga0495610_0018777_447_1127 225
317 3300046513 Ga0495616_0000273 Ga0495616_0000273_16581_17267 225
318 3300046513 Ga0495616_0000705 Ga0495616_0000705_6171_6857 225
319 3300046513 Ga0495616_0003218 Ga0495616_0003218_4149_4829 225
320 3300046513 Ga0495616_0032621 Ga0495616_0032621_668_1363 225
321 3300046513 Ga0495616_0111219 Ga0495616_0111219_217_927 225
322 3300046513 Ga0495616_0206469 Ga0495616_0206469_66_761 225
323 3300046514 Ga0495618_0003519 Ga0495618_0003519_2479_3168 225
324 3300046515 Ga0495620_0000046 Ga0495620_0000046_44771_45451 225
325 3300046516 Ga0495628_0036114 Ga0495628_0036114_908_1597 225
326 3300046517 Ga0495630_0002157 Ga0495630_0002157_2657_3346 225
327 3300046518 Ga0495631_0003716 Ga0495631_0003716_3390_4070 225
328 3300046518 Ga0495631_0004385 Ga0495631_0004385_3344_4108 225
329 3300046518 Ga0495631_0015151 Ga0495631_0015151_2190_2876 225
330 3300046518 Ga0495631_0015402 Ga0495631_0015402_1278_1958 225
331 3300046518 Ga0495631_0076168 Ga0495631_0076168_25_705 225
332 3300046518 Ga0495631_0137187 Ga0495631_0137187_249_959 225
333 3300046518 Ga0495631_0215214 Ga0495631_0215214_20_700 225
334 3300046519 Ga0495632_0000503 Ga0495632_0000503_13464_14150 225
335 3300046519 Ga0495632_0000555 Ga0495632_0000555_24710_25405 225
336 3300046519 Ga0495632_0001943 Ga0495632_0001943_11446_12132 225
337 3300046519 Ga0495632_0034670 Ga0495632_0034670_1783_2463 225
338 3300046520 Ga0495637_0000008 Ga0495637_0000008_43496_44176 225
339 3300046520 Ga0495637_0000443 Ga0495637_0000443_194_874 225
340 3300046520 Ga0495637_0005975 Ga0495637_0005975_3258_3950 225
341 3300046522 Ga0495643_0000361 Ga0495643_0000361_31152_31832 225
342 3300046522 Ga0495643_0000459 Ga0495643_0000459_43111_43791 225
343 3300046522 Ga0495643_0000505 Ga0495643_0000505_22544_23224 225
344 3300046522 Ga0495643_0024129 Ga0495643_0024129_417_1097 225
345 3300046522 Ga0495643_0033376 Ga0495643_0033376_1089_1769 225
346 3300046522 Ga0495643_0038355 Ga0495643_0038355_1699_2388 225
347 3300046523 Ga0495644_0013925 Ga0495644_0013925_1899_2579 225
348 3300046523 Ga0495644_0021679 Ga0495644_0021679_1398_2078 225
349 3300046523 Ga0495644_0108511 Ga0495644_0108511_127_807 225
350 3300046524 Ga0495648_0000001 Ga0495648_0000001_55997_56677 225
351 3300046524 Ga0495648_0001043 Ga0495648_0001043_4406_5086 225
352 3300046524 Ga0495648_0011562 Ga0495648_0011562_3253_3933 225
353 3300046524 Ga0495648_0012949 Ga0495648_0012949_3120_3800 225
354 3300046524 Ga0495648_0019418 Ga0495648_0019418_2551_3240 225
355 3300046524 Ga0495648_0055877 Ga0495648_0055877_1377_2057 225
356 3300046525 Ga0495663_0001261 Ga0495663_0001261_7095_7778 225
357 3300046526 Ga0495666_0000847 Ga0495666_0000847_11083_11772 225
358 3300046526 Ga0495666_0001810 Ga0495666_0001810_9254_9949 225
359 3300046526 Ga0495666_0123782 Ga0495666_0123782_12_692 225
360 3300046528 Ga0495642_0001888 Ga0495642_0001888_6320_7000 225
361 3300046528 Ga0495642_0004660 Ga0495642_0004660_4480_5166 225
362 3300046528 Ga0495642_0007488 Ga0495642_0007488_2616_3296 225
363 3300046528 Ga0495642_0011959 Ga0495642_0011959_766_1452 225
364 3300046528 Ga0495642_0031155 Ga0495642_0031155_134_844 225
365 3300046528 Ga0495642_0066632 Ga0495642_0066632_387_1067 225
366 3300046528 Ga0495642_0113602 Ga0495642_0113602_304_984 225
367 3300046528 Ga0495642_0200825 Ga0495642_0200825_63_743 225
368 3300046529 Ga0495652_0003824 Ga0495652_0003824_2372_3061 225
369 3300046529 Ga0495652_0352060 Ga0495652_0352060_142_822 225
370 3300046530 Ga0495654_0000002 Ga0495654_0000002_516733_517413 225
371 3300046530 Ga0495654_0000020 Ga0495654_0000020_281463_282143 225
372 3300046530 Ga0495654_0000041 Ga0495654_0000041_1868_2548 225
373 3300046530 Ga0495654_0000807 Ga0495654_0000807_1935_2615 225
374 3300046530 Ga0495654_0012222 Ga0495654_0012222_1862_2548 225
375 3300046530 Ga0495654_0012437 Ga0495654_0012437_2711_3391 225
376 3300046530 Ga0495654_0047148 Ga0495654_0047148_281_991 225
377 3300046531 Ga0495665_0007388 Ga0495665_0007388_4675_5355 225
378 3300046531 Ga0495665_0017320 Ga0495665_0017320_1538_2227 225
379 3300046533 Ga0495640_0000889 Ga0495640_0000889_9366_10055 225
380 3300046533 Ga0495640_0149961 Ga0495640_0149961_616_1311 225
381 3300046533 Ga0495640_0476140 Ga0495640_0476140_56_736 225
382 3300046536 Ga0495587_0007121 Ga0495587_0007121_3496_4185 225
383 3300046538 Ga0495609_0000095 Ga0495609_0000095_59182_59868 225
384 3300046538 Ga0495609_0001197 Ga0495609_0001197_13696_14376 225
385 3300046538 Ga0495609_0004440 Ga0495609_0004440_717_1397 225
386 3300046538 Ga0495609_0007887 Ga0495609_0007887_4289_4969 225
387 3300046538 Ga0495609_0032900 Ga0495609_0032900_753_1439 225
388 3300046538 Ga0495609_0035465 Ga0495609_0035465_706_1386 225
389 3300046538 Ga0495609_0036430 Ga0495609_0036430_44_754 225
390 3300046538 Ga0495609_0064384 Ga0495609_0064384_907_1587 225
391 3300046542 Ga0495597_0004891 Ga0495597_0004891_3801_4481 225
392 3300046542 Ga0495597_0012324 Ga0495597_0012324_3158_3838 225
393 3300046557 Ga0495622_0000276 Ga0495622_0000276_35893_36573 225
394 3300046557 Ga0495622_0020782 Ga0495622_0020782_167_877 225
395 3300046558 Ga0495633_0000171 Ga0495633_0000171_59599_60279 225
396 3300046558 Ga0495633_0000792 Ga0495633_0000792_20050_20733 225
397 3300046558 Ga0495633_0002160 Ga0495633_0002160_8057_8737 225
398 3300046558 Ga0495633_0007057 Ga0495633_0007057_307_987 225
399 3300046558 Ga0495633_0064061 Ga0495633_0064061_442_1134 225
400 3300046615 Ga0495656_0022925 Ga0495656_0022925_687_1367 225
401 3300046615 Ga0495656_0122377 Ga0495656_0122377_109_795 225
402 3300046615 Ga0495656_0216678 Ga0495656_0216678_233_922 225
403 3300046616 Ga0495668_0000146 Ga0495668_0000146_19342_20022 225
404 3300046616 Ga0495668_0011759 Ga0495668_0011759_2790_3470 225
405 3300046616 Ga0495668_0027156 Ga0495668_0027156_642_1352 225
406 3300046616 Ga0495668_0054328 Ga0495668_0054328_126_806 225
407 3300046616 Ga0495668_0288307 Ga0495668_0288307_66_746 225
408 3300046642 Ga0495634_0001994 Ga0495634_0001994_3352_4041 225
409 3300046642 Ga0495634_0023001 Ga0495634_0023001_233_913 225
410 3300046648 Ga0495611_0000214 Ga0495611_0000214_7499_8179 225
411 3300046648 Ga0495611_0002426 Ga0495611_0002426_4600_5280 225
412 3300046660 Ga0495625_0000483 Ga0495625_0000483_45723_46403 225
413 3300046660 Ga0495625_0020252 Ga0495625_0020252_1876_2556 225
414 3300046660 Ga0495625_0034279 Ga0495625_0034279_2841_3521 225
415 3300046660 Ga0495625_0063553 Ga0495625_0063553_1641_2351 225
416 3300046660 Ga0495625_0066735 Ga0495625_0066735_973_1659 225
417 3300046660 Ga0495625_0206263 Ga0495625_0206263_567_1247 225
418 3300046660 Ga0495625_0301861 Ga0495625_0301861_52_732 225
419 3300046663 Ga0495635_0104832 Ga0495635_0104832_1210_1899 225
420 3300046665 Ga0495661_0000012 Ga0495661_0000012_231179_231865 225
421 3300046665 Ga0495661_0000591 Ga0495661_0000591_11455_12135 225
422 3300046665 Ga0495661_0001091 Ga0495661_0001091_8286_8966 225
423 3300046665 Ga0495661_0002208 Ga0495661_0002208_13247_13939 225
424 3300046665 Ga0495661_0002775 Ga0495661_0002775_7762_8451 225
425 3300046665 Ga0495661_0002864 Ga0495661_0002864_1667_2347 225
426 3300046665 Ga0495661_0057056 Ga0495661_0057056_41_721 225
427 3300046665 Ga0495661_0064923 Ga0495661_0064923_723_1409 225
428 3300046665 Ga0495661_0122667 Ga0495661_0122667_484_1170 225
429 3300046674 Ga0495588_0005068 Ga0495588_0005068_4913_5623 225
430 3300046674 Ga0495588_0012626 Ga0495588_0012626_2086_2772 225
431 3300046678 Ga0495599_0016376 Ga0495599_0016376_500_1189 225
432 3300046679 Ga0495623_0003308 Ga0495623_0003308_4774_5463 225
433 3300046679 Ga0495623_0005569 Ga0495623_0005569_7101_7781 225
434 3300046679 Ga0495623_0014267 Ga0495623_0014267_1439_2119 225
435 3300046679 Ga0495623_0203120 Ga0495623_0203120_19_714 225
436 3300046680 Ga0495646_0001168 Ga0495646_0001168_10427_11116 225
437 3300046684 Ga0495669_0005169 Ga0495669_0005169_2280_2966 225
438 3300046689 Ga0495613_0029128 Ga0495613_0029128_3042_3731 225
439 3300046690 Ga0495624_0002313 Ga0495624_0002313_3513_4202 225
440 3300046690 Ga0495624_0247337 Ga0495624_0247337_383_1063 225
441 3300046691 Ga0495670_0004445 Ga0495670_0004445_2982_3662 225
442 3300046691 Ga0495670_0057396 Ga0495670_0057396_1053_1739 225
443 3300046691 Ga0495670_0162235 Ga0495670_0162235_195_881 225
444 3300046692 Ga0495671_0009682 Ga0495671_0009682_627_1307 225
445 3300046692 Ga0495671_0014256 Ga0495671_0014256_41_730 225
446 3300046692 Ga0495671_0033699 Ga0495671_0033699_1124_1810 225
447 3300046692 Ga0495671_0054682 Ga0495671_0054682_575_1255 225
448 3300046694 Ga0495649_0000535 Ga0495649_0000535_8836_9600 225
449 3300046694 Ga0495649_0096039 Ga0495649_0096039_294_989 225
450 3300046694 Ga0495649_0237063 Ga0495649_0237063_120_812 225
451 3300046794 Ga0495589_0000007 Ga0495589_0000007_230819_231505 225
452 3300046794 Ga0495589_0000054 Ga0495589_0000054_3409_4089 225
453 3300046794 Ga0495589_0000293 Ga0495589_0000293_7042_7722 225
454 3300046794 Ga0495589_0000550 Ga0495589_0000550_23621_24310 225
455 3300046794 Ga0495589_0016350 Ga0495589_0016350_2462_3142 225
456 3300046794 Ga0495589_0017358 Ga0495589_0017358_2236_2946 225
457 3300046794 Ga0495589_0019173 Ga0495589_0019173_1843_2523 225
458 3300046794 Ga0495589_0043559 Ga0495589_0043559_1104_1784 225
459 3300046794 Ga0495589_0045759 Ga0495589_0045759_505_1185 225
460 3300046794 Ga0495589_0120362 Ga0495589_0120362_286_966 225
461 3300046794 Ga0495589_0136818 Ga0495589_0136818_56_736 225
462 3300046809 Ga0495600_0000280 Ga0495600_0000280_15927_16616 225
463 3300046809 Ga0495600_0068268 Ga0495600_0068268_637_1317 225
464 3300046810 Ga0495660_0000011 Ga0495660_0000011_277938_278618 225
465 3300046810 Ga0495660_0000055 Ga0495660_0000055_66742_67422 225
466 3300046810 Ga0495660_0000172 Ga0495660_0000172_40869_41549 225
467 3300046810 Ga0495660_0002144 Ga0495660_0002144_3756_4436 225
468 3300046810 Ga0495660_0003099 Ga0495660_0003099_9289_9975 225
469 3300046810 Ga0495660_0026237 Ga0495660_0026237_509_1189 225
470 3300046810 Ga0495660_0061324 Ga0495660_0061324_965_1651 225
471 3300047317 Ga0495604_0008804 Ga0495604_0008804_2489_3178 225
472 3300047317 Ga0495604_0050382 Ga0495604_0050382_1131_1826 225
473 3300047319 Ga0495674_0003883 Ga0495674_0003883_13342_14031 225
474 3300047320 Ga0495672_0000004 Ga0495672_0000004_303356_304036 225
475 3300047320 Ga0495672_0000013 Ga0495672_0000013_196406_197083 225
476 3300047320 Ga0495672_0000013 Ga0495672_0000013_197489_198166 225
477 3300047320 Ga0495672_0000032 Ga0495672_0000032_29144_29836 225
478 3300047320 Ga0495672_0000032 Ga0495672_0000032_30794_31486 225
479 3300047320 Ga0495672_0000033 Ga0495672_0000033_223908_224588 225
480 3300047320 Ga0495672_0000096 Ga0495672_0000096_25159_25839 225
481 3300047320 Ga0495672_0000386 Ga0495672_0000386_9786_10466 225
482 3300047320 Ga0495672_0000580 Ga0495672_0000580_22933_23613 225
483 3300047320 Ga0495672_0016673 Ga0495672_0016673_2273_2953 225
484 3300047320 Ga0495672_0130749 Ga0495672_0130749_218_910 225
485 3300047320 Ga0495672_0218796 Ga0495672_0218796_13_723 225
486 3300047321 Ga0495676_0000273 Ga0495676_0000273_4539_5249 225
487 3300047321 Ga0495676_0077590 Ga0495676_0077590_810_1499 225
488 3300047322 Ga0495680_0003552 Ga0495680_0003552_2959_3648 225
489 3300047323 Ga0495683_0000114 Ga0495683_0000114_39209_39892 225
490 3300047323 Ga0495683_0000301 Ga0495683_0000301_32851_33531 225
491 3300047323 Ga0495683_0000819 Ga0495683_0000819_1684_2364 225
492 3300047323 Ga0495683_0019864 Ga0495683_0019864_217_906 225
493 3300047323 Ga0495683_0042630 Ga0495683_0042630_228_908 225
494 3300047323 Ga0495683_0043935 Ga0495683_0043935_394_1074 225
495 3300047323 Ga0495683_0101924 Ga0495683_0101924_287_997 225
496 3300047443 Ga0495687_000003 Ga0495687_000003_356859_357545 225
497 3300047443 Ga0495687_000474 Ga0495687_000474_38003_38683 225
498 3300047443 Ga0495687_000704 Ga0495687_000704_30114_30794 225
499 3300047443 Ga0495687_000843 Ga0495687_000843_30859_31539 225
500 3300047443 Ga0495687_003092 Ga0495687_003092_4761_5447 225
501 3300047444 Ga0495675_0000447 Ga0495675_0000447_19909_20598 225
502 3300047444 Ga0495675_0242883 Ga0495675_0242883_300_995 225
503 3300047445 Ga0495677_0000005 Ga0495677_0000005_45162_45848 225
504 3300047445 Ga0495677_0000270 Ga0495677_0000270_19609_20373 225
505 3300047445 Ga0495677_0001551 Ga0495677_0001551_7991_8671 225
506 3300047445 Ga0495677_0002228 Ga0495677_0002228_4542_5222 225
507 3300047445 Ga0495677_0010955 Ga0495677_0010955_33_728 225
508 3300047445 Ga0495677_0047928 Ga0495677_0047928_650_1360 225
509 3300047446 Ga0495679_000304 Ga0495679_000304_30153_30842 225
510 3300047446 Ga0495679_002632 Ga0495679_002632_5205_5885 225
511 3300047447 Ga0495685_045432 Ga0495685_045432_633_1343 225
512 3300047469 Ga0495673_0000023 Ga0495673_0000023_220347_221027 225
513 3300047469 Ga0495673_0016244 Ga0495673_0016244_2249_2938 225
514 3300047470 Ga0495681_0004589 Ga0495681_0004589_5769_6449 225
515 3300047470 Ga0495681_0017640 Ga0495681_0017640_2117_2797 225
516 3300047470 Ga0495681_0018426 Ga0495681_0018426_2423_3103 225
517 3300047470 Ga0495681_0020104 Ga0495681_0020104_2676_3356 225
518 3300047470 Ga0495681_0132112 Ga0495681_0132112_86_769 225
519 3300047471 Ga0495684_0072338 Ga0495684_0072338_1918_2607 225
520 3300047472 Ga0495686_0001166 Ga0495686_0001166_15499_16179 225
521 3300047472 Ga0495686_0001166 Ga0495686_0001166_21240_21920 225
522 3300047472 Ga0495686_0015119 Ga0495686_0015119_2186_2866 225
523 3300047472 Ga0495686_0055268 Ga0495686_0055268_14_694 225
524 3300047472 Ga0495686_0311015 Ga0495686_0311015_109_789 225
525 3300047673 Ga0495593_0001373 Ga0495593_0001373_2126_2815 225
526 3300048088 Ga0495602_0003973 Ga0495602_0003973_13342_14031 225
527 3300048088 Ga0495602_0202551 Ga0495602_0202551_694_1389 225
528 3300048089 Ga0495614_0026580 Ga0495614_0026580_907_1596 225
529 3300048091 Ga0495626_0000017 Ga0495626_0000017_122235_122930 225
530 3300048091 Ga0495626_0000017 Ga0495626_0000017_137053_137733 225
531 3300048091 Ga0495626_0000053 Ga0495626_0000053_88122_88802 225
532 3300048091 Ga0495626_0000543 Ga0495626_0000543_534_1220 225
533 3300048091 Ga0495626_0001020 Ga0495626_0001020_22531_23295 225
534 3300048091 Ga0495626_0007202 Ga0495626_0007202_3494_4174 225
535 3300048091 Ga0495626_0014143 Ga0495626_0014143_2259_2945 225
536 3300048091 Ga0495626_0030393 Ga0495626_0030393_1784_2464 225
537 3300048091 Ga0495626_0131097 Ga0495626_0131097_145_837 225
538 3300048903 Ga0496100_0593667 Ga0496100_0593667_137_820 225
539 3300048904 Ga0496101_0000324 Ga0496101_0000324_5078_5761 225
540 3300048904 Ga0496101_0002266 Ga0496101_0002266_4298_4990 225
541 3300048906 Ga0496103_0003365 Ga0496103_0003365_5025_5705 225
542 3300048908 Ga0496105_0024276 Ga0496105_0024276_1239_1919 225
543 3300048914 Ga0496111_0002901 Ga0496111_0002901_4773_5450 225
544 3300048917 Ga0496114_0024682 Ga0496114_0024682_3926_4606 225
545 3300048919 Ga0496116_0013844 Ga0496116_0013844_3881_4561 225
546 3300048919 Ga0496116_0022952 Ga0496116_0022952_348_1025 225
547 3300048920 Ga0496117_0000145 Ga0496117_0000145_54605_55285 225
548 3300048920 Ga0496117_0007273 Ga0496117_0007273_5835_6530 225
549 3300048920 Ga0496117_0129892 Ga0496117_0129892_18_698 225
550 3300048921 Ga0496118_0000397 Ga0496118_0000397_55151_55831 225
551 3300048921 Ga0496118_0094118 Ga0496118_0094118_876_1556 225
552 3300048922 Ga0496119_0023566 Ga0496119_0023566_2179_2862 225
553 3300048923 Ga0496120_0001585 Ga0496120_0001585_13875_14555 225
554 3300048923 Ga0496120_0066232 Ga0496120_0066232_1077_1760 225
555 3300048924 Ga0496121_0007569 Ga0496121_0007569_6705_7382 225
556 3300048924 Ga0496121_0014071 Ga0496121_0014071_1692_2372 225
557 3300048924 Ga0496121_0029716 Ga0496121_0029716_3077_3757 225
558 3300048925 Ga0496122_0008873 Ga0496122_0008873_3196_3879 225
559 3300048925 Ga0496122_0014290 Ga0496122_0014290_3320_4000 225
560 3300048925 Ga0496122_0107965 Ga0496122_0107965_598_1278 225
561 3300048926 Ga0496123_0002194 Ga0496123_0002194_24088_24768 225
562 3300048926 Ga0496123_0002866 Ga0496123_0002866_8369_9046 225
563 3300048927 Ga0496124_0005010 Ga0496124_0005010_4527_5219 225
564 3300048927 Ga0496124_0022664 Ga0496124_0022664_795_1475 225
565 3300048927 Ga0496124_0024811 Ga0496124_0024811_992_1675 225
566 3300048927 Ga0496124_0039688 Ga0496124_0039688_2645_3337 225
567 3300048927 Ga0496124_0144447 Ga0496124_0144447_83_763 225
568 3300048927 Ga0496124_0146091 Ga0496124_0146091_117_797 225
569 3300048927 Ga0496124_0154806 Ga0496124_0154806_840_1523 225
570 3300048927 Ga0496124_0284988 Ga0496124_0284988_169_846 225
571 3300048928 Ga0496125_0075693 Ga0496125_0075693_1240_1920 225
572 3300048929 Ga0496126_0000248 Ga0496126_0000248_74736_75416 225
573 3300048929 Ga0496126_0022569 Ga0496126_0022569_2485_3177 225
574 3300048929 Ga0496126_0030527 Ga0496126_0030527_4376_5068 225
575 3300049459 Ga0495678_000004 Ga0495678_000004_330384_331064 225
576 3300049459 Ga0495678_000024 Ga0495678_000024_166016_166696 225
577 3300049459 Ga0495678_000203 Ga0495678_000203_60855_61535 225
578 3300049459 Ga0495678_000459 Ga0495678_000459_13116_13796 225
579 3300049459 Ga0495678_000835 Ga0495678_000835_20283_20963 225
580 3300049459 Ga0495678_002374 Ga0495678_002374_6791_7477 225
581 3300049459 Ga0495678_002971 Ga0495678_002971_4240_4920 225
582 3300049459 Ga0495678_007634 Ga0495678_007634_4398_5078 225
583 3300049459 Ga0495678_041881 Ga0495678_041881_290_982 225
584 3300049459 Ga0495678_064746 Ga0495678_064746_89_769 225
585 3300049460 Ga0495682_0000004 Ga0495682_0000004_275041_275721 225
586 3300049460 Ga0495682_0000716 Ga0495682_0000716_12828_13508 225
587 3300049460 Ga0495682_0074820 Ga0495682_0074820_155_919 225
588 3300049460 Ga0495682_0104585 Ga0495682_0104585_248_928 225
589 3300049662 Ga0501222_000230 Ga0501222_000230_6445_7128 225
590 3300049766 Ga0501269_000543 Ga0501269_000543_3255_3935 225
591 3300050491 nmdc:mga00v17_108346_c1 nmdc:mga00v17_108346_c1_570_1253 225
592 3300053098 Ga0500650_0000107 Ga0500650_0000107_5019_5738 225
593 3300053125 Ga0500618_000165 Ga0500618_000165_14995_15675 225
594 3300053125 Ga0500618_000294 Ga0500618_000294_24187_24867 225
595 3300053125 Ga0500618_002626 Ga0500618_002626_4320_5000 225
596 3300053125 Ga0500618_017464 Ga0500618_017464_1086_1763 225
597 3300053126 Ga0500621_000001 Ga0500621_000001_360429_361109 225
598 3300053136 Ga0500559_0000432 Ga0500559_0000432_4259_4948 225
599 3300053136 Ga0500559_0028463 Ga0500559_0028463_345_1022 225
600 iso_pu_bacteria 2937843397 2937844588 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

19

216

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.956 2 225
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9349 2 224
1qvv-assembly1.cif.gz_D-2 crystal structure of the s. cerevisiae ydr533c protein 0.9336 1 224
4qyx-assembly1.cif.gz_A crystal structure of ydr533cp 0.9335 2 225
1qvz-assembly1.cif.gz_B crystal structure of the s. cerevisiae ydr533c protein 0.9328 2 224
ID Description Score Start End Superfamily
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9596 1 220 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9557 2 225 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9428 1 220 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9392 2 225 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9331 2 224 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A351NYN2-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 1.001 127 225 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-W4RWS6-F1-model_v4 ThiJ/PfpI family protein 0.9985 107 224 GO:0005737
GO:0019172
GO:0019243
AF-A0A844BBE8-F1-model_v4 DJ-1/PfpI family protein 0.998 122 224 GO:0005737
GO:0019172
GO:0019243
AF-A0A455U1L9-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9977 136 225 GO:0005737
GO:0019172
GO:0019243
AF-A0A520DH63-F1-model_v4 Tail specific protease domain-containing protein 0.9966 1 95 GO:0006508
GO:0008236

Feature Viewer

pLDDT pTM Quality
95.43 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map