F467952

General Info

Members Datasets Scaffolds Average Seq Length
600 254 597 248

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100001432|Ga0070662_1000014326
Length 277
Sequence MKARARFPFQRLLWAFVALLPLVLTTGCATVGGGAPTRQSAGQKLDPWENWNRKVFSFNEGLDEHLLKPVATAYRKVTPSFLRTAISNFFNNAEDAWSAVNHFLQGKGESGMQMLVRFNTNTFFGLGGVLDIATEAGIERQPEDFGQTLGKWGFGAGAYIVWPVLGPSSVRDSLALPLDRTMTSPAPLFEPESVQWEMLGLQLVNTRAGLLDASRVIDDIALDKYTFLRDGYLARRRSLVYDGNPPDTSPRDDAEDLAPAEKSEAAPPAGAASAPAQ

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
192 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
193 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
248 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
253 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.33
Nodule 0
Rhizoplane 2.83
Rhizosphere 80.33
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1014872 3300002155 Bacteria 955
2 JGI25152J39213_1000662 3300002773 Bacteria 17998
3 JGI25153J46596_10003371 3300003215 Bacteria 8968
4 JGI25153J46596_10007545 3300003215 Bacteria 5328
5 rootH1_10004482 3300003323 Bacteria 2128
6 Ga0055526_1001626 3300003771 Bacteria 15770
7 Ga0070658_10016712 3300005327 Bacteria 5873
8 Ga0070676_10017134 3300005328 Bacteria 4008
9 Ga0070676_10021221 3300005328 Bacteria 3635
10 Ga0070676_10034601 3300005328 Bacteria 2901
11 Ga0070690_100017758 3300005330 Bacteria 4286
12 Ga0070690_100028629 3300005330 Bacteria 3451
13 Ga0070670_100013611 3300005331 Bacteria 6971
14 Ga0070670_100021917 3300005331 Bacteria 5496
15 Ga0070670_100026210 3300005331 Bacteria 5018
16 Ga0070670_100034305 3300005331 Bacteria 4367
17 Ga0070670_100080193 3300005331 Bacteria 2805
18 Ga0070670_100099934 3300005331 Bacteria 2497
19 Ga0070677_10005615 3300005333 Bacteria 4139
20 Ga0070677_10015649 3300005333 Bacteria 2688
21 Ga0070677_10052567 3300005333 Bacteria 1653
22 Ga0070677_10054709 3300005333 Bacteria 1626
23 Ga0070677_10063098 3300005333 Bacteria 1535
24 Ga0068869_100003488 3300005334 Bacteria 9627
25 Ga0068869_100031544 3300005334 Bacteria 3728
26 Ga0068869_100168989 3300005334 Bacteria 1707
27 Ga0070666_10004086 3300005335 Bacteria 8865
28 Ga0070666_10114353 3300005335 Bacteria 1868
29 Ga0070666_10217538 3300005335 Bacteria 1347
30 Ga0070666_10229530 3300005335 Bacteria 1311
31 Ga0068868_100001343 3300005338 Bacteria 16950
32 Ga0068868_100003534 3300005338 Bacteria 10890
33 Ga0068868_100046664 3300005338 Bacteria 3391
34 Ga0068868_100060065 3300005338 Bacteria 3008
35 Ga0068868_100069894 3300005338 Bacteria 2799
36 Ga0068868_100329171 3300005338 Bacteria 1303
37 Ga0070660_100083259 3300005339 Bacteria 2513
38 Ga0070689_100156502 3300005340 Bacteria 1840
39 Ga0070661_100108494 3300005344 Bacteria 2071
40 Ga0070661_100181398 3300005344 Bacteria 1602
41 Ga0070661_100225204 3300005344 Bacteria 1439
42 Ga0070668_100043016 3300005347 Bacteria 3463
43 Ga0070668_100277076 3300005347 Bacteria 1400
44 Ga0070669_100044294 3300005353 Bacteria 3242
45 Ga0070669_100050718 3300005353 Bacteria 3031
46 Ga0070669_100155058 3300005353 Bacteria 1775
47 Ga0070669_100173734 3300005353 Bacteria 1681
48 Ga0070675_100003418 3300005354 Bacteria 12023
49 Ga0070675_100010402 3300005354 Bacteria 7268
50 Ga0070675_100133968 3300005354 Bacteria 2113
51 Ga0070675_100137894 3300005354 Bacteria 2083
52 Ga0070675_100343512 3300005354 Bacteria 1322
53 Ga0070671_100008407 3300005355 Bacteria 8273
54 Ga0070671_100020559 3300005355 Bacteria 5385
55 Ga0070671_100135962 3300005355 Bacteria 2072
56 Ga0070671_100169440 3300005355 Bacteria 1847
57 Ga0070671_100232935 3300005355 Bacteria 1563
58 Ga0070674_100121621 3300005356 Bacteria 1933
59 Ga0070673_100002371 3300005364 Bacteria 11464
60 Ga0070673_100120925 3300005364 Bacteria 2184
61 Ga0070673_100295974 3300005364 Bacteria 1423
62 Ga0070673_100321953 3300005364 Bacteria 1366
63 Ga0070688_100019843 3300005365 Bacteria 3899
64 Ga0070659_100011449 3300005366 Bacteria 6562
65 Ga0070659_100122710 3300005366 Bacteria 2106
66 Ga0070667_100012357 3300005367 Bacteria 7062
67 Ga0070667_100030336 3300005367 Bacteria 4510
68 Ga0070667_100138756 3300005367 Bacteria 2127
69 Ga0070700_100067380 3300005441 Bacteria 2274
70 Ga0070708_100338018 3300005445 Bacteria 1419
71 Ga0070663_100107129 3300005455 Bacteria 2095
72 Ga0070663_100109227 3300005455 Bacteria 2076
73 Ga0070663_100284977 3300005455 Bacteria 1318
74 Ga0070678_100006062 3300005456 Bacteria 7052
75 Ga0070678_100033281 3300005456 Bacteria 3577
76 Ga0070678_100081202 3300005456 Bacteria 2457
77 Ga0070678_100163811 3300005456 Bacteria 1804
78 Ga0070678_100282192 3300005456 Bacteria 1405
79 Ga0070662_100001432 3300005457 Bacteria 14712
80 Ga0070662_100005695 3300005457 Bacteria 7972
81 Ga0070662_100028238 3300005457 Bacteria 3902
82 Ga0070662_100031932 3300005457 Bacteria 3699
83 Ga0070681_10017630 3300005458 Bacteria 7135
84 Ga0068867_100005426 3300005459 Bacteria 9022
85 Ga0068867_100011992 3300005459 Bacteria 6123
86 Ga0068867_100014496 3300005459 Bacteria 5586
87 Ga0068867_100017829 3300005459 Bacteria 5042
88 Ga0068867_100030867 3300005459 Bacteria 3867
89 Ga0068867_100064789 3300005459 Bacteria 2717
90 Ga0068867_100071487 3300005459 Bacteria 2595
91 Ga0070707_100026153 3300005468 Bacteria 5539
92 Ga0070679_100000726 3300005530 Bacteria 28453
93 Ga0070684_100005261 3300005535 Bacteria 9903
94 Ga0070684_100451596 3300005535 Bacteria 1188
95 Ga0068853_100006811 3300005539 Bacteria 9111
96 Ga0068853_100435425 3300005539 Bacteria 1232
97 Ga0070672_100025769 3300005543 Bacteria 4368
98 Ga0070672_100026382 3300005543 Bacteria 4322
99 Ga0070672_100047279 3300005543 Bacteria 3338
100 Ga0070672_100086298 3300005543 Bacteria 2524
101 Ga0070686_100082995 3300005544 Bacteria 2126
102 Ga0070686_100209678 3300005544 Bacteria 1402
103 Ga0070686_100364279 3300005544 Bacteria 1090
104 Ga0070693_100041764 3300005547 Bacteria 2582
105 Ga0070693_100044620 3300005547 Bacteria 2508
106 Ga0070665_100007443 3300005548 Bacteria 11136
107 Ga0070665_100104794 3300005548 Bacteria 2830
108 Ga0070665_100115538 3300005548 Bacteria 2687
109 Ga0068855_100018761 3300005563 Bacteria 8316
110 Ga0070664_100015313 3300005564 Bacteria 6270
111 Ga0070664_100224211 3300005564 Bacteria 1682
112 Ga0070664_100304190 3300005564 Bacteria 1441
113 Ga0070664_100343636 3300005564 Bacteria 1356
114 Ga0070664_100472159 3300005564 Bacteria 1154
115 Ga0068857_100010507 3300005577 Bacteria 8046
116 Ga0068854_100013710 3300005578 Bacteria 5326
117 Ga0068854_100085075 3300005578 Bacteria 2341
118 Ga0068854_100093842 3300005578 Bacteria 2237
119 Ga0068856_100013192 3300005614 Bacteria 8003
120 Ga0068856_100074496 3300005614 Bacteria 3361
121 Ga0070702_100169659 3300005615 Bacteria 1418
122 Ga0068852_100009092 3300005616 Bacteria 7356
123 Ga0068852_100013380 3300005616 Bacteria 6280
124 Ga0068852_100066202 3300005616 Bacteria 3155
125 Ga0068852_100085162 3300005616 Bacteria 2815
126 Ga0068852_100114694 3300005616 Bacteria 2455
127 Ga0068852_100128266 3300005616 Bacteria 2332
128 Ga0068852_100185077 3300005616 Bacteria 1961
129 Ga0068852_100187166 3300005616 Bacteria 1951
130 Ga0068859_100001451 3300005617 Bacteria 24059
131 Ga0068859_100101507 3300005617 Bacteria 2934
132 Ga0068859_100357592 3300005617 Bacteria 1555
133 Ga0068864_100002901 3300005618 Bacteria 14175
134 Ga0068864_100009398 3300005618 Bacteria 8066
135 Ga0068864_100104355 3300005618 Bacteria 2518
136 Ga0068864_100201517 3300005618 Bacteria 1828
137 Ga0068864_100233074 3300005618 Bacteria 1703
138 Ga0068866_10019689 3300005718 Bacteria 3078
139 Ga0068866_10087404 3300005718 Bacteria 1689
140 Ga0068866_10130962 3300005718 Bacteria 1427
141 Ga0068861_100005459 3300005719 Bacteria 8611
142 Ga0068861_100013781 3300005719 Bacteria 5662
143 Ga0068861_100145774 3300005719 Bacteria 1937
144 Ga0068861_100329349 3300005719 Bacteria 1332
145 Ga0068851_10008150 3300005834 Bacteria 4838
146 Ga0068851_10207598 3300005834 Bacteria 1096
147 Ga0068863_100010181 3300005841 Bacteria 9144
148 Ga0068863_100018287 3300005841 Bacteria 6711
149 Ga0068863_100040067 3300005841 Bacteria 4455
150 Ga0068863_100154915 3300005841 Bacteria 2193
151 Ga0068863_100831740 3300005841 Bacteria 922
152 Ga0068858_100010630 3300005842 Bacteria 8712
153 Ga0068858_100285693 3300005842 Bacteria 1571
154 Ga0068858_100368842 3300005842 Bacteria 1377
155 Ga0068860_100039824 3300005843 Bacteria 4494
156 Ga0068860_100172465 3300005843 Bacteria 2090
157 Ga0068860_100182469 3300005843 Bacteria 2029
158 Ga0068862_100042040 3300005844 Bacteria 3891
159 Ga0068862_100086453 3300005844 Bacteria 2726
160 Ga0075368_10000682 3300006042 Bacteria 10310
161 Ga0075368_10018606 3300006042 Bacteria 2611
162 Ga0075363_100024753 3300006048 Bacteria 3054
163 Ga0075363_100061252 3300006048 Bacteria 2028
164 Ga0075363_100224254 3300006048 Bacteria 1078
165 Ga0075364_10124329 3300006051 Bacteria 1728
166 Ga0070715_10179035 3300006163 Bacteria 1062
167 Ga0075362_10016796 3300006177 Bacteria 3004
168 Ga0075362_10042877 3300006177 Bacteria 2002
169 Ga0075367_10032551 3300006178 Bacteria 3001
170 Ga0075367_10048227 3300006178 Bacteria 2508
171 Ga0075367_10049792 3300006178 Bacteria 2471
172 Ga0075369_10018641 3300006186 Bacteria 2827
173 Ga0075369_10020713 3300006186 Bacteria 2695
174 Ga0075369_10028340 3300006186 Bacteria 2347
175 Ga0075366_10001768 3300006195 Bacteria 10899
176 Ga0075366_10005954 3300006195 Bacteria 6637
177 Ga0075366_10021753 3300006195 Bacteria 3729
178 Ga0075366_10040736 3300006195 Bacteria 2748
179 Ga0075366_10095314 3300006195 Bacteria 1784
180 Ga0075366_10137621 3300006195 Unclassified 1475
181 Ga0075366_10221944 3300006195 Bacteria 1151
182 Ga0097621_100009144 3300006237 Bacteria 7182
183 Ga0097621_100009422 3300006237 Bacteria 7086
184 Ga0097621_100033628 3300006237 Bacteria 4084
185 Ga0097621_100044849 3300006237 Bacteria 3569
186 Ga0097621_100151519 3300006237 Bacteria 1989
187 Ga0075370_10001151 3300006353 Bacteria 11109
188 Ga0075370_10012585 3300006353 Bacteria 4477
189 Ga0075370_10024268 3300006353 Bacteria 3348
190 Ga0068871_100006200 3300006358 Bacteria 8431
191 Ga0068871_100008132 3300006358 Bacteria 7530
192 Ga0068871_100016972 3300006358 Bacteria 5497
193 Ga0068871_100076558 3300006358 Bacteria 2763
194 Ga0068871_100082655 3300006358 Bacteria 2663
195 Ga0068871_100318388 3300006358 Bacteria 1369
196 Ga0068865_100041024 3300006881 Bacteria 3148
197 Ga0068865_100091208 3300006881 Bacteria 2211
198 Ga0097620_100001451 3300006931 Bacteria 24059
199 Ga0097620_100101507 3300006931 Bacteria 2934
200 Ga0097620_100357572 3300006931 Bacteria 1555
201 Ga0075435_100170830 3300007076 Bacteria 1834
202 Ga0111539_10644569 3300009094 Bacteria 1233
203 Ga0105245_10061239 3300009098 Bacteria 3392
204 Ga0105245_10112084 3300009098 Bacteria 2538
205 Ga0114129_10080001 3300009147 Bacteria 4544
206 Ga0105243_10042764 3300009148 Bacteria 3548
207 Ga0105243_10149234 3300009148 Bacteria 2004
208 Ga0105241_10050051 3300009174 Bacteria 3184
209 Ga0105242_10129773 3300009176 Bacteria 2174
210 Ga0105248_10008335 3300009177 Bacteria 11388
211 Ga0105248_10011079 3300009177 Bacteria 9946
212 Ga0105248_10018942 3300009177 Bacteria 7611
213 Ga0105248_10232105 3300009177 Bacteria 2077
214 Ga0105237_10004861 3300009545 Bacteria 15417
215 Ga0105237_10035404 3300009545 Bacteria 5052
216 Ga0105238_10016299 3300009551 Bacteria 7521
217 Ga0105238_10152230 3300009551 Bacteria 2288
218 Ga0105249_10074684 3300009553 Bacteria 3139
219 Ga0105239_10030119 3300010375 Bacteria 5967
220 Ga0105246_10061627 3300011119 Bacteria 2611
221 Ga0157370_10162346 3300013104 Bacteria 2079
222 Ga0157370_10530964 3300013104 Bacteria 1079
223 Ga0157369_10058720 3300013105 Bacteria 4149
224 Ga0157374_10031054 3300013296 Bacteria 4851
225 Ga0157374_10040878 3300013296 Bacteria 4271
226 Ga0157374_10052887 3300013296 Bacteria 3784
227 Ga0157374_10064219 3300013296 Bacteria 3444
228 Ga0157374_10260256 3300013296 Bacteria 1709
229 Ga0157378_10192154 3300013297 Bacteria 1926
230 Ga0157378_10716694 3300013297 Bacteria 1021
231 Ga0163162_10047853 3300013306 Bacteria 4284
232 Ga0163162_10178661 3300013306 Bacteria 2248
233 Ga0163162_10206812 3300013306 Bacteria 2092
234 Ga0163162_10271665 3300013306 Bacteria 1827
235 Ga0157372_10013740 3300013307 Bacteria 8651
236 Ga0157372_10163891 3300013307 Bacteria 2570
237 Ga0157372_10368357 3300013307 Bacteria 1674
238 Ga0157375_10005174 3300013308 Bacteria 11316
239 Ga0157375_10014262 3300013308 Bacteria 7084
240 Ga0157375_10027908 3300013308 Bacteria 5281
241 Ga0157375_10043978 3300013308 Bacteria 4334
242 Ga0157375_10203394 3300013308 Bacteria 2136
243 Ga0157375_10239083 3300013308 Bacteria 1976
244 Ga0157375_10417487 3300013308 Bacteria 1508
245 Ga0163163_10003570 3300014325 Bacteria 13205
246 Ga0163163_10115810 3300014325 Bacteria 2711
247 Ga0163163_10170197 3300014325 Bacteria 2225
248 Ga0163163_10313596 3300014325 Bacteria 1622
249 Ga0157380_10088041 3300014326 Bacteria 2554
250 Ga0157380_10159855 3300014326 Bacteria 1957
251 Ga0157380_10215411 3300014326 Bacteria 1715
252 Ga0157380_10363464 3300014326 Bacteria 1359
253 Ga0157377_10001565 3300014745 Bacteria 9949
254 Ga0157377_10169007 3300014745 Bacteria 1366
255 Ga0157379_10010130 3300014968 Bacteria 8218
256 Ga0157379_10020334 3300014968 Bacteria 5869
257 Ga0157379_10043362 3300014968 Bacteria 4017
258 Ga0157379_10214716 3300014968 Bacteria 1742
259 Ga0157379_10229954 3300014968 Bacteria 1681
260 Ga0157379_10350325 3300014968 Bacteria 1352
261 Ga0157379_10424267 3300014968 Bacteria 1225
262 Ga0157376_10003307 3300014969 Bacteria 11099
263 Ga0157376_10077851 3300014969 Bacteria 2837
264 Ga0157376_10154832 3300014969 Bacteria 2071
265 Ga0157376_10239807 3300014969 Bacteria 1689
266 Ga0157376_10248362 3300014969 Bacteria 1661
267 Ga0163161_10006298 3300017792 Bacteria 8215
268 Ga0163161_10009331 3300017792 Bacteria 6789
269 Ga0163161_10430928 3300017792 Bacteria 1063
270 Ga0207425_1000802 3300025245 Bacteria 15938
271 Ga0209129_1000012 3300025258 Bacteria 541516
272 Ga0209564_1000022 3300025295 Bacteria 555109
273 Ga0209758_1000124 3300025297 Bacteria 189933
274 Ga0209758_1000234 3300025297 Bacteria 116217
275 Ga0207697_10003064 3300025315 Bacteria 8383
276 Ga0207697_10015695 3300025315 Bacteria 3126
277 Ga0207656_10067121 3300025321 Bacteria 1587
278 Ga0207682_10002801 3300025893 Bacteria 7710
279 Ga0207682_10005911 3300025893 Bacteria 4951
280 Ga0207682_10011716 3300025893 Bacteria 3427
281 Ga0207682_10033543 3300025893 Bacteria 2067
282 Ga0207682_10058226 3300025893 Bacteria 1612
283 Ga0207682_10092786 3300025893 Bacteria 1311
284 Ga0207642_10010828 3300025899 Bacteria 3231
285 Ga0207688_10058002 3300025901 Bacteria 2178
286 Ga0207688_10058459 3300025901 Bacteria 2169
287 Ga0207688_10227898 3300025901 Bacteria 1124
288 Ga0207680_10010662 3300025903 Bacteria 4608
289 Ga0207680_10058549 3300025903 Bacteria 2336
290 Ga0207645_10023445 3300025907 Bacteria 4012
291 Ga0207645_10024932 3300025907 Bacteria 3874
292 Ga0207645_10027684 3300025907 Bacteria 3659
293 Ga0207645_10049830 3300025907 Bacteria 2674
294 Ga0207645_10082477 3300025907 Bacteria 2061
295 Ga0207645_10204488 3300025907 Bacteria 1299
296 Ga0207645_10206752 3300025907 Bacteria 1292
297 Ga0207643_10084950 3300025908 Bacteria 1838
298 Ga0207643_10197607 3300025908 Bacteria 1223
299 Ga0207705_10033024 3300025909 Bacteria 3698
300 Ga0207684_10003264 3300025910 Bacteria 15912
301 Ga0207654_10052847 3300025911 Bacteria 2343
302 Ga0207707_10092626 3300025912 Bacteria 2641
303 Ga0207671_10023595 3300025914 Bacteria 4638
304 Ga0207671_10048096 3300025914 Bacteria 3156
305 Ga0207660_10056055 3300025917 Bacteria 2819
306 Ga0207662_10006607 3300025918 Bacteria 6264
307 Ga0207649_10041035 3300025920 Bacteria 2816
308 Ga0207649_10063732 3300025920 Bacteria 2328
309 Ga0207652_10009072 3300025921 Bacteria 8011
310 Ga0207681_10003514 3300025923 Bacteria 9755
311 Ga0207681_10025216 3300025923 Bacteria 3822
312 Ga0207681_10037524 3300025923 Bacteria 3203
313 Ga0207681_10470868 3300025923 Bacteria 1025
314 Ga0207650_10001276 3300025925 Bacteria 18258
315 Ga0207650_10007499 3300025925 Bacteria 7439
316 Ga0207650_10023626 3300025925 Bacteria 4362
317 Ga0207650_10127027 3300025925 Bacteria 1991
318 Ga0207650_10205477 3300025925 Bacteria 1579
319 Ga0207659_10002886 3300025926 Bacteria 10227
320 Ga0207659_10011834 3300025926 Bacteria 5526
321 Ga0207659_10014054 3300025926 Bacteria 5153
322 Ga0207659_10057723 3300025926 Bacteria 2785
323 Ga0207687_10065044 3300025927 Bacteria 2589
324 Ga0207687_10100888 3300025927 Bacteria 2124
325 Ga0207687_10329200 3300025927 Bacteria 1239
326 Ga0207644_10000523 3300025931 Bacteria 24867
327 Ga0207644_10001757 3300025931 Bacteria 14039
328 Ga0207644_10024131 3300025931 Bacteria 4172
329 Ga0207644_10026585 3300025931 Bacteria 3989
330 Ga0207644_10057199 3300025931 Bacteria 2815
331 Ga0207690_10101872 3300025932 Bacteria 2052
332 Ga0207706_10001906 3300025933 Bacteria 20489
333 Ga0207706_10006211 3300025933 Bacteria 11101
334 Ga0207706_10019872 3300025933 Bacteria 6038
335 Ga0207706_10024686 3300025933 Bacteria 5387
336 Ga0207706_10043492 3300025933 Bacteria 3980
337 Ga0207706_10125634 3300025933 Bacteria 2256
338 Ga0207686_10174035 3300025934 Bacteria 1521
339 Ga0207709_10048637 3300025935 Bacteria 2585
340 Ga0207670_10183929 3300025936 Bacteria 1576
341 Ga0207669_10016372 3300025937 Bacteria 3765
342 Ga0207669_10342931 3300025937 Bacteria 1151
343 Ga0207704_10032069 3300025938 Bacteria 2968
344 Ga0207704_10070145 3300025938 Bacteria 2218
345 Ga0207691_10003381 3300025940 Bacteria 15525
346 Ga0207691_10044552 3300025940 Bacteria 4083
347 Ga0207691_10061268 3300025940 Bacteria 3418
348 Ga0207691_10101973 3300025940 Bacteria 2560
349 Ga0207691_10109769 3300025940 Bacteria 2454
350 Ga0207691_10131704 3300025940 Bacteria 2208
351 Ga0207691_10149842 3300025940 Bacteria 2051
352 Ga0207711_10004582 3300025941 Bacteria 11755
353 Ga0207711_10008794 3300025941 Bacteria 8444
354 Ga0207711_10028615 3300025941 Bacteria 4692
355 Ga0207711_10048247 3300025941 Bacteria 3643
356 Ga0207711_10149051 3300025941 Bacteria 2110
357 Ga0207689_10003664 3300025942 Bacteria 14006
358 Ga0207689_10035048 3300025942 Bacteria 4169
359 Ga0207689_10063010 3300025942 Bacteria 3049
360 Ga0207661_10037727 3300025944 Bacteria 3782
361 Ga0207661_10203771 3300025944 Bacteria 1740
362 Ga0207679_10008387 3300025945 Bacteria 6580
363 Ga0207679_10030713 3300025945 Bacteria 3754
364 Ga0207679_10093087 3300025945 Bacteria 2336
365 Ga0207679_10234094 3300025945 Bacteria 1553
366 Ga0207679_10266734 3300025945 Bacteria 1463
367 Ga0207679_10337306 3300025945 Bacteria 1310
368 Ga0207651_10001062 3300025960 Bacteria 12183
369 Ga0207651_10014368 3300025960 Bacteria 4568
370 Ga0207651_10375358 3300025960 Bacteria 1204
371 Ga0207651_10410093 3300025960 Bacteria 1154
372 Ga0207651_10479793 3300025960 Bacteria 1071
373 Ga0207712_10048342 3300025961 Bacteria 2959
374 Ga0207712_10097655 3300025961 Bacteria 2177
375 Ga0207668_10020637 3300025972 Bacteria 4190
376 Ga0207668_10033710 3300025972 Bacteria 3394
377 Ga0207668_10178318 3300025972 Bacteria 1673
378 Ga0207640_10049149 3300025981 Bacteria 2729
379 Ga0207640_10073760 3300025981 Bacteria 2307
380 Ga0207640_10087561 3300025981 Bacteria 2147
381 Ga0207640_10202395 3300025981 Bacteria 1506
382 Ga0207658_10016179 3300025986 Bacteria 5125
383 Ga0207658_10140191 3300025986 Bacteria 1955
384 Ga0207658_10202601 3300025986 Bacteria 1658
385 Ga0207658_10210366 3300025986 Bacteria 1629
386 Ga0207658_10403049 3300025986 Bacteria 1203
387 Ga0207658_10552786 3300025986 Bacteria 1030
388 Ga0207677_10002493 3300026023 Bacteria 9661
389 Ga0207677_10028700 3300026023 Bacteria 3524
390 Ga0207677_10134704 3300026023 Bacteria 1881
391 Ga0207677_10151054 3300026023 Bacteria 1792
392 Ga0207703_10005450 3300026035 Bacteria 10235
393 Ga0207703_10036096 3300026035 Bacteria 3932
394 Ga0207639_10117864 3300026041 Bacteria 2176
395 Ga0207639_10489276 3300026041 Bacteria 1122
396 Ga0207678_10040687 3300026067 Bacteria 4030
397 Ga0207678_10082065 3300026067 Bacteria 2759
398 Ga0207678_10112336 3300026067 Bacteria 2324
399 Ga0207678_10154674 3300026067 Bacteria 1958
400 Ga0207708_10012477 3300026075 Bacteria 6333
401 Ga0207708_10233638 3300026075 Bacteria 1477
402 Ga0207708_10460076 3300026075 Bacteria 1061
403 Ga0207702_10099445 3300026078 Bacteria 2564
404 Ga0207641_10002150 3300026088 Bacteria 18573
405 Ga0207641_10009103 3300026088 Bacteria 8202
406 Ga0207641_10019205 3300026088 Bacteria 5608
407 Ga0207641_10021621 3300026088 Bacteria 5285
408 Ga0207641_10059586 3300026088 Bacteria 3251
409 Ga0207641_10115113 3300026088 Bacteria 2390
410 Ga0207648_10004239 3300026089 Bacteria 14817
411 Ga0207648_10010311 3300026089 Bacteria 8871
412 Ga0207648_10021145 3300026089 Bacteria 5850
413 Ga0207648_10039013 3300026089 Bacteria 4178
414 Ga0207648_10094008 3300026089 Bacteria 2621
415 Ga0207648_10143164 3300026089 Bacteria 2108
416 Ga0207648_10311599 3300026089 Bacteria 1413
417 Ga0207648_10358799 3300026089 Bacteria 1315
418 Ga0207676_10004991 3300026095 Bacteria 9400
419 Ga0207676_10011582 3300026095 Bacteria 6306
420 Ga0207676_10033040 3300026095 Bacteria 3906
421 Ga0207676_10045595 3300026095 Bacteria 3388
422 Ga0207676_10079068 3300026095 Bacteria 2666
423 Ga0207676_10254464 3300026095 Bacteria 1582
424 Ga0207676_10551427 3300026095 Bacteria 1101
425 Ga0207674_10159975 3300026116 Bacteria 2206
426 Ga0207674_10184093 3300026116 Bacteria 2039
427 Ga0207675_100008151 3300026118 Bacteria 9875
428 Ga0207675_100023191 3300026118 Bacteria 5771
429 Ga0207675_100161335 3300026118 Bacteria 2138
430 Ga0207675_100187106 3300026118 Bacteria 1985
431 Ga0207683_10025450 3300026121 Bacteria 5106
432 Ga0207683_10080603 3300026121 Bacteria 2888
433 Ga0207683_10083536 3300026121 Bacteria 2838
434 Ga0207683_10156000 3300026121 Bacteria 2062
435 Ga0207683_10163204 3300026121 Bacteria 2015
436 Ga0207683_10195091 3300026121 Bacteria 1839
437 Ga0207698_10016587 3300026142 Bacteria 4970
438 Ga0207698_10044118 3300026142 Bacteria 3347
439 Ga0207698_10136893 3300026142 Bacteria 2103
440 Ga0207698_10157641 3300026142 Bacteria 1980
441 Ga0207698_10245947 3300026142 Bacteria 1633
442 Ga0209813_10001726 3300027866 Bacteria 4922
443 Ga0209813_10006806 3300027866 Bacteria 2832
444 Ga0209813_10069947 3300027866 Bacteria 1139
445 Ga0209974_10001641 3300027876 Bacteria 8098
446 Ga0268266_10060195 3300028379 Bacteria 3273
447 Ga0268266_10072607 3300028379 Bacteria 2985
448 Ga0268266_10166821 3300028379 Bacteria 1996
449 Ga0268266_10190097 3300028379 Bacteria 1874
450 Ga0268265_10106367 3300028380 Bacteria 2279
451 Ga0268265_10162748 3300028380 Bacteria 1898
452 Ga0268264_10003375 3300028381 Bacteria 13788
453 Ga0268264_10020755 3300028381 Bacteria 5368
454 Ga0268264_10206482 3300028381 Bacteria 1800
455 Ga0307517_10077045 3300028786 Bacteria 2903
456 Ga0307517_10088076 3300028786 Bacteria 2571
457 Ga0307515_10000138 3300028794 Bacteria 173220
458 Ga0307515_10001206 3300028794 Bacteria 59045
459 Ga0307515_10011495 3300028794 Bacteria 16801
460 Ga0307515_10087663 3300028794 Bacteria 3946
461 Ga0307512_10059574 3300030522 Bacteria 2961
462 Ga0307512_10109888 3300030522 Bacteria 1822
463 Ga0265328_10013306 3300031239 Bacteria 3261
464 Ga0307513_10017125 3300031456 Bacteria 8704
465 Ga0307513_10098065 3300031456 Bacteria 2963
466 Ga0307513_10106681 3300031456 Bacteria 2806
467 Ga0307513_10277999 3300031456 Bacteria 1453
468 Ga0307513_10341078 3300031456 Bacteria 1249
469 Ga0307509_10000249 3300031507 Bacteria 87094
470 Ga0307509_10003703 3300031507 Bacteria 22876
471 Ga0307509_10197563 3300031507 Bacteria 1853
472 Ga0307508_10000216 3300031616 Bacteria 69990
473 Ga0307508_10006698 3300031616 Bacteria 10804
474 Ga0307514_10015854 3300031649 Bacteria 6210
475 Ga0307516_10006485 3300031730 Bacteria 13704
476 Ga0307516_10174805 3300031730 Bacteria 1885
477 Ga0307405_10118973 3300031731 Bacteria 1804
478 Ga0307413_10057428 3300031824 Bacteria 2380
479 Ga0307413_10115720 3300031824 Unclassified 1805
480 Ga0307410_10138158 3300031852 Bacteria 1799
481 Ga0307406_10023123 3300031901 Bacteria 3696
482 Ga0307407_10210016 3300031903 Bacteria 1310
483 Ga0307412_10027498 3300031911 Bacteria 3547
484 Ga0307412_10034896 3300031911 Bacteria 3209
485 Ga0307409_100131501 3300031995 Bacteria 2140
486 Ga0307409_100304806 3300031995 Bacteria 1484
487 Ga0307416_100014114 3300032002 Bacteria 5457
488 Ga0307416_100061065 3300032002 Bacteria 3074
489 Ga0307411_10012282 3300032005 Bacteria 4665
490 Ga0307411_10016314 3300032005 Bacteria 4202
491 Ga0307507_10058387 3300033179 Bacteria 3623
492 Ga0307510_10009738 3300033180 Bacteria 11436
493 Ga0373949_0046589 3300035090 Bacteria 1081
494 Ga0373956_0094396 3300035119 Bacteria 1382
495 Ga0373957_0093147 3300035120 Bacteria 1200
496 Ga0373955_0065797 3300035172 Bacteria 2013
497 Ga0373931_0002695 3300035691 Bacteria 7904
498 Ga0373935_0129552 3300035692 Bacteria 1694
499 Ga0373947_0074319 3300035725 Bacteria 2091
500 Ga0373937_0044214 3300036401 Bacteria 4067
501 Ga0373925_0050008 3300037068 Bacteria 3117
502 Ga0395905_0000140 3300037471 Bacteria 120221
503 Ga0395905_0010653 3300037471 Bacteria 8919
504 Ga0395905_0285650 3300037471 Bacteria 1537
505 Ga0436363_0457939 3300039450 Bacteria 2488
506 Ga0451793_0320329 3300041452 Bacteria 949
507 Ga0451793_0659484 3300041452 Bacteria 2027
508 Ga0451798_0362761 3300041458 Bacteria 2178
509 Ga0451804_0090619 3300041463 Bacteria 1251
510 Ga0451807_0096601 3300041486 Bacteria 1451
511 Ga0451841_0104201 3300041498 Bacteria 1678
512 Ga0451853_1937147 3300041512 Bacteria 1393
513 Ga0466969_0000020 3300044656 Bacteria 101861
514 Ga0466972_0000594 3300044658 Bacteria 17607
515 Ga0466972_0034624 3300044658 Bacteria 2473
516 Ga0466965_0040007 3300044683 Bacteria 2306
517 Ga0466965_0040218 3300044683 Bacteria 2301
518 Ga0466965_0070563 3300044683 Bacteria 1756
519 Ga0466966_0030555 3300044684 Bacteria 3496
520 Ga0466961_0019127 3300044693 Bacteria 4407
521 Ga0466961_0187416 3300044693 Bacteria 1283
522 Ga0453684_0020128 3300044712 Bacteria 10096
523 Ga0453684_0086122 3300044712 Bacteria 3900
524 Ga0466971_0064726 3300044719 Bacteria 1655
525 Ga0466970_0046815 3300044765 Bacteria 2304
526 Ga0466957_0047364 3300044842 Bacteria 2612
527 Ga0466960_0184303 3300044901 Bacteria 1133
528 Ga0451576_0212037 3300045051 Bacteria 2022
529 Ga0466967_0291581 3300045976 Bacteria 1568
530 Ga0495592_0001883 3300046454 Bacteria 14765
531 Ga0495629_0148636 3300046459 Bacteria 1629
532 Ga0495582_0252674 3300046473 Bacteria 1011
533 Ga0495628_0242193 3300046516 Bacteria 1349
534 Ga0495632_0010839 3300046519 Bacteria 5362
535 Ga0495632_0035845 3300046519 Bacteria 2527
536 Ga0495598_0048524 3300046537 Bacteria 1270
537 Ga0495645_0062606 3300046543 Bacteria 2695
538 Ga0495668_0153315 3300046616 Bacteria 1262
539 Ga0495625_0004997 3300046660 Bacteria 12312
540 Ga0495647_0003210 3300046681 Bacteria 5230
541 Ga0495658_0052347 3300046683 Bacteria 2315
542 Ga0495658_0224679 3300046683 Bacteria 1176
543 Ga0495684_0111770 3300047471 Bacteria 2061
544 Ga0495686_0182833 3300047472 Bacteria 1214
545 Ga0496100_0004969 3300048903 Bacteria 7109
546 Ga0496102_0002898 3300048905 Bacteria 14539
547 Ga0496102_0066858 3300048905 Bacteria 3295
548 Ga0496104_0146090 3300048907 Bacteria 2271
549 Ga0496105_0126952 3300048908 Bacteria 2103
550 Ga0496106_0025160 3300048909 Bacteria 4428
551 Ga0496107_0003649 3300048910 Bacteria 10348
552 Ga0496108_0014761 3300048911 Bacteria 6376
553 Ga0496109_0185242 3300048912 Bacteria 1956
554 Ga0496110_0034479 3300048913 Bacteria 4384
555 Ga0496111_0246096 3300048914 Bacteria 1327
556 Ga0496112_0241198 3300048915 Bacteria 1760
557 nmdc:mga03683_159822_c1 3300050489 Bacteria 1020
558 nmdc:mga03n38_164991_c1 3300050490 Bacteria 1124
559 nmdc:mga03n38_208194_c1 3300050490 Bacteria 1015
560 nmdc:mga03n38_24590_c1 3300050490 Bacteria 2464
561 nmdc:mga0k408_105924_c1 3300050493 Bacteria 1661
562 nmdc:mga0k408_1135_c1 3300050493 Bacteria 14614
563 nmdc:mga0k408_1245_c1 3300050493 Bacteria 13917
564 nmdc:mga0k408_32874_c1 3300050493 Bacteria 2964
565 nmdc:mga0k408_4061_c1 3300050493 Bacteria 7765
566 nmdc:mga0k408_49318_c1 3300050493 Bacteria 2437
567 nmdc:mga0k408_669_c1 3300050493 Bacteria 18779
568 nmdc:mga0k408_7292_c1 3300050493 Bacteria 5907
569 nmdc:mga06z11_215045_c1 3300050494 Bacteria 1121
570 nmdc:mga06z11_2171_c1 3300050494 Bacteria 7447
571 nmdc:mga06z11_8664_c1 3300050494 Bacteria 4255
572 nmdc:mga04h51_15581_c1 3300050495 Bacteria 2192
573 nmdc:mga04h51_1899_c1 3300050495 Bacteria 4876
574 nmdc:mga07m45_10728_c1 3300050496 Bacteria 4794
575 nmdc:mga07m45_1153_c1 3300050496 Bacteria 11861
576 nmdc:mga07m45_3113_c1 3300050496 Bacteria 7940
577 nmdc:mga07m45_52553_c1 3300050496 Bacteria 2300
578 nmdc:mga07m45_6321_c1 3300050496 Bacteria 5984
579 nmdc:mga0sz30_30396_c1 3300050516 Bacteria 2231
580 nmdc:mga0sz30_8564_c1 3300050516 Bacteria 3865
581 Ga0495601_0032063 3300053077 Bacteria 3269
582 Ga0500578_0000673 3300053086 Bacteria 40901
583 Ga0500651_0276409 3300053093 Bacteria 970
584 Ga0500650_0046776 3300053098 Bacteria 2005
585 Ga0500562_024019 3300053108 Bacteria 1593
586 Ga0500593_000680 3300053117 Bacteria 12914
587 Ga0500607_078551 3300053121 Bacteria 1687
588 Ga0500628_019472 3300053129 Bacteria 1351
589 Ga0500652_056670 3300053131 Bacteria 1607
590 Ga0500568_0028336 3300053139 Bacteria 2335
591 Ga0500619_000006 3300053154 Bacteria 77270
592 Ga0500619_009997 3300053154 Bacteria 2379
593 Ga0500622_0000872 3300053156 Bacteria 25676
594 Ga0500570_053603 3300053724 Bacteria 2008
595 Ga0500587_000047 3300053739 Bacteria 9955
596 Ga0466962_0006584 3300061719 Bacteria 5573
597 Ga0466962_0037915 3300061719 Bacteria 2309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030522 Ga0307512_10059574 Ga0307512_100595743 230
2 3300005327 Ga0070658_10016712 Ga0070658_100167125 231
3 3300005339 Ga0070660_100083259 Ga0070660_1000832593 231
4 3300005535 Ga0070684_100005261 Ga0070684_1000052617 231
5 3300005564 Ga0070664_100015313 Ga0070664_1000153133 231
6 3300005577 Ga0068857_100010507 Ga0068857_1000105077 231
7 3300005614 Ga0068856_100013192 Ga0068856_1000131925 231
8 3300005616 Ga0068852_100013380 Ga0068852_1000133803 231
9 3300005834 Ga0068851_10207598 Ga0068851_102075982 231
10 3300013104 Ga0157370_10162346 Ga0157370_101623462 231
11 3300013105 Ga0157369_10058720 Ga0157369_100587203 231
12 3300013296 Ga0157374_10052887 Ga0157374_100528873 231
13 3300013307 Ga0157372_10013740 Ga0157372_100137403 231
14 3300028794 Ga0307515_10000138 Ga0307515_1000013846 231
15 3300061719 Ga0466962_0037915 Ga0466962_0037915_397_1233 231
16 3300006177 Ga0075362_10042877 Ga0075362_100428772 232
17 3300013297 Ga0157378_10716694 Ga0157378_107166941 232
18 3300025909 Ga0207705_10033024 Ga0207705_100330245 232
19 3300025945 Ga0207679_10008387 Ga0207679_100083875 232
20 3300025960 Ga0207651_10375358 Ga0207651_103753581 232
21 3300026078 Ga0207702_10099445 Ga0207702_100994453 232
22 3300026116 Ga0207674_10184093 Ga0207674_101840932 232
23 3300026142 Ga0207698_10044118 Ga0207698_100441182 232
24 3300028786 Ga0307517_10077045 Ga0307517_100770452 232
25 3300028786 Ga0307517_10088076 Ga0307517_100880763 232
26 3300028794 Ga0307515_10087663 Ga0307515_100876631 232
27 3300031456 Ga0307513_10277999 Ga0307513_102779992 232
28 3300044656 Ga0466969_0000020 Ga0466969_0000020_11819_12655 232
29 3300044683 Ga0466965_0070563 Ga0466965_0070563_431_1267 232
30 3300044684 Ga0466966_0030555 Ga0466966_0030555_2555_3391 232
31 3300044693 Ga0466961_0019127 Ga0466961_0019127_1190_2026 232
32 3300053724 Ga0500570_053603 Ga0500570_053603_865_1701 232
33 3300005445 Ga0070708_100338018 Ga0070708_1003380182 233
34 3300006048 Ga0075363_100224254 Ga0075363_1002242542 233
35 3300006195 Ga0075366_10001768 Ga0075366_100017686 233
36 3300006353 Ga0075370_10001151 Ga0075370_100011518 233
37 3300035119 Ga0373956_0094396 Ga0373956_0094396_239_1063 233
38 3300035120 Ga0373957_0093147 Ga0373957_0093147_167_991 233
39 3300035172 Ga0373955_0065797 Ga0373955_0065797_1030_1854 233
40 3300035725 Ga0373947_0074319 Ga0373947_0074319_676_1500 233
41 3300036401 Ga0373937_0044214 Ga0373937_0044214_39_863 233
42 3300037068 Ga0373925_0050008 Ga0373925_0050008_940_1764 233
43 3300046459 Ga0495629_0148636 Ga0495629_0148636_691_1515 233
44 3300046516 Ga0495628_0242193 Ga0495628_0242193_36_860 233
45 3300046543 Ga0495645_0062606 Ga0495645_0062606_200_1024 233
46 3300046683 Ga0495658_0052347 Ga0495658_0052347_343_1167 233
47 3300047471 Ga0495684_0111770 Ga0495684_0111770_533_1357 233
48 3300050493 nmdc:mga0k408_49318_c1 nmdc:mga0k408_49318_c1_363_1229 233
49 3300050496 nmdc:mga07m45_10728_c1 nmdc:mga07m45_10728_c1_1249_2076 233
50 3300005338 Ga0068868_100069894 Ga0068868_1000698942 234
51 3300005366 Ga0070659_100122710 Ga0070659_1001227103 234
52 3300005458 Ga0070681_10017630 Ga0070681_100176302 234
53 3300005530 Ga0070679_100000726 Ga0070679_10000072627 234
54 3300005578 Ga0068854_100013710 Ga0068854_1000137103 234
55 3300006042 Ga0075368_10018606 Ga0075368_100186063 234
56 3300006048 Ga0075363_100061252 Ga0075363_1000612523 234
57 3300006178 Ga0075367_10048227 Ga0075367_100482272 234
58 3300006186 Ga0075369_10028340 Ga0075369_100283402 234
59 3300009148 Ga0105243_10042764 Ga0105243_100427645 234
60 3300009545 Ga0105237_10004861 Ga0105237_1000486115 234
61 3300010375 Ga0105239_10030119 Ga0105239_100301194 234
62 3300025912 Ga0207707_10092626 Ga0207707_100926264 234
63 3300025914 Ga0207671_10023595 Ga0207671_100235953 234
64 3300025917 Ga0207660_10056055 Ga0207660_100560554 234
65 3300025921 Ga0207652_10009072 Ga0207652_100090727 234
66 3300025932 Ga0207690_10101872 Ga0207690_101018722 234
67 3300025933 Ga0207706_10024686 Ga0207706_100246864 234
68 3300025942 Ga0207689_10063010 Ga0207689_100630102 234
69 3300025961 Ga0207712_10097655 Ga0207712_100976552 234
70 3300026023 Ga0207677_10134704 Ga0207677_101347042 234
71 3300027866 Ga0209813_10006806 Ga0209813_100068063 234
72 3300031456 Ga0307513_10341078 Ga0307513_103410781 234
73 3300050490 nmdc:mga03n38_24590_c1 nmdc:mga03n38_24590_c1_848_1705 234
74 3300050494 nmdc:mga06z11_8664_c1 nmdc:mga06z11_8664_c1_49_906 234
75 3300050495 nmdc:mga04h51_15581_c1 nmdc:mga04h51_15581_c1_1120_1977 234
76 3300050516 nmdc:mga0sz30_30396_c1 nmdc:mga0sz30_30396_c1_692_1549 234
77 3300053117 Ga0500593_000680 Ga0500593_000680_1051_1899 234
78 3300006186 Ga0075369_10020713 Ga0075369_100207133 235
79 3300030522 Ga0307512_10109888 Ga0307512_101098882 235
80 3300031507 Ga0307509_10000249 Ga0307509_1000024969 235
81 3300031730 Ga0307516_10174805 Ga0307516_101748053 235
82 3300033180 Ga0307510_10009738 Ga0307510_100097382 235
83 3300046454 Ga0495592_0001883 Ga0495592_0001883_8768_9559 235
84 3300053093 Ga0500651_0276409 Ga0500651_0276409_158_949 235
85 3300053121 Ga0500607_078551 Ga0500607_078551_767_1618 235
86 3300053154 Ga0500619_009997 Ga0500619_009997_144_935 235
87 3300005459 Ga0068867_100014496 Ga0068867_1000144965 236
88 3300005618 Ga0068864_100233074 Ga0068864_1002330742 236
89 3300005718 Ga0068866_10087404 Ga0068866_100874042 236
90 3300006042 Ga0075368_10000682 Ga0075368_100006829 236
91 3300006051 Ga0075364_10124329 Ga0075364_101243292 236
92 3300006177 Ga0075362_10016796 Ga0075362_100167963 236
93 3300006178 Ga0075367_10032551 Ga0075367_100325513 236
94 3300006195 Ga0075366_10005954 Ga0075366_100059545 236
95 3300006195 Ga0075366_10095314 Ga0075366_100953142 236
96 3300006195 Ga0075366_10137621 Ga0075366_101376212 236
97 3300025907 Ga0207645_10206752 Ga0207645_102067521 236
98 3300025920 Ga0207649_10063732 Ga0207649_100637322 236
99 3300025945 Ga0207679_10337306 Ga0207679_103373061 236
100 3300026089 Ga0207648_10021145 Ga0207648_100211455 236
101 3300027866 Ga0209813_10001726 Ga0209813_100017267 236
102 3300028379 Ga0268266_10166821 Ga0268266_101668213 236
103 3300035692 Ga0373935_0129552 Ga0373935_0129552_212_1048 236
104 3300046683 Ga0495658_0224679 Ga0495658_0224679_17_853 236
105 3300050493 nmdc:mga0k408_1135_c1 nmdc:mga0k408_1135_c1_6296_7150 236
106 3300050495 nmdc:mga04h51_1899_c1 nmdc:mga04h51_1899_c1_220_1071 236
107 3300050516 nmdc:mga0sz30_8564_c1 nmdc:mga0sz30_8564_c1_543_1394 236
108 3300053077 Ga0495601_0032063 Ga0495601_0032063_1051_1887 236
109 3300005347 Ga0070668_100277076 Ga0070668_1002770762 237
110 3300005353 Ga0070669_100173734 Ga0070669_1001737342 237
111 3300005364 Ga0070673_100120925 Ga0070673_1001209252 237
112 3300005535 Ga0070684_100451596 Ga0070684_1004515962 237
113 3300005547 Ga0070693_100041764 Ga0070693_1000417643 237
114 3300005616 Ga0068852_100114694 Ga0068852_1001146942 237
115 3300013104 Ga0157370_10530964 Ga0157370_105309641 237
116 3300013307 Ga0157372_10368357 Ga0157372_103683572 237
117 3300025944 Ga0207661_10037727 Ga0207661_100377275 237
118 3300025945 Ga0207679_10030713 Ga0207679_100307134 237
119 3300025986 Ga0207658_10202601 Ga0207658_102026013 237
120 3300026095 Ga0207676_10551427 Ga0207676_105514272 237
121 3300053154 Ga0500619_000006 Ga0500619_000006_12501_13313 237
122 3300005328 Ga0070676_10021221 Ga0070676_100212211 238
123 3300005330 Ga0070690_100017758 Ga0070690_1000177585 238
124 3300005331 Ga0070670_100080193 Ga0070670_1000801933 238
125 3300005333 Ga0070677_10005615 Ga0070677_100056157 238
126 3300005335 Ga0070666_10004086 Ga0070666_100040869 238
127 3300005338 Ga0068868_100001343 Ga0068868_10000134310 238
128 3300005340 Ga0070689_100156502 Ga0070689_1001565022 238
129 3300005354 Ga0070675_100003418 Ga0070675_10000341810 238
130 3300005365 Ga0070688_100019843 Ga0070688_1000198436 238
131 3300005456 Ga0070678_100081202 Ga0070678_1000812022 238
132 3300005459 Ga0068867_100071487 Ga0068867_1000714872 238
133 3300005548 Ga0070665_100007443 Ga0070665_1000074435 238
134 3300005617 Ga0068859_100001451 Ga0068859_1000014518 238
135 3300005618 Ga0068864_100002901 Ga0068864_10000290110 238
136 3300005719 Ga0068861_100145774 Ga0068861_1001457742 238
137 3300005719 Ga0068861_100329349 Ga0068861_1003293492 238
138 3300005841 Ga0068863_100010181 Ga0068863_1000101812 238
139 3300005844 Ga0068862_100042040 Ga0068862_1000420403 238
140 3300006237 Ga0097621_100009422 Ga0097621_1000094223 238
141 3300006358 Ga0068871_100076558 Ga0068871_1000765584 238
142 3300006931 Ga0097620_100001451 Ga0097620_1000014518 238
143 3300009177 Ga0105248_10008335 Ga0105248_1000833510 238
144 3300013297 Ga0157378_10192154 Ga0157378_101921542 238
145 3300013306 Ga0163162_10178661 Ga0163162_101786613 238
146 3300013306 Ga0163162_10206812 Ga0163162_102068123 238
147 3300013308 Ga0157375_10027908 Ga0157375_100279085 238
148 3300013308 Ga0157375_10417487 Ga0157375_104174872 238
149 3300014325 Ga0163163_10003570 Ga0163163_1000357010 238
150 3300014326 Ga0157380_10215411 Ga0157380_102154112 238
151 3300014968 Ga0157379_10229954 Ga0157379_102299542 238
152 3300014968 Ga0157379_10424267 Ga0157379_104242672 238
153 3300014969 Ga0157376_10248362 Ga0157376_102483622 238
154 3300017792 Ga0163161_10430928 Ga0163161_104309282 238
155 3300025893 Ga0207682_10005911 Ga0207682_100059112 238
156 3300025903 Ga0207680_10010662 Ga0207680_100106624 238
157 3300025908 Ga0207643_10197607 Ga0207643_101976071 238
158 3300025923 Ga0207681_10037524 Ga0207681_100375242 238
159 3300025926 Ga0207659_10002886 Ga0207659_1000288611 238
160 3300025931 Ga0207644_10024131 Ga0207644_100241313 238
161 3300025933 Ga0207706_10043492 Ga0207706_100434925 238
162 3300025936 Ga0207670_10183929 Ga0207670_101839292 238
163 3300025940 Ga0207691_10109769 Ga0207691_101097692 238
164 3300025941 Ga0207711_10028615 Ga0207711_100286155 238
165 3300025960 Ga0207651_10001062 Ga0207651_100010626 238
166 3300025961 Ga0207712_10048342 Ga0207712_100483423 238
167 3300025972 Ga0207668_10178318 Ga0207668_101783182 238
168 3300026023 Ga0207677_10002493 Ga0207677_100024932 238
169 3300026035 Ga0207703_10005450 Ga0207703_1000545010 238
170 3300026067 Ga0207678_10112336 Ga0207678_101123362 238
171 3300026075 Ga0207708_10460076 Ga0207708_104600761 238
172 3300026088 Ga0207641_10002150 Ga0207641_100021508 238
173 3300026089 Ga0207648_10094008 Ga0207648_100940082 238
174 3300026095 Ga0207676_10004991 Ga0207676_100049912 238
175 3300026118 Ga0207675_100161335 Ga0207675_1001613352 238
176 3300026118 Ga0207675_100187106 Ga0207675_1001871061 238
177 3300026121 Ga0207683_10163204 Ga0207683_101632042 238
178 3300028379 Ga0268266_10060195 Ga0268266_100601956 238
179 3300031456 Ga0307513_10017125 Ga0307513_100171256 238
180 3300044658 Ga0466972_0034624 Ga0466972_0034624_1296_2117 238
181 3300046681 Ga0495647_0003210 Ga0495647_0003210_4260_5108 238
182 3300048908 Ga0496105_0126952 Ga0496105_0126952_604_1440 238
183 3300048911 Ga0496108_0014761 Ga0496108_0014761_2781_3626 238
184 3300002773 JGI25152J39213_1000662 JGI25152J39213_100066213 239
185 3300003215 JGI25153J46596_10003371 JGI25153J46596_100033717 239
186 3300003771 Ga0055526_1001626 Ga0055526_10016267 239
187 3300005459 Ga0068867_100017829 Ga0068867_1000178292 239
188 3300006195 Ga0075366_10221944 Ga0075366_102219441 239
189 3300013308 Ga0157375_10014262 Ga0157375_100142625 239
190 3300025245 Ga0207425_1000802 Ga0207425_100080215 239
191 3300025258 Ga0209129_1000012 Ga0209129_1000012263 239
192 3300025295 Ga0209564_1000022 Ga0209564_1000022251 239
193 3300025297 Ga0209758_1000234 Ga0209758_1000234108 239
194 3300025925 Ga0207650_10007499 Ga0207650_100074998 239
195 3300025960 Ga0207651_10410093 Ga0207651_104100932 239
196 3300025986 Ga0207658_10210366 Ga0207658_102103663 239
197 3300025986 Ga0207658_10403049 Ga0207658_104030492 239
198 3300026089 Ga0207648_10358799 Ga0207648_103587992 239
199 iso_pu_bacteria 2585428062 2587759504 239
200 3300005331 Ga0070670_100013611 Ga0070670_1000136112 240
201 3300005841 Ga0068863_100831740 Ga0068863_1008317401 240
202 3300014325 Ga0163163_10115810 Ga0163163_101158103 240
203 3300037471 Ga0395905_0000140 Ga0395905_0000140_76413_77378 240
204 3300050493 nmdc:mga0k408_4061_c1 nmdc:mga0k408_4061_c1_1556_2305 240
205 3300005344 Ga0070661_100181398 Ga0070661_1001813982 241
206 3300005354 Ga0070675_100137894 Ga0070675_1001378942 241
207 3300005355 Ga0070671_100169440 Ga0070671_1001694403 241
208 3300005456 Ga0070678_100033281 Ga0070678_1000332815 241
209 3300005543 Ga0070672_100086298 Ga0070672_1000862982 241
210 3300005544 Ga0070686_100364279 Ga0070686_1003642791 241
211 3300005564 Ga0070664_100224211 Ga0070664_1002242113 241
212 3300005718 Ga0068866_10130962 Ga0068866_101309621 241
213 3300006048 Ga0075363_100024753 Ga0075363_1000247533 241
214 3300006178 Ga0075367_10049792 Ga0075367_100497922 241
215 3300006186 Ga0075369_10018641 Ga0075369_100186413 241
216 3300006237 Ga0097621_100151519 Ga0097621_1001515192 241
217 3300006353 Ga0075370_10012585 Ga0075370_100125853 241
218 3300006358 Ga0068871_100082655 Ga0068871_1000826554 241
219 3300009147 Ga0114129_10080001 Ga0114129_100800014 241
220 3300014969 Ga0157376_10239807 Ga0157376_102398072 241
221 3300025907 Ga0207645_10027684 Ga0207645_100276845 241
222 3300031507 Ga0307509_10003703 Ga0307509_1000370312 241
223 3300031731 Ga0307405_10118973 Ga0307405_101189732 241
224 3300031911 Ga0307412_10034896 Ga0307412_100348963 241
225 3300032002 Ga0307416_100014114 Ga0307416_1000141142 241
226 3300046473 Ga0495582_0252674 Ga0495582_0252674_103_969 241
227 3300050490 nmdc:mga03n38_208194_c1 nmdc:mga03n38_208194_c1_95_916 241
228 3300050493 nmdc:mga0k408_32874_c1 nmdc:mga0k408_32874_c1_101_922 241
229 3300050493 nmdc:mga0k408_7292_c1 nmdc:mga0k408_7292_c1_1443_2174 241
230 3300050496 nmdc:mga07m45_1153_c1 nmdc:mga07m45_1153_c1_101_922 241
231 3300005331 Ga0070670_100034305 Ga0070670_1000343053 242
232 3300005333 Ga0070677_10052567 Ga0070677_100525672 242
233 3300005333 Ga0070677_10063098 Ga0070677_100630982 242
234 3300005344 Ga0070661_100225204 Ga0070661_1002252042 242
235 3300005354 Ga0070675_100343512 Ga0070675_1003435122 242
236 3300005355 Ga0070671_100135962 Ga0070671_1001359622 242
237 3300005355 Ga0070671_100232935 Ga0070671_1002329352 242
238 3300005364 Ga0070673_100295974 Ga0070673_1002959742 242
239 3300005367 Ga0070667_100030336 Ga0070667_1000303366 242
240 3300005456 Ga0070678_100163811 Ga0070678_1001638112 242
241 3300005459 Ga0068867_100030867 Ga0068867_1000308674 242
242 3300005616 Ga0068852_100185077 Ga0068852_1001850772 242
243 3300005842 Ga0068858_100010630 Ga0068858_1000106308 242
244 3300009177 Ga0105248_10232105 Ga0105248_102321052 242
245 3300013308 Ga0157375_10043978 Ga0157375_100439785 242
246 3300014325 Ga0163163_10170197 Ga0163163_101701974 242
247 3300014969 Ga0157376_10154832 Ga0157376_101548322 242
248 3300025315 Ga0207697_10015695 Ga0207697_100156954 242
249 3300025893 Ga0207682_10011716 Ga0207682_100117162 242
250 3300025893 Ga0207682_10092786 Ga0207682_100927862 242
251 3300025901 Ga0207688_10227898 Ga0207688_102278981 242
252 3300025907 Ga0207645_10023445 Ga0207645_100234455 242
253 3300025907 Ga0207645_10204488 Ga0207645_102044882 242
254 3300025920 Ga0207649_10041035 Ga0207649_100410354 242
255 3300025925 Ga0207650_10023626 Ga0207650_100236263 242
256 3300025925 Ga0207650_10127027 Ga0207650_101270272 242
257 3300025926 Ga0207659_10057723 Ga0207659_100577233 242
258 3300025931 Ga0207644_10026585 Ga0207644_100265853 242
259 3300025931 Ga0207644_10057199 Ga0207644_100571994 242
260 3300025933 Ga0207706_10125634 Ga0207706_101256342 242
261 3300025937 Ga0207669_10342931 Ga0207669_103429311 242
262 3300025938 Ga0207704_10070145 Ga0207704_100701453 242
263 3300025940 Ga0207691_10101973 Ga0207691_101019732 242
264 3300025940 Ga0207691_10149842 Ga0207691_101498423 242
265 3300025941 Ga0207711_10048247 Ga0207711_100482474 242
266 3300025941 Ga0207711_10149051 Ga0207711_101490512 242
267 3300025945 Ga0207679_10266734 Ga0207679_102667342 242
268 3300025981 Ga0207640_10087561 Ga0207640_100875612 242
269 3300025986 Ga0207658_10140191 Ga0207658_101401912 242
270 3300026023 Ga0207677_10151054 Ga0207677_101510541 242
271 3300026067 Ga0207678_10154674 Ga0207678_101546743 242
272 3300026088 Ga0207641_10115113 Ga0207641_101151132 242
273 3300026089 Ga0207648_10010311 Ga0207648_100103116 242
274 3300026089 Ga0207648_10039013 Ga0207648_100390132 242
275 3300026089 Ga0207648_10311599 Ga0207648_103115992 242
276 3300026095 Ga0207676_10079068 Ga0207676_100790683 242
277 3300026121 Ga0207683_10025450 Ga0207683_100254504 242
278 3300026121 Ga0207683_10195091 Ga0207683_101950913 242
279 3300027866 Ga0209813_10069947 Ga0209813_100699472 242
280 3300028379 Ga0268266_10190097 Ga0268266_101900973 242
281 3300028794 Ga0307515_10001206 Ga0307515_1000120623 242
282 3300031616 Ga0307508_10006698 Ga0307508_100066983 242
283 3300031730 Ga0307516_10006485 Ga0307516_1000648513 242
284 3300041498 Ga0451841_0104201 Ga0451841_0104201_87_917 242
285 3300041512 Ga0451853_1937147 Ga0451853_1937147_117_947 242
286 3300044712 Ga0453684_0086122 Ga0453684_0086122_1513_2250 242
287 3300046519 Ga0495632_0010839 Ga0495632_0010839_1316_2146 242
288 3300046616 Ga0495668_0153315 Ga0495668_0153315_279_1121 242
289 3300047472 Ga0495686_0182833 Ga0495686_0182833_244_1074 242
290 3300050489 nmdc:mga03683_159822_c1 nmdc:mga03683_159822_c1_105_935 242
291 3300053739 Ga0500587_000047 Ga0500587_000047_9010_9840 242
292 3300005328 Ga0070676_10017134 Ga0070676_100171342 243
293 3300005330 Ga0070690_100028629 Ga0070690_1000286292 243
294 3300005333 Ga0070677_10015649 Ga0070677_100156493 243
295 3300005334 Ga0068869_100003488 Ga0068869_1000034886 243
296 3300005334 Ga0068869_100031544 Ga0068869_1000315442 243
297 3300005338 Ga0068868_100003534 Ga0068868_1000035347 243
298 3300005338 Ga0068868_100329171 Ga0068868_1003291711 243
299 3300005344 Ga0070661_100108494 Ga0070661_1001084942 243
300 3300005347 Ga0070668_100043016 Ga0070668_1000430165 243
301 3300005353 Ga0070669_100044294 Ga0070669_1000442943 243
302 3300005353 Ga0070669_100155058 Ga0070669_1001550581 243
303 3300005354 Ga0070675_100010402 Ga0070675_1000104027 243
304 3300005354 Ga0070675_100133968 Ga0070675_1001339682 243
305 3300005356 Ga0070674_100121621 Ga0070674_1001216212 243
306 3300005366 Ga0070659_100011449 Ga0070659_1000114497 243
307 3300005367 Ga0070667_100138756 Ga0070667_1001387562 243
308 3300005441 Ga0070700_100067380 Ga0070700_1000673803 243
309 3300005455 Ga0070663_100107129 Ga0070663_1001071292 243
310 3300005455 Ga0070663_100109227 Ga0070663_1001092272 243
311 3300005456 Ga0070678_100282192 Ga0070678_1002821922 243
312 3300005457 Ga0070662_100005695 Ga0070662_1000056957 243
313 3300005457 Ga0070662_100028238 Ga0070662_1000282382 243
314 3300005457 Ga0070662_100031932 Ga0070662_1000319322 243
315 3300005459 Ga0068867_100011992 Ga0068867_1000119923 243
316 3300005539 Ga0068853_100006811 Ga0068853_1000068117 243
317 3300005544 Ga0070686_100209678 Ga0070686_1002096781 243
318 3300005547 Ga0070693_100044620 Ga0070693_1000446203 243
319 3300005563 Ga0068855_100018761 Ga0068855_1000187617 243
320 3300005564 Ga0070664_100304190 Ga0070664_1003041901 243
321 3300005564 Ga0070664_100472159 Ga0070664_1004721592 243
322 3300005578 Ga0068854_100085075 Ga0068854_1000850752 243
323 3300005578 Ga0068854_100093842 Ga0068854_1000938422 243
324 3300005614 Ga0068856_100074496 Ga0068856_1000744964 243
325 3300005616 Ga0068852_100009092 Ga0068852_1000090925 243
326 3300005616 Ga0068852_100128266 Ga0068852_1001282662 243
327 3300005618 Ga0068864_100009398 Ga0068864_1000093987 243
328 3300005618 Ga0068864_100201517 Ga0068864_1002015171 243
329 3300005718 Ga0068866_10019689 Ga0068866_100196893 243
330 3300005719 Ga0068861_100005459 Ga0068861_1000054597 243
331 3300005719 Ga0068861_100013781 Ga0068861_1000137815 243
332 3300005841 Ga0068863_100018287 Ga0068863_1000182877 243
333 3300005842 Ga0068858_100285693 Ga0068858_1002856932 243
334 3300005842 Ga0068858_100368842 Ga0068858_1003688422 243
335 3300005843 Ga0068860_100039824 Ga0068860_1000398243 243
336 3300005843 Ga0068860_100172465 Ga0068860_1001724652 243
337 3300005844 Ga0068862_100086453 Ga0068862_1000864534 243
338 3300006237 Ga0097621_100033628 Ga0097621_1000336286 243
339 3300006358 Ga0068871_100016972 Ga0068871_1000169727 243
340 3300006881 Ga0068865_100041024 Ga0068865_1000410244 243
341 3300007076 Ga0075435_100170830 Ga0075435_1001708302 243
342 3300009094 Ga0111539_10644569 Ga0111539_106445691 243
343 3300009098 Ga0105245_10112084 Ga0105245_101120843 243
344 3300009148 Ga0105243_10149234 Ga0105243_101492342 243
345 3300009174 Ga0105241_10050051 Ga0105241_100500513 243
346 3300009177 Ga0105248_10011079 Ga0105248_100110796 243
347 3300009545 Ga0105237_10035404 Ga0105237_100354043 243
348 3300009551 Ga0105238_10152230 Ga0105238_101522303 243
349 3300009553 Ga0105249_10074684 Ga0105249_100746843 243
350 3300013296 Ga0157374_10031054 Ga0157374_100310545 243
351 3300013306 Ga0163162_10047853 Ga0163162_100478535 243
352 3300013307 Ga0157372_10163891 Ga0157372_101638913 243
353 3300013308 Ga0157375_10203394 Ga0157375_102033942 243
354 3300014326 Ga0157380_10088041 Ga0157380_100880413 243
355 3300014745 Ga0157377_10001565 Ga0157377_100015658 243
356 3300014968 Ga0157379_10043362 Ga0157379_100433626 243
357 3300014968 Ga0157379_10214716 Ga0157379_102147162 243
358 3300014969 Ga0157376_10003307 Ga0157376_100033078 243
359 3300017792 Ga0163161_10006298 Ga0163161_100062986 243
360 3300025321 Ga0207656_10067121 Ga0207656_100671212 243
361 3300025893 Ga0207682_10033543 Ga0207682_100335432 243
362 3300025899 Ga0207642_10010828 Ga0207642_100108283 243
363 3300025901 Ga0207688_10058459 Ga0207688_100584592 243
364 3300025907 Ga0207645_10049830 Ga0207645_100498302 243
365 3300025911 Ga0207654_10052847 Ga0207654_100528474 243
366 3300025914 Ga0207671_10048096 Ga0207671_100480963 243
367 3300025918 Ga0207662_10006607 Ga0207662_100066077 243
368 3300025923 Ga0207681_10025216 Ga0207681_100252164 243
369 3300025926 Ga0207659_10011834 Ga0207659_100118347 243
370 3300025927 Ga0207687_10065044 Ga0207687_100650442 243
371 3300025927 Ga0207687_10100888 Ga0207687_101008882 243
372 3300025933 Ga0207706_10006211 Ga0207706_100062116 243
373 3300025933 Ga0207706_10019872 Ga0207706_100198723 243
374 3300025935 Ga0207709_10048637 Ga0207709_100486372 243
375 3300025938 Ga0207704_10032069 Ga0207704_100320694 243
376 3300025941 Ga0207711_10004582 Ga0207711_100045828 243
377 3300025942 Ga0207689_10003664 Ga0207689_100036647 243
378 3300025942 Ga0207689_10035048 Ga0207689_100350483 243
379 3300025945 Ga0207679_10093087 Ga0207679_100930872 243
380 3300025972 Ga0207668_10020637 Ga0207668_100206372 243
381 3300025972 Ga0207668_10033710 Ga0207668_100337104 243
382 3300025981 Ga0207640_10049149 Ga0207640_100491492 243
383 3300025981 Ga0207640_10073760 Ga0207640_100737603 243
384 3300025986 Ga0207658_10016179 Ga0207658_100161796 243
385 3300026023 Ga0207677_10028700 Ga0207677_100287004 243
386 3300026035 Ga0207703_10036096 Ga0207703_100360966 243
387 3300026041 Ga0207639_10117864 Ga0207639_101178642 243
388 3300026067 Ga0207678_10040687 Ga0207678_100406874 243
389 3300026067 Ga0207678_10082065 Ga0207678_100820654 243
390 3300026075 Ga0207708_10012477 Ga0207708_100124772 243
391 3300026088 Ga0207641_10009103 Ga0207641_100091034 243
392 3300026088 Ga0207641_10019205 Ga0207641_100192056 243
393 3300026095 Ga0207676_10011582 Ga0207676_100115823 243
394 3300026095 Ga0207676_10254464 Ga0207676_102544642 243
395 3300026118 Ga0207675_100008151 Ga0207675_1000081514 243
396 3300026118 Ga0207675_100023191 Ga0207675_1000231916 243
397 3300026121 Ga0207683_10080603 Ga0207683_100806035 243
398 3300026142 Ga0207698_10016587 Ga0207698_100165874 243
399 3300026142 Ga0207698_10157641 Ga0207698_101576413 243
400 3300027876 Ga0209974_10001641 Ga0209974_100016414 243
401 3300028381 Ga0268264_10020755 Ga0268264_100207552 243
402 3300028381 Ga0268264_10206482 Ga0268264_102064823 243
403 3300028794 Ga0307515_10011495 Ga0307515_1001149510 243
404 3300031456 Ga0307513_10106681 Ga0307513_101066812 243
405 3300031507 Ga0307509_10197563 Ga0307509_101975631 243
406 3300031616 Ga0307508_10000216 Ga0307508_1000021657 243
407 3300031649 Ga0307514_10015854 Ga0307514_100158547 243
408 3300033179 Ga0307507_10058387 Ga0307507_100583874 243
409 3300035090 Ga0373949_0046589 Ga0373949_0046589_186_1043 243
410 3300035691 Ga0373931_0002695 Ga0373931_0002695_2597_3454 243
411 3300041452 Ga0451793_0320329 Ga0451793_0320329_76_903 243
412 3300041452 Ga0451793_0659484 Ga0451793_0659484_110_937 243
413 3300045051 Ga0451576_0212037 Ga0451576_0212037_877_1734 243
414 3300046519 Ga0495632_0035845 Ga0495632_0035845_617_1444 243
415 3300046537 Ga0495598_0048524 Ga0495598_0048524_310_1137 243
416 3300048903 Ga0496100_0004969 Ga0496100_0004969_2414_3271 243
417 3300048907 Ga0496104_0146090 Ga0496104_0146090_1102_1959 243
418 3300048909 Ga0496106_0025160 Ga0496106_0025160_428_1285 243
419 3300048910 Ga0496107_0003649 Ga0496107_0003649_4735_5592 243
420 3300048912 Ga0496109_0185242 Ga0496109_0185242_629_1486 243
421 3300048913 Ga0496110_0034479 Ga0496110_0034479_2937_3794 243
422 3300048914 Ga0496111_0246096 Ga0496111_0246096_86_943 243
423 3300050490 nmdc:mga03n38_164991_c1 nmdc:mga03n38_164991_c1_15_842 243
424 3300050493 nmdc:mga0k408_669_c1 nmdc:mga0k408_669_c1_9010_9837 243
425 3300050496 nmdc:mga07m45_52553_c1 nmdc:mga07m45_52553_c1_427_1245 243
426 3300050496 nmdc:mga07m45_6321_c1 nmdc:mga07m45_6321_c1_2144_2971 243
427 3300053098 Ga0500650_0046776 Ga0500650_0046776_412_1239 243
428 3300053129 Ga0500628_019472 Ga0500628_019472_409_1236 243
429 3300053131 Ga0500652_056670 Ga0500652_056670_102_929 243
430 3300053139 Ga0500568_0028336 Ga0500568_0028336_1093_1920 243
431 3300053156 Ga0500622_0000872 Ga0500622_0000872_1131_1958 243
432 3300003215 JGI25153J46596_10007545 JGI25153J46596_100075456 244
433 3300005331 Ga0070670_100026210 Ga0070670_1000262102 244
434 3300005338 Ga0068868_100060065 Ga0068868_1000600654 244
435 3300005355 Ga0070671_100008407 Ga0070671_1000084076 244
436 3300005355 Ga0070671_100020559 Ga0070671_1000205595 244
437 3300005364 Ga0070673_100321953 Ga0070673_1003219532 244
438 3300005543 Ga0070672_100047279 Ga0070672_1000472794 244
439 3300005548 Ga0070665_100104794 Ga0070665_1001047944 244
440 3300005617 Ga0068859_100101507 Ga0068859_1001015072 244
441 3300005618 Ga0068864_100104355 Ga0068864_1001043554 244
442 3300005841 Ga0068863_100040067 Ga0068863_1000400676 244
443 3300005841 Ga0068863_100154915 Ga0068863_1001549152 244
444 3300005843 Ga0068860_100182469 Ga0068860_1001824692 244
445 3300006163 Ga0070715_10179035 Ga0070715_101790351 244
446 3300006237 Ga0097621_100009144 Ga0097621_1000091445 244
447 3300006358 Ga0068871_100008132 Ga0068871_1000081328 244
448 3300006931 Ga0097620_100101507 Ga0097620_1001015072 244
449 3300009098 Ga0105245_10061239 Ga0105245_100612391 244
450 3300009176 Ga0105242_10129773 Ga0105242_101297733 244
451 3300009177 Ga0105248_10018942 Ga0105248_100189423 244
452 3300009551 Ga0105238_10016299 Ga0105238_100162991 244
453 3300011119 Ga0105246_10061627 Ga0105246_100616273 244
454 3300013296 Ga0157374_10040878 Ga0157374_100408785 244
455 3300013296 Ga0157374_10064219 Ga0157374_100642195 244
456 3300013308 Ga0157375_10005174 Ga0157375_100051748 244
457 3300013308 Ga0157375_10239083 Ga0157375_102390832 244
458 3300014325 Ga0163163_10313596 Ga0163163_103135962 244
459 3300014968 Ga0157379_10020334 Ga0157379_100203347 244
460 3300014968 Ga0157379_10350325 Ga0157379_103503252 244
461 3300025893 Ga0207682_10058226 Ga0207682_100582261 244
462 3300025907 Ga0207645_10082477 Ga0207645_100824772 244
463 3300025931 Ga0207644_10001757 Ga0207644_100017578 244
464 3300025934 Ga0207686_10174035 Ga0207686_101740352 244
465 3300025940 Ga0207691_10061268 Ga0207691_100612684 244
466 3300025940 Ga0207691_10131704 Ga0207691_101317042 244
467 3300025941 Ga0207711_10008794 Ga0207711_100087948 244
468 3300025944 Ga0207661_10203771 Ga0207661_102037712 244
469 3300025960 Ga0207651_10479793 Ga0207651_104797931 244
470 3300025986 Ga0207658_10552786 Ga0207658_105527861 244
471 3300026088 Ga0207641_10021621 Ga0207641_100216215 244
472 3300026088 Ga0207641_10059586 Ga0207641_100595863 244
473 3300026089 Ga0207648_10143164 Ga0207648_101431642 244
474 3300026095 Ga0207676_10033040 Ga0207676_100330401 244
475 3300026095 Ga0207676_10045595 Ga0207676_100455954 244
476 3300026116 Ga0207674_10159975 Ga0207674_101599753 244
477 3300026121 Ga0207683_10156000 Ga0207683_101560002 244
478 3300028380 Ga0268265_10106367 Ga0268265_101063672 244
479 3300028380 Ga0268265_10162748 Ga0268265_101627482 244
480 3300046660 Ga0495625_0004997 Ga0495625_0004997_942_1793 244
481 3300048905 Ga0496102_0002898 Ga0496102_0002898_1594_2505 244
482 3300048915 Ga0496112_0241198 Ga0496112_0241198_210_1067 244
483 3300050494 nmdc:mga06z11_215045_c1 nmdc:mga06z11_215045_c1_25_774 244
484 3300003323 rootH1_10004482 rootH1_100044821 245
485 3300005335 Ga0070666_10217538 Ga0070666_102175381 245
486 3300005335 Ga0070666_10229530 Ga0070666_102295301 245
487 3300005367 Ga0070667_100012357 Ga0070667_1000123576 245
488 3300005455 Ga0070663_100284977 Ga0070663_1002849772 245
489 3300005459 Ga0068867_100064789 Ga0068867_1000647892 245
490 3300005468 Ga0070707_100026153 Ga0070707_1000261535 245
491 3300005539 Ga0068853_100435425 Ga0068853_1004354251 245
492 3300005543 Ga0070672_100025769 Ga0070672_1000257692 245
493 3300005616 Ga0068852_100066202 Ga0068852_1000662022 245
494 3300006195 Ga0075366_10040736 Ga0075366_100407363 245
495 3300006353 Ga0075370_10024268 Ga0075370_100242683 245
496 3300006358 Ga0068871_100318388 Ga0068871_1003183882 245
497 3300006881 Ga0068865_100091208 Ga0068865_1000912082 245
498 3300014326 Ga0157380_10159855 Ga0157380_101598552 245
499 3300014326 Ga0157380_10363464 Ga0157380_103634641 245
500 3300014968 Ga0157379_10010130 Ga0157379_100101308 245
501 3300025297 Ga0209758_1000124 Ga0209758_10001244 245
502 3300025903 Ga0207680_10058549 Ga0207680_100585492 245
503 3300025910 Ga0207684_10003264 Ga0207684_100032642 245
504 3300025925 Ga0207650_10205477 Ga0207650_102054772 245
505 3300025940 Ga0207691_10044552 Ga0207691_100445522 245
506 3300026041 Ga0207639_10489276 Ga0207639_104892761 245
507 3300026142 Ga0207698_10245947 Ga0207698_102459472 245
508 3300028381 Ga0268264_10003375 Ga0268264_100033756 245
509 3300044693 Ga0466961_0187416 Ga0466961_0187416_179_988 245
510 3300048905 Ga0496102_0066858 Ga0496102_0066858_106_1011 245
511 iso_pu_bacteria 2585428057 2587725241 245
512 iso_pu_bacteria 2585428058 2587731403 245
513 3300005616 Ga0068852_100085162 Ga0068852_1000851622 246
514 3300025923 Ga0207681_10470868 Ga0207681_104708682 246
515 3300050493 nmdc:mga0k408_105924_c1 nmdc:mga0k408_105924_c1_245_1096 246
516 3300053108 Ga0500562_024019 Ga0500562_024019_444_1280 246
517 3300031239 Ga0265328_10013306 Ga0265328_100133064 247
518 3300031456 Ga0307513_10098065 Ga0307513_100980654 247
519 3300031995 Ga0307409_100131501 Ga0307409_1001315013 247
520 3300032002 Ga0307416_100061065 Ga0307416_1000610654 247
521 3300050493 nmdc:mga0k408_1245_c1 nmdc:mga0k408_1245_c1_10198_11049 247
522 3300050494 nmdc:mga06z11_2171_c1 nmdc:mga06z11_2171_c1_6199_7050 247
523 3300053086 Ga0500578_0000673 Ga0500578_0000673_9420_10268 247
524 3300006195 Ga0075366_10021753 Ga0075366_100217535 248
525 3300044901 Ga0466960_0184303 Ga0466960_0184303_125_952 248
526 3300005548 Ga0070665_100115538 Ga0070665_1001155383 249
527 3300044658 Ga0466972_0000594 Ga0466972_0000594_11796_12605 249
528 3300044683 Ga0466965_0040218 Ga0466965_0040218_428_1237 249
529 3300044712 Ga0453684_0020128 Ga0453684_0020128_2053_2838 249
530 3300039450 Ga0436363_0457939 Ga0436363_0457939_1376_2242 250
531 3300028379 Ga0268266_10072607 Ga0268266_100726073 251
532 3300041463 Ga0451804_0090619 Ga0451804_0090619_209_1108 251
533 3300041486 Ga0451807_0096601 Ga0451807_0096601_350_1219 251
534 3300050496 nmdc:mga07m45_3113_c1 nmdc:mga07m45_3113_c1_473_1327 251
535 3300031903 Ga0307407_10210016 Ga0307407_102100161 253
536 3300037471 Ga0395905_0285650 Ga0395905_0285650_81_1013 253
537 3300025927 Ga0207687_10329200 Ga0207687_103292002 254
538 3300037471 Ga0395905_0010653 Ga0395905_0010653_7458_8258 255
539 3300044683 Ga0466965_0040007 Ga0466965_0040007_1085_1900 255
540 3300044719 Ga0466971_0064726 Ga0466971_0064726_420_1235 255
541 3300044765 Ga0466970_0046815 Ga0466970_0046815_927_1742 255
542 3300044842 Ga0466957_0047364 Ga0466957_0047364_1672_2487 255
543 3300045976 Ga0466967_0291581 Ga0466967_0291581_165_980 255
544 3300061719 Ga0466962_0006584 Ga0466962_0006584_3369_4184 255
545 3300005331 Ga0070670_100099934 Ga0070670_1000999343 259
546 3300005457 Ga0070662_100001432 Ga0070662_1000014326 259
547 3300025933 Ga0207706_10001906 Ga0207706_1000190612 259
548 3300002155 JGI24033J26618_1014872 JGI24033J26618_10148721 260
549 3300005328 Ga0070676_10034601 Ga0070676_100346013 260
550 3300005331 Ga0070670_100021917 Ga0070670_1000219173 260
551 3300005333 Ga0070677_10054709 Ga0070677_100547091 260
552 3300005334 Ga0068869_100168989 Ga0068869_1001689892 260
553 3300005335 Ga0070666_10114353 Ga0070666_101143532 260
554 3300005338 Ga0068868_100046664 Ga0068868_1000466642 260
555 3300005353 Ga0070669_100050718 Ga0070669_1000507183 260
556 3300005364 Ga0070673_100002371 Ga0070673_1000023718 260
557 3300005456 Ga0070678_100006062 Ga0070678_1000060623 260
558 3300005459 Ga0068867_100005426 Ga0068867_1000054265 260
559 3300005543 Ga0070672_100026382 Ga0070672_1000263824 260
560 3300005544 Ga0070686_100082995 Ga0070686_1000829953 260
561 3300005564 Ga0070664_100343636 Ga0070664_1003436361 260
562 3300005615 Ga0070702_100169659 Ga0070702_1001696591 260
563 3300005616 Ga0068852_100187166 Ga0068852_1001871662 260
564 3300005617 Ga0068859_100357592 Ga0068859_1003575922 260
565 3300005834 Ga0068851_10008150 Ga0068851_100081505 260
566 3300006237 Ga0097621_100044849 Ga0097621_1000448494 260
567 3300006358 Ga0068871_100006200 Ga0068871_1000062009 260
568 3300006931 Ga0097620_100357572 Ga0097620_1003575722 260
569 3300013296 Ga0157374_10260256 Ga0157374_102602562 260
570 3300013306 Ga0163162_10271665 Ga0163162_102716651 260
571 3300014745 Ga0157377_10169007 Ga0157377_101690071 260
572 3300014969 Ga0157376_10077851 Ga0157376_100778513 260
573 3300017792 Ga0163161_10009331 Ga0163161_100093316 260
574 3300025315 Ga0207697_10003064 Ga0207697_100030646 260
575 3300025893 Ga0207682_10002801 Ga0207682_100028013 260
576 3300025901 Ga0207688_10058002 Ga0207688_100580022 260
577 3300025907 Ga0207645_10024932 Ga0207645_100249324 260
578 3300025908 Ga0207643_10084950 Ga0207643_100849503 260
579 3300025923 Ga0207681_10003514 Ga0207681_100035146 260
580 3300025925 Ga0207650_10001276 Ga0207650_100012769 260
581 3300025926 Ga0207659_10014054 Ga0207659_100140544 260
582 3300025931 Ga0207644_10000523 Ga0207644_1000052316 260
583 3300025937 Ga0207669_10016372 Ga0207669_100163725 260
584 3300025940 Ga0207691_10003381 Ga0207691_1000338110 260
585 3300025945 Ga0207679_10234094 Ga0207679_102340941 260
586 3300025960 Ga0207651_10014368 Ga0207651_100143684 260
587 3300025981 Ga0207640_10202395 Ga0207640_102023952 260
588 3300026075 Ga0207708_10233638 Ga0207708_102336382 260
589 3300026089 Ga0207648_10004239 Ga0207648_100042395 260
590 3300026121 Ga0207683_10083536 Ga0207683_100835364 260
591 3300026142 Ga0207698_10136893 Ga0207698_101368931 260
592 3300031824 Ga0307413_10057428 Ga0307413_100574284 260
593 3300031824 Ga0307413_10115720 Ga0307413_101157203 260
594 3300031852 Ga0307410_10138158 Ga0307410_101381583 260
595 3300031901 Ga0307406_10023123 Ga0307406_100231234 260
596 3300031911 Ga0307412_10027498 Ga0307412_100274984 260
597 3300031995 Ga0307409_100304806 Ga0307409_1003048062 260
598 3300032005 Ga0307411_10012282 Ga0307411_100122824 260
599 3300032005 Ga0307411_10016314 Ga0307411_100163143 260
600 3300041458 Ga0451798_0362761 Ga0451798_0362761_275_1102 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04333

MlaA

MlaA lipoprotein

44

239

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8r-assembly1.cif.gz_D cryo-em structure of ompc3-mlaa complex in msp2n2 nanodiscs 0.764 38 228
5nuo-assembly1.cif.gz_D structural basis for maintenance of bacterial outer membrane lipid asymmetry 0.7607 38 232
5nuq-assembly1.cif.gz_H structural basis for maintenance of bacterial outer membrane lipid asymmetry 0.7598 38 232
5nuq-assembly1.cif.gz_H structural basis for maintenance of bacterial outer membrane lipid asymmetry 0.743 38 232
8i8r-assembly1.cif.gz_D cryo-em structure of ompc3-mlaa complex in msp2n2 nanodiscs 0.7413 38 228
ID Description Score Start End Superfamily
af_Q57935_5_362_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.3672 75 146 1.10.645.10
4zl5F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3549 75 232 1.20.1260.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2958 72 204 1.20.1260.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.292 72 204 1.20.1260.10
4zl5F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2811 75 232 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A382TC89-F1-model_v4 VacJ lipoprotein 0.8969 34 216 GO:0016020
GO:0120010
AF-A0A382TC89-F1-model_v4 VacJ lipoprotein 0.8831 34 216 GO:0016020
GO:0120010
AF-A0A537E2Y9-F1-model_v4 VacJ family lipoprotein 0.8782 17 207 GO:0016020
GO:0120010
AF-A0A3B8TRL5-F1-model_v4 deleted 0.8782 52 231
AF-A0A3B8TRL5-F1-model_v4 deleted 0.8643 52 231

Feature Viewer

pLDDT pTM Quality
73.39 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map