F467952
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 600 | 254 | 597 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100001432|Ga0070662_1000014326 |
| Length | 277 |
| Sequence | MKARARFPFQRLLWAFVALLPLVLTTGCATVGGGAPTRQSAGQKLDPWENWNRKVFSFNEGLDEHLLKPVATAYRKVTPSFLRTAISNFFNNAEDAWSAVNHFLQGKGESGMQMLVRFNTNTFFGLGGVLDIATEAGIERQPEDFGQTLGKWGFGAGAYIVWPVLGPSSVRDSLALPLDRTMTSPAPLFEPESVQWEMLGLQLVNTRAGLLDASRVIDDIALDKYTFLRDGYLARRRSLVYDGNPPDTSPRDDAEDLAPAEKSEAAPPAGAASAPAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 191 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 198 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 236 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 237 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 240 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 242 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 243 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 244 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 245 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 246 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 247 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 248 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 249 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 251 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 252 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 253 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 254 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.33 |
| Nodule | 0 |
| Rhizoplane | 2.83 |
| Rhizosphere | 80.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1014872 | 3300002155 | Bacteria | 955 |
| 2 | JGI25152J39213_1000662 | 3300002773 | Bacteria | 17998 |
| 3 | JGI25153J46596_10003371 | 3300003215 | Bacteria | 8968 |
| 4 | JGI25153J46596_10007545 | 3300003215 | Bacteria | 5328 |
| 5 | rootH1_10004482 | 3300003323 | Bacteria | 2128 |
| 6 | Ga0055526_1001626 | 3300003771 | Bacteria | 15770 |
| 7 | Ga0070658_10016712 | 3300005327 | Bacteria | 5873 |
| 8 | Ga0070676_10017134 | 3300005328 | Bacteria | 4008 |
| 9 | Ga0070676_10021221 | 3300005328 | Bacteria | 3635 |
| 10 | Ga0070676_10034601 | 3300005328 | Bacteria | 2901 |
| 11 | Ga0070690_100017758 | 3300005330 | Bacteria | 4286 |
| 12 | Ga0070690_100028629 | 3300005330 | Bacteria | 3451 |
| 13 | Ga0070670_100013611 | 3300005331 | Bacteria | 6971 |
| 14 | Ga0070670_100021917 | 3300005331 | Bacteria | 5496 |
| 15 | Ga0070670_100026210 | 3300005331 | Bacteria | 5018 |
| 16 | Ga0070670_100034305 | 3300005331 | Bacteria | 4367 |
| 17 | Ga0070670_100080193 | 3300005331 | Bacteria | 2805 |
| 18 | Ga0070670_100099934 | 3300005331 | Bacteria | 2497 |
| 19 | Ga0070677_10005615 | 3300005333 | Bacteria | 4139 |
| 20 | Ga0070677_10015649 | 3300005333 | Bacteria | 2688 |
| 21 | Ga0070677_10052567 | 3300005333 | Bacteria | 1653 |
| 22 | Ga0070677_10054709 | 3300005333 | Bacteria | 1626 |
| 23 | Ga0070677_10063098 | 3300005333 | Bacteria | 1535 |
| 24 | Ga0068869_100003488 | 3300005334 | Bacteria | 9627 |
| 25 | Ga0068869_100031544 | 3300005334 | Bacteria | 3728 |
| 26 | Ga0068869_100168989 | 3300005334 | Bacteria | 1707 |
| 27 | Ga0070666_10004086 | 3300005335 | Bacteria | 8865 |
| 28 | Ga0070666_10114353 | 3300005335 | Bacteria | 1868 |
| 29 | Ga0070666_10217538 | 3300005335 | Bacteria | 1347 |
| 30 | Ga0070666_10229530 | 3300005335 | Bacteria | 1311 |
| 31 | Ga0068868_100001343 | 3300005338 | Bacteria | 16950 |
| 32 | Ga0068868_100003534 | 3300005338 | Bacteria | 10890 |
| 33 | Ga0068868_100046664 | 3300005338 | Bacteria | 3391 |
| 34 | Ga0068868_100060065 | 3300005338 | Bacteria | 3008 |
| 35 | Ga0068868_100069894 | 3300005338 | Bacteria | 2799 |
| 36 | Ga0068868_100329171 | 3300005338 | Bacteria | 1303 |
| 37 | Ga0070660_100083259 | 3300005339 | Bacteria | 2513 |
| 38 | Ga0070689_100156502 | 3300005340 | Bacteria | 1840 |
| 39 | Ga0070661_100108494 | 3300005344 | Bacteria | 2071 |
| 40 | Ga0070661_100181398 | 3300005344 | Bacteria | 1602 |
| 41 | Ga0070661_100225204 | 3300005344 | Bacteria | 1439 |
| 42 | Ga0070668_100043016 | 3300005347 | Bacteria | 3463 |
| 43 | Ga0070668_100277076 | 3300005347 | Bacteria | 1400 |
| 44 | Ga0070669_100044294 | 3300005353 | Bacteria | 3242 |
| 45 | Ga0070669_100050718 | 3300005353 | Bacteria | 3031 |
| 46 | Ga0070669_100155058 | 3300005353 | Bacteria | 1775 |
| 47 | Ga0070669_100173734 | 3300005353 | Bacteria | 1681 |
| 48 | Ga0070675_100003418 | 3300005354 | Bacteria | 12023 |
| 49 | Ga0070675_100010402 | 3300005354 | Bacteria | 7268 |
| 50 | Ga0070675_100133968 | 3300005354 | Bacteria | 2113 |
| 51 | Ga0070675_100137894 | 3300005354 | Bacteria | 2083 |
| 52 | Ga0070675_100343512 | 3300005354 | Bacteria | 1322 |
| 53 | Ga0070671_100008407 | 3300005355 | Bacteria | 8273 |
| 54 | Ga0070671_100020559 | 3300005355 | Bacteria | 5385 |
| 55 | Ga0070671_100135962 | 3300005355 | Bacteria | 2072 |
| 56 | Ga0070671_100169440 | 3300005355 | Bacteria | 1847 |
| 57 | Ga0070671_100232935 | 3300005355 | Bacteria | 1563 |
| 58 | Ga0070674_100121621 | 3300005356 | Bacteria | 1933 |
| 59 | Ga0070673_100002371 | 3300005364 | Bacteria | 11464 |
| 60 | Ga0070673_100120925 | 3300005364 | Bacteria | 2184 |
| 61 | Ga0070673_100295974 | 3300005364 | Bacteria | 1423 |
| 62 | Ga0070673_100321953 | 3300005364 | Bacteria | 1366 |
| 63 | Ga0070688_100019843 | 3300005365 | Bacteria | 3899 |
| 64 | Ga0070659_100011449 | 3300005366 | Bacteria | 6562 |
| 65 | Ga0070659_100122710 | 3300005366 | Bacteria | 2106 |
| 66 | Ga0070667_100012357 | 3300005367 | Bacteria | 7062 |
| 67 | Ga0070667_100030336 | 3300005367 | Bacteria | 4510 |
| 68 | Ga0070667_100138756 | 3300005367 | Bacteria | 2127 |
| 69 | Ga0070700_100067380 | 3300005441 | Bacteria | 2274 |
| 70 | Ga0070708_100338018 | 3300005445 | Bacteria | 1419 |
| 71 | Ga0070663_100107129 | 3300005455 | Bacteria | 2095 |
| 72 | Ga0070663_100109227 | 3300005455 | Bacteria | 2076 |
| 73 | Ga0070663_100284977 | 3300005455 | Bacteria | 1318 |
| 74 | Ga0070678_100006062 | 3300005456 | Bacteria | 7052 |
| 75 | Ga0070678_100033281 | 3300005456 | Bacteria | 3577 |
| 76 | Ga0070678_100081202 | 3300005456 | Bacteria | 2457 |
| 77 | Ga0070678_100163811 | 3300005456 | Bacteria | 1804 |
| 78 | Ga0070678_100282192 | 3300005456 | Bacteria | 1405 |
| 79 | Ga0070662_100001432 | 3300005457 | Bacteria | 14712 |
| 80 | Ga0070662_100005695 | 3300005457 | Bacteria | 7972 |
| 81 | Ga0070662_100028238 | 3300005457 | Bacteria | 3902 |
| 82 | Ga0070662_100031932 | 3300005457 | Bacteria | 3699 |
| 83 | Ga0070681_10017630 | 3300005458 | Bacteria | 7135 |
| 84 | Ga0068867_100005426 | 3300005459 | Bacteria | 9022 |
| 85 | Ga0068867_100011992 | 3300005459 | Bacteria | 6123 |
| 86 | Ga0068867_100014496 | 3300005459 | Bacteria | 5586 |
| 87 | Ga0068867_100017829 | 3300005459 | Bacteria | 5042 |
| 88 | Ga0068867_100030867 | 3300005459 | Bacteria | 3867 |
| 89 | Ga0068867_100064789 | 3300005459 | Bacteria | 2717 |
| 90 | Ga0068867_100071487 | 3300005459 | Bacteria | 2595 |
| 91 | Ga0070707_100026153 | 3300005468 | Bacteria | 5539 |
| 92 | Ga0070679_100000726 | 3300005530 | Bacteria | 28453 |
| 93 | Ga0070684_100005261 | 3300005535 | Bacteria | 9903 |
| 94 | Ga0070684_100451596 | 3300005535 | Bacteria | 1188 |
| 95 | Ga0068853_100006811 | 3300005539 | Bacteria | 9111 |
| 96 | Ga0068853_100435425 | 3300005539 | Bacteria | 1232 |
| 97 | Ga0070672_100025769 | 3300005543 | Bacteria | 4368 |
| 98 | Ga0070672_100026382 | 3300005543 | Bacteria | 4322 |
| 99 | Ga0070672_100047279 | 3300005543 | Bacteria | 3338 |
| 100 | Ga0070672_100086298 | 3300005543 | Bacteria | 2524 |
| 101 | Ga0070686_100082995 | 3300005544 | Bacteria | 2126 |
| 102 | Ga0070686_100209678 | 3300005544 | Bacteria | 1402 |
| 103 | Ga0070686_100364279 | 3300005544 | Bacteria | 1090 |
| 104 | Ga0070693_100041764 | 3300005547 | Bacteria | 2582 |
| 105 | Ga0070693_100044620 | 3300005547 | Bacteria | 2508 |
| 106 | Ga0070665_100007443 | 3300005548 | Bacteria | 11136 |
| 107 | Ga0070665_100104794 | 3300005548 | Bacteria | 2830 |
| 108 | Ga0070665_100115538 | 3300005548 | Bacteria | 2687 |
| 109 | Ga0068855_100018761 | 3300005563 | Bacteria | 8316 |
| 110 | Ga0070664_100015313 | 3300005564 | Bacteria | 6270 |
| 111 | Ga0070664_100224211 | 3300005564 | Bacteria | 1682 |
| 112 | Ga0070664_100304190 | 3300005564 | Bacteria | 1441 |
| 113 | Ga0070664_100343636 | 3300005564 | Bacteria | 1356 |
| 114 | Ga0070664_100472159 | 3300005564 | Bacteria | 1154 |
| 115 | Ga0068857_100010507 | 3300005577 | Bacteria | 8046 |
| 116 | Ga0068854_100013710 | 3300005578 | Bacteria | 5326 |
| 117 | Ga0068854_100085075 | 3300005578 | Bacteria | 2341 |
| 118 | Ga0068854_100093842 | 3300005578 | Bacteria | 2237 |
| 119 | Ga0068856_100013192 | 3300005614 | Bacteria | 8003 |
| 120 | Ga0068856_100074496 | 3300005614 | Bacteria | 3361 |
| 121 | Ga0070702_100169659 | 3300005615 | Bacteria | 1418 |
| 122 | Ga0068852_100009092 | 3300005616 | Bacteria | 7356 |
| 123 | Ga0068852_100013380 | 3300005616 | Bacteria | 6280 |
| 124 | Ga0068852_100066202 | 3300005616 | Bacteria | 3155 |
| 125 | Ga0068852_100085162 | 3300005616 | Bacteria | 2815 |
| 126 | Ga0068852_100114694 | 3300005616 | Bacteria | 2455 |
| 127 | Ga0068852_100128266 | 3300005616 | Bacteria | 2332 |
| 128 | Ga0068852_100185077 | 3300005616 | Bacteria | 1961 |
| 129 | Ga0068852_100187166 | 3300005616 | Bacteria | 1951 |
| 130 | Ga0068859_100001451 | 3300005617 | Bacteria | 24059 |
| 131 | Ga0068859_100101507 | 3300005617 | Bacteria | 2934 |
| 132 | Ga0068859_100357592 | 3300005617 | Bacteria | 1555 |
| 133 | Ga0068864_100002901 | 3300005618 | Bacteria | 14175 |
| 134 | Ga0068864_100009398 | 3300005618 | Bacteria | 8066 |
| 135 | Ga0068864_100104355 | 3300005618 | Bacteria | 2518 |
| 136 | Ga0068864_100201517 | 3300005618 | Bacteria | 1828 |
| 137 | Ga0068864_100233074 | 3300005618 | Bacteria | 1703 |
| 138 | Ga0068866_10019689 | 3300005718 | Bacteria | 3078 |
| 139 | Ga0068866_10087404 | 3300005718 | Bacteria | 1689 |
| 140 | Ga0068866_10130962 | 3300005718 | Bacteria | 1427 |
| 141 | Ga0068861_100005459 | 3300005719 | Bacteria | 8611 |
| 142 | Ga0068861_100013781 | 3300005719 | Bacteria | 5662 |
| 143 | Ga0068861_100145774 | 3300005719 | Bacteria | 1937 |
| 144 | Ga0068861_100329349 | 3300005719 | Bacteria | 1332 |
| 145 | Ga0068851_10008150 | 3300005834 | Bacteria | 4838 |
| 146 | Ga0068851_10207598 | 3300005834 | Bacteria | 1096 |
| 147 | Ga0068863_100010181 | 3300005841 | Bacteria | 9144 |
| 148 | Ga0068863_100018287 | 3300005841 | Bacteria | 6711 |
| 149 | Ga0068863_100040067 | 3300005841 | Bacteria | 4455 |
| 150 | Ga0068863_100154915 | 3300005841 | Bacteria | 2193 |
| 151 | Ga0068863_100831740 | 3300005841 | Bacteria | 922 |
| 152 | Ga0068858_100010630 | 3300005842 | Bacteria | 8712 |
| 153 | Ga0068858_100285693 | 3300005842 | Bacteria | 1571 |
| 154 | Ga0068858_100368842 | 3300005842 | Bacteria | 1377 |
| 155 | Ga0068860_100039824 | 3300005843 | Bacteria | 4494 |
| 156 | Ga0068860_100172465 | 3300005843 | Bacteria | 2090 |
| 157 | Ga0068860_100182469 | 3300005843 | Bacteria | 2029 |
| 158 | Ga0068862_100042040 | 3300005844 | Bacteria | 3891 |
| 159 | Ga0068862_100086453 | 3300005844 | Bacteria | 2726 |
| 160 | Ga0075368_10000682 | 3300006042 | Bacteria | 10310 |
| 161 | Ga0075368_10018606 | 3300006042 | Bacteria | 2611 |
| 162 | Ga0075363_100024753 | 3300006048 | Bacteria | 3054 |
| 163 | Ga0075363_100061252 | 3300006048 | Bacteria | 2028 |
| 164 | Ga0075363_100224254 | 3300006048 | Bacteria | 1078 |
| 165 | Ga0075364_10124329 | 3300006051 | Bacteria | 1728 |
| 166 | Ga0070715_10179035 | 3300006163 | Bacteria | 1062 |
| 167 | Ga0075362_10016796 | 3300006177 | Bacteria | 3004 |
| 168 | Ga0075362_10042877 | 3300006177 | Bacteria | 2002 |
| 169 | Ga0075367_10032551 | 3300006178 | Bacteria | 3001 |
| 170 | Ga0075367_10048227 | 3300006178 | Bacteria | 2508 |
| 171 | Ga0075367_10049792 | 3300006178 | Bacteria | 2471 |
| 172 | Ga0075369_10018641 | 3300006186 | Bacteria | 2827 |
| 173 | Ga0075369_10020713 | 3300006186 | Bacteria | 2695 |
| 174 | Ga0075369_10028340 | 3300006186 | Bacteria | 2347 |
| 175 | Ga0075366_10001768 | 3300006195 | Bacteria | 10899 |
| 176 | Ga0075366_10005954 | 3300006195 | Bacteria | 6637 |
| 177 | Ga0075366_10021753 | 3300006195 | Bacteria | 3729 |
| 178 | Ga0075366_10040736 | 3300006195 | Bacteria | 2748 |
| 179 | Ga0075366_10095314 | 3300006195 | Bacteria | 1784 |
| 180 | Ga0075366_10137621 | 3300006195 | Unclassified | 1475 |
| 181 | Ga0075366_10221944 | 3300006195 | Bacteria | 1151 |
| 182 | Ga0097621_100009144 | 3300006237 | Bacteria | 7182 |
| 183 | Ga0097621_100009422 | 3300006237 | Bacteria | 7086 |
| 184 | Ga0097621_100033628 | 3300006237 | Bacteria | 4084 |
| 185 | Ga0097621_100044849 | 3300006237 | Bacteria | 3569 |
| 186 | Ga0097621_100151519 | 3300006237 | Bacteria | 1989 |
| 187 | Ga0075370_10001151 | 3300006353 | Bacteria | 11109 |
| 188 | Ga0075370_10012585 | 3300006353 | Bacteria | 4477 |
| 189 | Ga0075370_10024268 | 3300006353 | Bacteria | 3348 |
| 190 | Ga0068871_100006200 | 3300006358 | Bacteria | 8431 |
| 191 | Ga0068871_100008132 | 3300006358 | Bacteria | 7530 |
| 192 | Ga0068871_100016972 | 3300006358 | Bacteria | 5497 |
| 193 | Ga0068871_100076558 | 3300006358 | Bacteria | 2763 |
| 194 | Ga0068871_100082655 | 3300006358 | Bacteria | 2663 |
| 195 | Ga0068871_100318388 | 3300006358 | Bacteria | 1369 |
| 196 | Ga0068865_100041024 | 3300006881 | Bacteria | 3148 |
| 197 | Ga0068865_100091208 | 3300006881 | Bacteria | 2211 |
| 198 | Ga0097620_100001451 | 3300006931 | Bacteria | 24059 |
| 199 | Ga0097620_100101507 | 3300006931 | Bacteria | 2934 |
| 200 | Ga0097620_100357572 | 3300006931 | Bacteria | 1555 |
| 201 | Ga0075435_100170830 | 3300007076 | Bacteria | 1834 |
| 202 | Ga0111539_10644569 | 3300009094 | Bacteria | 1233 |
| 203 | Ga0105245_10061239 | 3300009098 | Bacteria | 3392 |
| 204 | Ga0105245_10112084 | 3300009098 | Bacteria | 2538 |
| 205 | Ga0114129_10080001 | 3300009147 | Bacteria | 4544 |
| 206 | Ga0105243_10042764 | 3300009148 | Bacteria | 3548 |
| 207 | Ga0105243_10149234 | 3300009148 | Bacteria | 2004 |
| 208 | Ga0105241_10050051 | 3300009174 | Bacteria | 3184 |
| 209 | Ga0105242_10129773 | 3300009176 | Bacteria | 2174 |
| 210 | Ga0105248_10008335 | 3300009177 | Bacteria | 11388 |
| 211 | Ga0105248_10011079 | 3300009177 | Bacteria | 9946 |
| 212 | Ga0105248_10018942 | 3300009177 | Bacteria | 7611 |
| 213 | Ga0105248_10232105 | 3300009177 | Bacteria | 2077 |
| 214 | Ga0105237_10004861 | 3300009545 | Bacteria | 15417 |
| 215 | Ga0105237_10035404 | 3300009545 | Bacteria | 5052 |
| 216 | Ga0105238_10016299 | 3300009551 | Bacteria | 7521 |
| 217 | Ga0105238_10152230 | 3300009551 | Bacteria | 2288 |
| 218 | Ga0105249_10074684 | 3300009553 | Bacteria | 3139 |
| 219 | Ga0105239_10030119 | 3300010375 | Bacteria | 5967 |
| 220 | Ga0105246_10061627 | 3300011119 | Bacteria | 2611 |
| 221 | Ga0157370_10162346 | 3300013104 | Bacteria | 2079 |
| 222 | Ga0157370_10530964 | 3300013104 | Bacteria | 1079 |
| 223 | Ga0157369_10058720 | 3300013105 | Bacteria | 4149 |
| 224 | Ga0157374_10031054 | 3300013296 | Bacteria | 4851 |
| 225 | Ga0157374_10040878 | 3300013296 | Bacteria | 4271 |
| 226 | Ga0157374_10052887 | 3300013296 | Bacteria | 3784 |
| 227 | Ga0157374_10064219 | 3300013296 | Bacteria | 3444 |
| 228 | Ga0157374_10260256 | 3300013296 | Bacteria | 1709 |
| 229 | Ga0157378_10192154 | 3300013297 | Bacteria | 1926 |
| 230 | Ga0157378_10716694 | 3300013297 | Bacteria | 1021 |
| 231 | Ga0163162_10047853 | 3300013306 | Bacteria | 4284 |
| 232 | Ga0163162_10178661 | 3300013306 | Bacteria | 2248 |
| 233 | Ga0163162_10206812 | 3300013306 | Bacteria | 2092 |
| 234 | Ga0163162_10271665 | 3300013306 | Bacteria | 1827 |
| 235 | Ga0157372_10013740 | 3300013307 | Bacteria | 8651 |
| 236 | Ga0157372_10163891 | 3300013307 | Bacteria | 2570 |
| 237 | Ga0157372_10368357 | 3300013307 | Bacteria | 1674 |
| 238 | Ga0157375_10005174 | 3300013308 | Bacteria | 11316 |
| 239 | Ga0157375_10014262 | 3300013308 | Bacteria | 7084 |
| 240 | Ga0157375_10027908 | 3300013308 | Bacteria | 5281 |
| 241 | Ga0157375_10043978 | 3300013308 | Bacteria | 4334 |
| 242 | Ga0157375_10203394 | 3300013308 | Bacteria | 2136 |
| 243 | Ga0157375_10239083 | 3300013308 | Bacteria | 1976 |
| 244 | Ga0157375_10417487 | 3300013308 | Bacteria | 1508 |
| 245 | Ga0163163_10003570 | 3300014325 | Bacteria | 13205 |
| 246 | Ga0163163_10115810 | 3300014325 | Bacteria | 2711 |
| 247 | Ga0163163_10170197 | 3300014325 | Bacteria | 2225 |
| 248 | Ga0163163_10313596 | 3300014325 | Bacteria | 1622 |
| 249 | Ga0157380_10088041 | 3300014326 | Bacteria | 2554 |
| 250 | Ga0157380_10159855 | 3300014326 | Bacteria | 1957 |
| 251 | Ga0157380_10215411 | 3300014326 | Bacteria | 1715 |
| 252 | Ga0157380_10363464 | 3300014326 | Bacteria | 1359 |
| 253 | Ga0157377_10001565 | 3300014745 | Bacteria | 9949 |
| 254 | Ga0157377_10169007 | 3300014745 | Bacteria | 1366 |
| 255 | Ga0157379_10010130 | 3300014968 | Bacteria | 8218 |
| 256 | Ga0157379_10020334 | 3300014968 | Bacteria | 5869 |
| 257 | Ga0157379_10043362 | 3300014968 | Bacteria | 4017 |
| 258 | Ga0157379_10214716 | 3300014968 | Bacteria | 1742 |
| 259 | Ga0157379_10229954 | 3300014968 | Bacteria | 1681 |
| 260 | Ga0157379_10350325 | 3300014968 | Bacteria | 1352 |
| 261 | Ga0157379_10424267 | 3300014968 | Bacteria | 1225 |
| 262 | Ga0157376_10003307 | 3300014969 | Bacteria | 11099 |
| 263 | Ga0157376_10077851 | 3300014969 | Bacteria | 2837 |
| 264 | Ga0157376_10154832 | 3300014969 | Bacteria | 2071 |
| 265 | Ga0157376_10239807 | 3300014969 | Bacteria | 1689 |
| 266 | Ga0157376_10248362 | 3300014969 | Bacteria | 1661 |
| 267 | Ga0163161_10006298 | 3300017792 | Bacteria | 8215 |
| 268 | Ga0163161_10009331 | 3300017792 | Bacteria | 6789 |
| 269 | Ga0163161_10430928 | 3300017792 | Bacteria | 1063 |
| 270 | Ga0207425_1000802 | 3300025245 | Bacteria | 15938 |
| 271 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 272 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 273 | Ga0209758_1000124 | 3300025297 | Bacteria | 189933 |
| 274 | Ga0209758_1000234 | 3300025297 | Bacteria | 116217 |
| 275 | Ga0207697_10003064 | 3300025315 | Bacteria | 8383 |
| 276 | Ga0207697_10015695 | 3300025315 | Bacteria | 3126 |
| 277 | Ga0207656_10067121 | 3300025321 | Bacteria | 1587 |
| 278 | Ga0207682_10002801 | 3300025893 | Bacteria | 7710 |
| 279 | Ga0207682_10005911 | 3300025893 | Bacteria | 4951 |
| 280 | Ga0207682_10011716 | 3300025893 | Bacteria | 3427 |
| 281 | Ga0207682_10033543 | 3300025893 | Bacteria | 2067 |
| 282 | Ga0207682_10058226 | 3300025893 | Bacteria | 1612 |
| 283 | Ga0207682_10092786 | 3300025893 | Bacteria | 1311 |
| 284 | Ga0207642_10010828 | 3300025899 | Bacteria | 3231 |
| 285 | Ga0207688_10058002 | 3300025901 | Bacteria | 2178 |
| 286 | Ga0207688_10058459 | 3300025901 | Bacteria | 2169 |
| 287 | Ga0207688_10227898 | 3300025901 | Bacteria | 1124 |
| 288 | Ga0207680_10010662 | 3300025903 | Bacteria | 4608 |
| 289 | Ga0207680_10058549 | 3300025903 | Bacteria | 2336 |
| 290 | Ga0207645_10023445 | 3300025907 | Bacteria | 4012 |
| 291 | Ga0207645_10024932 | 3300025907 | Bacteria | 3874 |
| 292 | Ga0207645_10027684 | 3300025907 | Bacteria | 3659 |
| 293 | Ga0207645_10049830 | 3300025907 | Bacteria | 2674 |
| 294 | Ga0207645_10082477 | 3300025907 | Bacteria | 2061 |
| 295 | Ga0207645_10204488 | 3300025907 | Bacteria | 1299 |
| 296 | Ga0207645_10206752 | 3300025907 | Bacteria | 1292 |
| 297 | Ga0207643_10084950 | 3300025908 | Bacteria | 1838 |
| 298 | Ga0207643_10197607 | 3300025908 | Bacteria | 1223 |
| 299 | Ga0207705_10033024 | 3300025909 | Bacteria | 3698 |
| 300 | Ga0207684_10003264 | 3300025910 | Bacteria | 15912 |
| 301 | Ga0207654_10052847 | 3300025911 | Bacteria | 2343 |
| 302 | Ga0207707_10092626 | 3300025912 | Bacteria | 2641 |
| 303 | Ga0207671_10023595 | 3300025914 | Bacteria | 4638 |
| 304 | Ga0207671_10048096 | 3300025914 | Bacteria | 3156 |
| 305 | Ga0207660_10056055 | 3300025917 | Bacteria | 2819 |
| 306 | Ga0207662_10006607 | 3300025918 | Bacteria | 6264 |
| 307 | Ga0207649_10041035 | 3300025920 | Bacteria | 2816 |
| 308 | Ga0207649_10063732 | 3300025920 | Bacteria | 2328 |
| 309 | Ga0207652_10009072 | 3300025921 | Bacteria | 8011 |
| 310 | Ga0207681_10003514 | 3300025923 | Bacteria | 9755 |
| 311 | Ga0207681_10025216 | 3300025923 | Bacteria | 3822 |
| 312 | Ga0207681_10037524 | 3300025923 | Bacteria | 3203 |
| 313 | Ga0207681_10470868 | 3300025923 | Bacteria | 1025 |
| 314 | Ga0207650_10001276 | 3300025925 | Bacteria | 18258 |
| 315 | Ga0207650_10007499 | 3300025925 | Bacteria | 7439 |
| 316 | Ga0207650_10023626 | 3300025925 | Bacteria | 4362 |
| 317 | Ga0207650_10127027 | 3300025925 | Bacteria | 1991 |
| 318 | Ga0207650_10205477 | 3300025925 | Bacteria | 1579 |
| 319 | Ga0207659_10002886 | 3300025926 | Bacteria | 10227 |
| 320 | Ga0207659_10011834 | 3300025926 | Bacteria | 5526 |
| 321 | Ga0207659_10014054 | 3300025926 | Bacteria | 5153 |
| 322 | Ga0207659_10057723 | 3300025926 | Bacteria | 2785 |
| 323 | Ga0207687_10065044 | 3300025927 | Bacteria | 2589 |
| 324 | Ga0207687_10100888 | 3300025927 | Bacteria | 2124 |
| 325 | Ga0207687_10329200 | 3300025927 | Bacteria | 1239 |
| 326 | Ga0207644_10000523 | 3300025931 | Bacteria | 24867 |
| 327 | Ga0207644_10001757 | 3300025931 | Bacteria | 14039 |
| 328 | Ga0207644_10024131 | 3300025931 | Bacteria | 4172 |
| 329 | Ga0207644_10026585 | 3300025931 | Bacteria | 3989 |
| 330 | Ga0207644_10057199 | 3300025931 | Bacteria | 2815 |
| 331 | Ga0207690_10101872 | 3300025932 | Bacteria | 2052 |
| 332 | Ga0207706_10001906 | 3300025933 | Bacteria | 20489 |
| 333 | Ga0207706_10006211 | 3300025933 | Bacteria | 11101 |
| 334 | Ga0207706_10019872 | 3300025933 | Bacteria | 6038 |
| 335 | Ga0207706_10024686 | 3300025933 | Bacteria | 5387 |
| 336 | Ga0207706_10043492 | 3300025933 | Bacteria | 3980 |
| 337 | Ga0207706_10125634 | 3300025933 | Bacteria | 2256 |
| 338 | Ga0207686_10174035 | 3300025934 | Bacteria | 1521 |
| 339 | Ga0207709_10048637 | 3300025935 | Bacteria | 2585 |
| 340 | Ga0207670_10183929 | 3300025936 | Bacteria | 1576 |
| 341 | Ga0207669_10016372 | 3300025937 | Bacteria | 3765 |
| 342 | Ga0207669_10342931 | 3300025937 | Bacteria | 1151 |
| 343 | Ga0207704_10032069 | 3300025938 | Bacteria | 2968 |
| 344 | Ga0207704_10070145 | 3300025938 | Bacteria | 2218 |
| 345 | Ga0207691_10003381 | 3300025940 | Bacteria | 15525 |
| 346 | Ga0207691_10044552 | 3300025940 | Bacteria | 4083 |
| 347 | Ga0207691_10061268 | 3300025940 | Bacteria | 3418 |
| 348 | Ga0207691_10101973 | 3300025940 | Bacteria | 2560 |
| 349 | Ga0207691_10109769 | 3300025940 | Bacteria | 2454 |
| 350 | Ga0207691_10131704 | 3300025940 | Bacteria | 2208 |
| 351 | Ga0207691_10149842 | 3300025940 | Bacteria | 2051 |
| 352 | Ga0207711_10004582 | 3300025941 | Bacteria | 11755 |
| 353 | Ga0207711_10008794 | 3300025941 | Bacteria | 8444 |
| 354 | Ga0207711_10028615 | 3300025941 | Bacteria | 4692 |
| 355 | Ga0207711_10048247 | 3300025941 | Bacteria | 3643 |
| 356 | Ga0207711_10149051 | 3300025941 | Bacteria | 2110 |
| 357 | Ga0207689_10003664 | 3300025942 | Bacteria | 14006 |
| 358 | Ga0207689_10035048 | 3300025942 | Bacteria | 4169 |
| 359 | Ga0207689_10063010 | 3300025942 | Bacteria | 3049 |
| 360 | Ga0207661_10037727 | 3300025944 | Bacteria | 3782 |
| 361 | Ga0207661_10203771 | 3300025944 | Bacteria | 1740 |
| 362 | Ga0207679_10008387 | 3300025945 | Bacteria | 6580 |
| 363 | Ga0207679_10030713 | 3300025945 | Bacteria | 3754 |
| 364 | Ga0207679_10093087 | 3300025945 | Bacteria | 2336 |
| 365 | Ga0207679_10234094 | 3300025945 | Bacteria | 1553 |
| 366 | Ga0207679_10266734 | 3300025945 | Bacteria | 1463 |
| 367 | Ga0207679_10337306 | 3300025945 | Bacteria | 1310 |
| 368 | Ga0207651_10001062 | 3300025960 | Bacteria | 12183 |
| 369 | Ga0207651_10014368 | 3300025960 | Bacteria | 4568 |
| 370 | Ga0207651_10375358 | 3300025960 | Bacteria | 1204 |
| 371 | Ga0207651_10410093 | 3300025960 | Bacteria | 1154 |
| 372 | Ga0207651_10479793 | 3300025960 | Bacteria | 1071 |
| 373 | Ga0207712_10048342 | 3300025961 | Bacteria | 2959 |
| 374 | Ga0207712_10097655 | 3300025961 | Bacteria | 2177 |
| 375 | Ga0207668_10020637 | 3300025972 | Bacteria | 4190 |
| 376 | Ga0207668_10033710 | 3300025972 | Bacteria | 3394 |
| 377 | Ga0207668_10178318 | 3300025972 | Bacteria | 1673 |
| 378 | Ga0207640_10049149 | 3300025981 | Bacteria | 2729 |
| 379 | Ga0207640_10073760 | 3300025981 | Bacteria | 2307 |
| 380 | Ga0207640_10087561 | 3300025981 | Bacteria | 2147 |
| 381 | Ga0207640_10202395 | 3300025981 | Bacteria | 1506 |
| 382 | Ga0207658_10016179 | 3300025986 | Bacteria | 5125 |
| 383 | Ga0207658_10140191 | 3300025986 | Bacteria | 1955 |
| 384 | Ga0207658_10202601 | 3300025986 | Bacteria | 1658 |
| 385 | Ga0207658_10210366 | 3300025986 | Bacteria | 1629 |
| 386 | Ga0207658_10403049 | 3300025986 | Bacteria | 1203 |
| 387 | Ga0207658_10552786 | 3300025986 | Bacteria | 1030 |
| 388 | Ga0207677_10002493 | 3300026023 | Bacteria | 9661 |
| 389 | Ga0207677_10028700 | 3300026023 | Bacteria | 3524 |
| 390 | Ga0207677_10134704 | 3300026023 | Bacteria | 1881 |
| 391 | Ga0207677_10151054 | 3300026023 | Bacteria | 1792 |
| 392 | Ga0207703_10005450 | 3300026035 | Bacteria | 10235 |
| 393 | Ga0207703_10036096 | 3300026035 | Bacteria | 3932 |
| 394 | Ga0207639_10117864 | 3300026041 | Bacteria | 2176 |
| 395 | Ga0207639_10489276 | 3300026041 | Bacteria | 1122 |
| 396 | Ga0207678_10040687 | 3300026067 | Bacteria | 4030 |
| 397 | Ga0207678_10082065 | 3300026067 | Bacteria | 2759 |
| 398 | Ga0207678_10112336 | 3300026067 | Bacteria | 2324 |
| 399 | Ga0207678_10154674 | 3300026067 | Bacteria | 1958 |
| 400 | Ga0207708_10012477 | 3300026075 | Bacteria | 6333 |
| 401 | Ga0207708_10233638 | 3300026075 | Bacteria | 1477 |
| 402 | Ga0207708_10460076 | 3300026075 | Bacteria | 1061 |
| 403 | Ga0207702_10099445 | 3300026078 | Bacteria | 2564 |
| 404 | Ga0207641_10002150 | 3300026088 | Bacteria | 18573 |
| 405 | Ga0207641_10009103 | 3300026088 | Bacteria | 8202 |
| 406 | Ga0207641_10019205 | 3300026088 | Bacteria | 5608 |
| 407 | Ga0207641_10021621 | 3300026088 | Bacteria | 5285 |
| 408 | Ga0207641_10059586 | 3300026088 | Bacteria | 3251 |
| 409 | Ga0207641_10115113 | 3300026088 | Bacteria | 2390 |
| 410 | Ga0207648_10004239 | 3300026089 | Bacteria | 14817 |
| 411 | Ga0207648_10010311 | 3300026089 | Bacteria | 8871 |
| 412 | Ga0207648_10021145 | 3300026089 | Bacteria | 5850 |
| 413 | Ga0207648_10039013 | 3300026089 | Bacteria | 4178 |
| 414 | Ga0207648_10094008 | 3300026089 | Bacteria | 2621 |
| 415 | Ga0207648_10143164 | 3300026089 | Bacteria | 2108 |
| 416 | Ga0207648_10311599 | 3300026089 | Bacteria | 1413 |
| 417 | Ga0207648_10358799 | 3300026089 | Bacteria | 1315 |
| 418 | Ga0207676_10004991 | 3300026095 | Bacteria | 9400 |
| 419 | Ga0207676_10011582 | 3300026095 | Bacteria | 6306 |
| 420 | Ga0207676_10033040 | 3300026095 | Bacteria | 3906 |
| 421 | Ga0207676_10045595 | 3300026095 | Bacteria | 3388 |
| 422 | Ga0207676_10079068 | 3300026095 | Bacteria | 2666 |
| 423 | Ga0207676_10254464 | 3300026095 | Bacteria | 1582 |
| 424 | Ga0207676_10551427 | 3300026095 | Bacteria | 1101 |
| 425 | Ga0207674_10159975 | 3300026116 | Bacteria | 2206 |
| 426 | Ga0207674_10184093 | 3300026116 | Bacteria | 2039 |
| 427 | Ga0207675_100008151 | 3300026118 | Bacteria | 9875 |
| 428 | Ga0207675_100023191 | 3300026118 | Bacteria | 5771 |
| 429 | Ga0207675_100161335 | 3300026118 | Bacteria | 2138 |
| 430 | Ga0207675_100187106 | 3300026118 | Bacteria | 1985 |
| 431 | Ga0207683_10025450 | 3300026121 | Bacteria | 5106 |
| 432 | Ga0207683_10080603 | 3300026121 | Bacteria | 2888 |
| 433 | Ga0207683_10083536 | 3300026121 | Bacteria | 2838 |
| 434 | Ga0207683_10156000 | 3300026121 | Bacteria | 2062 |
| 435 | Ga0207683_10163204 | 3300026121 | Bacteria | 2015 |
| 436 | Ga0207683_10195091 | 3300026121 | Bacteria | 1839 |
| 437 | Ga0207698_10016587 | 3300026142 | Bacteria | 4970 |
| 438 | Ga0207698_10044118 | 3300026142 | Bacteria | 3347 |
| 439 | Ga0207698_10136893 | 3300026142 | Bacteria | 2103 |
| 440 | Ga0207698_10157641 | 3300026142 | Bacteria | 1980 |
| 441 | Ga0207698_10245947 | 3300026142 | Bacteria | 1633 |
| 442 | Ga0209813_10001726 | 3300027866 | Bacteria | 4922 |
| 443 | Ga0209813_10006806 | 3300027866 | Bacteria | 2832 |
| 444 | Ga0209813_10069947 | 3300027866 | Bacteria | 1139 |
| 445 | Ga0209974_10001641 | 3300027876 | Bacteria | 8098 |
| 446 | Ga0268266_10060195 | 3300028379 | Bacteria | 3273 |
| 447 | Ga0268266_10072607 | 3300028379 | Bacteria | 2985 |
| 448 | Ga0268266_10166821 | 3300028379 | Bacteria | 1996 |
| 449 | Ga0268266_10190097 | 3300028379 | Bacteria | 1874 |
| 450 | Ga0268265_10106367 | 3300028380 | Bacteria | 2279 |
| 451 | Ga0268265_10162748 | 3300028380 | Bacteria | 1898 |
| 452 | Ga0268264_10003375 | 3300028381 | Bacteria | 13788 |
| 453 | Ga0268264_10020755 | 3300028381 | Bacteria | 5368 |
| 454 | Ga0268264_10206482 | 3300028381 | Bacteria | 1800 |
| 455 | Ga0307517_10077045 | 3300028786 | Bacteria | 2903 |
| 456 | Ga0307517_10088076 | 3300028786 | Bacteria | 2571 |
| 457 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 458 | Ga0307515_10001206 | 3300028794 | Bacteria | 59045 |
| 459 | Ga0307515_10011495 | 3300028794 | Bacteria | 16801 |
| 460 | Ga0307515_10087663 | 3300028794 | Bacteria | 3946 |
| 461 | Ga0307512_10059574 | 3300030522 | Bacteria | 2961 |
| 462 | Ga0307512_10109888 | 3300030522 | Bacteria | 1822 |
| 463 | Ga0265328_10013306 | 3300031239 | Bacteria | 3261 |
| 464 | Ga0307513_10017125 | 3300031456 | Bacteria | 8704 |
| 465 | Ga0307513_10098065 | 3300031456 | Bacteria | 2963 |
| 466 | Ga0307513_10106681 | 3300031456 | Bacteria | 2806 |
| 467 | Ga0307513_10277999 | 3300031456 | Bacteria | 1453 |
| 468 | Ga0307513_10341078 | 3300031456 | Bacteria | 1249 |
| 469 | Ga0307509_10000249 | 3300031507 | Bacteria | 87094 |
| 470 | Ga0307509_10003703 | 3300031507 | Bacteria | 22876 |
| 471 | Ga0307509_10197563 | 3300031507 | Bacteria | 1853 |
| 472 | Ga0307508_10000216 | 3300031616 | Bacteria | 69990 |
| 473 | Ga0307508_10006698 | 3300031616 | Bacteria | 10804 |
| 474 | Ga0307514_10015854 | 3300031649 | Bacteria | 6210 |
| 475 | Ga0307516_10006485 | 3300031730 | Bacteria | 13704 |
| 476 | Ga0307516_10174805 | 3300031730 | Bacteria | 1885 |
| 477 | Ga0307405_10118973 | 3300031731 | Bacteria | 1804 |
| 478 | Ga0307413_10057428 | 3300031824 | Bacteria | 2380 |
| 479 | Ga0307413_10115720 | 3300031824 | Unclassified | 1805 |
| 480 | Ga0307410_10138158 | 3300031852 | Bacteria | 1799 |
| 481 | Ga0307406_10023123 | 3300031901 | Bacteria | 3696 |
| 482 | Ga0307407_10210016 | 3300031903 | Bacteria | 1310 |
| 483 | Ga0307412_10027498 | 3300031911 | Bacteria | 3547 |
| 484 | Ga0307412_10034896 | 3300031911 | Bacteria | 3209 |
| 485 | Ga0307409_100131501 | 3300031995 | Bacteria | 2140 |
| 486 | Ga0307409_100304806 | 3300031995 | Bacteria | 1484 |
| 487 | Ga0307416_100014114 | 3300032002 | Bacteria | 5457 |
| 488 | Ga0307416_100061065 | 3300032002 | Bacteria | 3074 |
| 489 | Ga0307411_10012282 | 3300032005 | Bacteria | 4665 |
| 490 | Ga0307411_10016314 | 3300032005 | Bacteria | 4202 |
| 491 | Ga0307507_10058387 | 3300033179 | Bacteria | 3623 |
| 492 | Ga0307510_10009738 | 3300033180 | Bacteria | 11436 |
| 493 | Ga0373949_0046589 | 3300035090 | Bacteria | 1081 |
| 494 | Ga0373956_0094396 | 3300035119 | Bacteria | 1382 |
| 495 | Ga0373957_0093147 | 3300035120 | Bacteria | 1200 |
| 496 | Ga0373955_0065797 | 3300035172 | Bacteria | 2013 |
| 497 | Ga0373931_0002695 | 3300035691 | Bacteria | 7904 |
| 498 | Ga0373935_0129552 | 3300035692 | Bacteria | 1694 |
| 499 | Ga0373947_0074319 | 3300035725 | Bacteria | 2091 |
| 500 | Ga0373937_0044214 | 3300036401 | Bacteria | 4067 |
| 501 | Ga0373925_0050008 | 3300037068 | Bacteria | 3117 |
| 502 | Ga0395905_0000140 | 3300037471 | Bacteria | 120221 |
| 503 | Ga0395905_0010653 | 3300037471 | Bacteria | 8919 |
| 504 | Ga0395905_0285650 | 3300037471 | Bacteria | 1537 |
| 505 | Ga0436363_0457939 | 3300039450 | Bacteria | 2488 |
| 506 | Ga0451793_0320329 | 3300041452 | Bacteria | 949 |
| 507 | Ga0451793_0659484 | 3300041452 | Bacteria | 2027 |
| 508 | Ga0451798_0362761 | 3300041458 | Bacteria | 2178 |
| 509 | Ga0451804_0090619 | 3300041463 | Bacteria | 1251 |
| 510 | Ga0451807_0096601 | 3300041486 | Bacteria | 1451 |
| 511 | Ga0451841_0104201 | 3300041498 | Bacteria | 1678 |
| 512 | Ga0451853_1937147 | 3300041512 | Bacteria | 1393 |
| 513 | Ga0466969_0000020 | 3300044656 | Bacteria | 101861 |
| 514 | Ga0466972_0000594 | 3300044658 | Bacteria | 17607 |
| 515 | Ga0466972_0034624 | 3300044658 | Bacteria | 2473 |
| 516 | Ga0466965_0040007 | 3300044683 | Bacteria | 2306 |
| 517 | Ga0466965_0040218 | 3300044683 | Bacteria | 2301 |
| 518 | Ga0466965_0070563 | 3300044683 | Bacteria | 1756 |
| 519 | Ga0466966_0030555 | 3300044684 | Bacteria | 3496 |
| 520 | Ga0466961_0019127 | 3300044693 | Bacteria | 4407 |
| 521 | Ga0466961_0187416 | 3300044693 | Bacteria | 1283 |
| 522 | Ga0453684_0020128 | 3300044712 | Bacteria | 10096 |
| 523 | Ga0453684_0086122 | 3300044712 | Bacteria | 3900 |
| 524 | Ga0466971_0064726 | 3300044719 | Bacteria | 1655 |
| 525 | Ga0466970_0046815 | 3300044765 | Bacteria | 2304 |
| 526 | Ga0466957_0047364 | 3300044842 | Bacteria | 2612 |
| 527 | Ga0466960_0184303 | 3300044901 | Bacteria | 1133 |
| 528 | Ga0451576_0212037 | 3300045051 | Bacteria | 2022 |
| 529 | Ga0466967_0291581 | 3300045976 | Bacteria | 1568 |
| 530 | Ga0495592_0001883 | 3300046454 | Bacteria | 14765 |
| 531 | Ga0495629_0148636 | 3300046459 | Bacteria | 1629 |
| 532 | Ga0495582_0252674 | 3300046473 | Bacteria | 1011 |
| 533 | Ga0495628_0242193 | 3300046516 | Bacteria | 1349 |
| 534 | Ga0495632_0010839 | 3300046519 | Bacteria | 5362 |
| 535 | Ga0495632_0035845 | 3300046519 | Bacteria | 2527 |
| 536 | Ga0495598_0048524 | 3300046537 | Bacteria | 1270 |
| 537 | Ga0495645_0062606 | 3300046543 | Bacteria | 2695 |
| 538 | Ga0495668_0153315 | 3300046616 | Bacteria | 1262 |
| 539 | Ga0495625_0004997 | 3300046660 | Bacteria | 12312 |
| 540 | Ga0495647_0003210 | 3300046681 | Bacteria | 5230 |
| 541 | Ga0495658_0052347 | 3300046683 | Bacteria | 2315 |
| 542 | Ga0495658_0224679 | 3300046683 | Bacteria | 1176 |
| 543 | Ga0495684_0111770 | 3300047471 | Bacteria | 2061 |
| 544 | Ga0495686_0182833 | 3300047472 | Bacteria | 1214 |
| 545 | Ga0496100_0004969 | 3300048903 | Bacteria | 7109 |
| 546 | Ga0496102_0002898 | 3300048905 | Bacteria | 14539 |
| 547 | Ga0496102_0066858 | 3300048905 | Bacteria | 3295 |
| 548 | Ga0496104_0146090 | 3300048907 | Bacteria | 2271 |
| 549 | Ga0496105_0126952 | 3300048908 | Bacteria | 2103 |
| 550 | Ga0496106_0025160 | 3300048909 | Bacteria | 4428 |
| 551 | Ga0496107_0003649 | 3300048910 | Bacteria | 10348 |
| 552 | Ga0496108_0014761 | 3300048911 | Bacteria | 6376 |
| 553 | Ga0496109_0185242 | 3300048912 | Bacteria | 1956 |
| 554 | Ga0496110_0034479 | 3300048913 | Bacteria | 4384 |
| 555 | Ga0496111_0246096 | 3300048914 | Bacteria | 1327 |
| 556 | Ga0496112_0241198 | 3300048915 | Bacteria | 1760 |
| 557 | nmdc:mga03683_159822_c1 | 3300050489 | Bacteria | 1020 |
| 558 | nmdc:mga03n38_164991_c1 | 3300050490 | Bacteria | 1124 |
| 559 | nmdc:mga03n38_208194_c1 | 3300050490 | Bacteria | 1015 |
| 560 | nmdc:mga03n38_24590_c1 | 3300050490 | Bacteria | 2464 |
| 561 | nmdc:mga0k408_105924_c1 | 3300050493 | Bacteria | 1661 |
| 562 | nmdc:mga0k408_1135_c1 | 3300050493 | Bacteria | 14614 |
| 563 | nmdc:mga0k408_1245_c1 | 3300050493 | Bacteria | 13917 |
| 564 | nmdc:mga0k408_32874_c1 | 3300050493 | Bacteria | 2964 |
| 565 | nmdc:mga0k408_4061_c1 | 3300050493 | Bacteria | 7765 |
| 566 | nmdc:mga0k408_49318_c1 | 3300050493 | Bacteria | 2437 |
| 567 | nmdc:mga0k408_669_c1 | 3300050493 | Bacteria | 18779 |
| 568 | nmdc:mga0k408_7292_c1 | 3300050493 | Bacteria | 5907 |
| 569 | nmdc:mga06z11_215045_c1 | 3300050494 | Bacteria | 1121 |
| 570 | nmdc:mga06z11_2171_c1 | 3300050494 | Bacteria | 7447 |
| 571 | nmdc:mga06z11_8664_c1 | 3300050494 | Bacteria | 4255 |
| 572 | nmdc:mga04h51_15581_c1 | 3300050495 | Bacteria | 2192 |
| 573 | nmdc:mga04h51_1899_c1 | 3300050495 | Bacteria | 4876 |
| 574 | nmdc:mga07m45_10728_c1 | 3300050496 | Bacteria | 4794 |
| 575 | nmdc:mga07m45_1153_c1 | 3300050496 | Bacteria | 11861 |
| 576 | nmdc:mga07m45_3113_c1 | 3300050496 | Bacteria | 7940 |
| 577 | nmdc:mga07m45_52553_c1 | 3300050496 | Bacteria | 2300 |
| 578 | nmdc:mga07m45_6321_c1 | 3300050496 | Bacteria | 5984 |
| 579 | nmdc:mga0sz30_30396_c1 | 3300050516 | Bacteria | 2231 |
| 580 | nmdc:mga0sz30_8564_c1 | 3300050516 | Bacteria | 3865 |
| 581 | Ga0495601_0032063 | 3300053077 | Bacteria | 3269 |
| 582 | Ga0500578_0000673 | 3300053086 | Bacteria | 40901 |
| 583 | Ga0500651_0276409 | 3300053093 | Bacteria | 970 |
| 584 | Ga0500650_0046776 | 3300053098 | Bacteria | 2005 |
| 585 | Ga0500562_024019 | 3300053108 | Bacteria | 1593 |
| 586 | Ga0500593_000680 | 3300053117 | Bacteria | 12914 |
| 587 | Ga0500607_078551 | 3300053121 | Bacteria | 1687 |
| 588 | Ga0500628_019472 | 3300053129 | Bacteria | 1351 |
| 589 | Ga0500652_056670 | 3300053131 | Bacteria | 1607 |
| 590 | Ga0500568_0028336 | 3300053139 | Bacteria | 2335 |
| 591 | Ga0500619_000006 | 3300053154 | Bacteria | 77270 |
| 592 | Ga0500619_009997 | 3300053154 | Bacteria | 2379 |
| 593 | Ga0500622_0000872 | 3300053156 | Bacteria | 25676 |
| 594 | Ga0500570_053603 | 3300053724 | Bacteria | 2008 |
| 595 | Ga0500587_000047 | 3300053739 | Bacteria | 9955 |
| 596 | Ga0466962_0006584 | 3300061719 | Bacteria | 5573 |
| 597 | Ga0466962_0037915 | 3300061719 | Bacteria | 2309 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030522 | Ga0307512_10059574 | Ga0307512_100595743 | 230 |
| 2 | 3300005327 | Ga0070658_10016712 | Ga0070658_100167125 | 231 |
| 3 | 3300005339 | Ga0070660_100083259 | Ga0070660_1000832593 | 231 |
| 4 | 3300005535 | Ga0070684_100005261 | Ga0070684_1000052617 | 231 |
| 5 | 3300005564 | Ga0070664_100015313 | Ga0070664_1000153133 | 231 |
| 6 | 3300005577 | Ga0068857_100010507 | Ga0068857_1000105077 | 231 |
| 7 | 3300005614 | Ga0068856_100013192 | Ga0068856_1000131925 | 231 |
| 8 | 3300005616 | Ga0068852_100013380 | Ga0068852_1000133803 | 231 |
| 9 | 3300005834 | Ga0068851_10207598 | Ga0068851_102075982 | 231 |
| 10 | 3300013104 | Ga0157370_10162346 | Ga0157370_101623462 | 231 |
| 11 | 3300013105 | Ga0157369_10058720 | Ga0157369_100587203 | 231 |
| 12 | 3300013296 | Ga0157374_10052887 | Ga0157374_100528873 | 231 |
| 13 | 3300013307 | Ga0157372_10013740 | Ga0157372_100137403 | 231 |
| 14 | 3300028794 | Ga0307515_10000138 | Ga0307515_1000013846 | 231 |
| 15 | 3300061719 | Ga0466962_0037915 | Ga0466962_0037915_397_1233 | 231 |
| 16 | 3300006177 | Ga0075362_10042877 | Ga0075362_100428772 | 232 |
| 17 | 3300013297 | Ga0157378_10716694 | Ga0157378_107166941 | 232 |
| 18 | 3300025909 | Ga0207705_10033024 | Ga0207705_100330245 | 232 |
| 19 | 3300025945 | Ga0207679_10008387 | Ga0207679_100083875 | 232 |
| 20 | 3300025960 | Ga0207651_10375358 | Ga0207651_103753581 | 232 |
| 21 | 3300026078 | Ga0207702_10099445 | Ga0207702_100994453 | 232 |
| 22 | 3300026116 | Ga0207674_10184093 | Ga0207674_101840932 | 232 |
| 23 | 3300026142 | Ga0207698_10044118 | Ga0207698_100441182 | 232 |
| 24 | 3300028786 | Ga0307517_10077045 | Ga0307517_100770452 | 232 |
| 25 | 3300028786 | Ga0307517_10088076 | Ga0307517_100880763 | 232 |
| 26 | 3300028794 | Ga0307515_10087663 | Ga0307515_100876631 | 232 |
| 27 | 3300031456 | Ga0307513_10277999 | Ga0307513_102779992 | 232 |
| 28 | 3300044656 | Ga0466969_0000020 | Ga0466969_0000020_11819_12655 | 232 |
| 29 | 3300044683 | Ga0466965_0070563 | Ga0466965_0070563_431_1267 | 232 |
| 30 | 3300044684 | Ga0466966_0030555 | Ga0466966_0030555_2555_3391 | 232 |
| 31 | 3300044693 | Ga0466961_0019127 | Ga0466961_0019127_1190_2026 | 232 |
| 32 | 3300053724 | Ga0500570_053603 | Ga0500570_053603_865_1701 | 232 |
| 33 | 3300005445 | Ga0070708_100338018 | Ga0070708_1003380182 | 233 |
| 34 | 3300006048 | Ga0075363_100224254 | Ga0075363_1002242542 | 233 |
| 35 | 3300006195 | Ga0075366_10001768 | Ga0075366_100017686 | 233 |
| 36 | 3300006353 | Ga0075370_10001151 | Ga0075370_100011518 | 233 |
| 37 | 3300035119 | Ga0373956_0094396 | Ga0373956_0094396_239_1063 | 233 |
| 38 | 3300035120 | Ga0373957_0093147 | Ga0373957_0093147_167_991 | 233 |
| 39 | 3300035172 | Ga0373955_0065797 | Ga0373955_0065797_1030_1854 | 233 |
| 40 | 3300035725 | Ga0373947_0074319 | Ga0373947_0074319_676_1500 | 233 |
| 41 | 3300036401 | Ga0373937_0044214 | Ga0373937_0044214_39_863 | 233 |
| 42 | 3300037068 | Ga0373925_0050008 | Ga0373925_0050008_940_1764 | 233 |
| 43 | 3300046459 | Ga0495629_0148636 | Ga0495629_0148636_691_1515 | 233 |
| 44 | 3300046516 | Ga0495628_0242193 | Ga0495628_0242193_36_860 | 233 |
| 45 | 3300046543 | Ga0495645_0062606 | Ga0495645_0062606_200_1024 | 233 |
| 46 | 3300046683 | Ga0495658_0052347 | Ga0495658_0052347_343_1167 | 233 |
| 47 | 3300047471 | Ga0495684_0111770 | Ga0495684_0111770_533_1357 | 233 |
| 48 | 3300050493 | nmdc:mga0k408_49318_c1 | nmdc:mga0k408_49318_c1_363_1229 | 233 |
| 49 | 3300050496 | nmdc:mga07m45_10728_c1 | nmdc:mga07m45_10728_c1_1249_2076 | 233 |
| 50 | 3300005338 | Ga0068868_100069894 | Ga0068868_1000698942 | 234 |
| 51 | 3300005366 | Ga0070659_100122710 | Ga0070659_1001227103 | 234 |
| 52 | 3300005458 | Ga0070681_10017630 | Ga0070681_100176302 | 234 |
| 53 | 3300005530 | Ga0070679_100000726 | Ga0070679_10000072627 | 234 |
| 54 | 3300005578 | Ga0068854_100013710 | Ga0068854_1000137103 | 234 |
| 55 | 3300006042 | Ga0075368_10018606 | Ga0075368_100186063 | 234 |
| 56 | 3300006048 | Ga0075363_100061252 | Ga0075363_1000612523 | 234 |
| 57 | 3300006178 | Ga0075367_10048227 | Ga0075367_100482272 | 234 |
| 58 | 3300006186 | Ga0075369_10028340 | Ga0075369_100283402 | 234 |
| 59 | 3300009148 | Ga0105243_10042764 | Ga0105243_100427645 | 234 |
| 60 | 3300009545 | Ga0105237_10004861 | Ga0105237_1000486115 | 234 |
| 61 | 3300010375 | Ga0105239_10030119 | Ga0105239_100301194 | 234 |
| 62 | 3300025912 | Ga0207707_10092626 | Ga0207707_100926264 | 234 |
| 63 | 3300025914 | Ga0207671_10023595 | Ga0207671_100235953 | 234 |
| 64 | 3300025917 | Ga0207660_10056055 | Ga0207660_100560554 | 234 |
| 65 | 3300025921 | Ga0207652_10009072 | Ga0207652_100090727 | 234 |
| 66 | 3300025932 | Ga0207690_10101872 | Ga0207690_101018722 | 234 |
| 67 | 3300025933 | Ga0207706_10024686 | Ga0207706_100246864 | 234 |
| 68 | 3300025942 | Ga0207689_10063010 | Ga0207689_100630102 | 234 |
| 69 | 3300025961 | Ga0207712_10097655 | Ga0207712_100976552 | 234 |
| 70 | 3300026023 | Ga0207677_10134704 | Ga0207677_101347042 | 234 |
| 71 | 3300027866 | Ga0209813_10006806 | Ga0209813_100068063 | 234 |
| 72 | 3300031456 | Ga0307513_10341078 | Ga0307513_103410781 | 234 |
| 73 | 3300050490 | nmdc:mga03n38_24590_c1 | nmdc:mga03n38_24590_c1_848_1705 | 234 |
| 74 | 3300050494 | nmdc:mga06z11_8664_c1 | nmdc:mga06z11_8664_c1_49_906 | 234 |
| 75 | 3300050495 | nmdc:mga04h51_15581_c1 | nmdc:mga04h51_15581_c1_1120_1977 | 234 |
| 76 | 3300050516 | nmdc:mga0sz30_30396_c1 | nmdc:mga0sz30_30396_c1_692_1549 | 234 |
| 77 | 3300053117 | Ga0500593_000680 | Ga0500593_000680_1051_1899 | 234 |
| 78 | 3300006186 | Ga0075369_10020713 | Ga0075369_100207133 | 235 |
| 79 | 3300030522 | Ga0307512_10109888 | Ga0307512_101098882 | 235 |
| 80 | 3300031507 | Ga0307509_10000249 | Ga0307509_1000024969 | 235 |
| 81 | 3300031730 | Ga0307516_10174805 | Ga0307516_101748053 | 235 |
| 82 | 3300033180 | Ga0307510_10009738 | Ga0307510_100097382 | 235 |
| 83 | 3300046454 | Ga0495592_0001883 | Ga0495592_0001883_8768_9559 | 235 |
| 84 | 3300053093 | Ga0500651_0276409 | Ga0500651_0276409_158_949 | 235 |
| 85 | 3300053121 | Ga0500607_078551 | Ga0500607_078551_767_1618 | 235 |
| 86 | 3300053154 | Ga0500619_009997 | Ga0500619_009997_144_935 | 235 |
| 87 | 3300005459 | Ga0068867_100014496 | Ga0068867_1000144965 | 236 |
| 88 | 3300005618 | Ga0068864_100233074 | Ga0068864_1002330742 | 236 |
| 89 | 3300005718 | Ga0068866_10087404 | Ga0068866_100874042 | 236 |
| 90 | 3300006042 | Ga0075368_10000682 | Ga0075368_100006829 | 236 |
| 91 | 3300006051 | Ga0075364_10124329 | Ga0075364_101243292 | 236 |
| 92 | 3300006177 | Ga0075362_10016796 | Ga0075362_100167963 | 236 |
| 93 | 3300006178 | Ga0075367_10032551 | Ga0075367_100325513 | 236 |
| 94 | 3300006195 | Ga0075366_10005954 | Ga0075366_100059545 | 236 |
| 95 | 3300006195 | Ga0075366_10095314 | Ga0075366_100953142 | 236 |
| 96 | 3300006195 | Ga0075366_10137621 | Ga0075366_101376212 | 236 |
| 97 | 3300025907 | Ga0207645_10206752 | Ga0207645_102067521 | 236 |
| 98 | 3300025920 | Ga0207649_10063732 | Ga0207649_100637322 | 236 |
| 99 | 3300025945 | Ga0207679_10337306 | Ga0207679_103373061 | 236 |
| 100 | 3300026089 | Ga0207648_10021145 | Ga0207648_100211455 | 236 |
| 101 | 3300027866 | Ga0209813_10001726 | Ga0209813_100017267 | 236 |
| 102 | 3300028379 | Ga0268266_10166821 | Ga0268266_101668213 | 236 |
| 103 | 3300035692 | Ga0373935_0129552 | Ga0373935_0129552_212_1048 | 236 |
| 104 | 3300046683 | Ga0495658_0224679 | Ga0495658_0224679_17_853 | 236 |
| 105 | 3300050493 | nmdc:mga0k408_1135_c1 | nmdc:mga0k408_1135_c1_6296_7150 | 236 |
| 106 | 3300050495 | nmdc:mga04h51_1899_c1 | nmdc:mga04h51_1899_c1_220_1071 | 236 |
| 107 | 3300050516 | nmdc:mga0sz30_8564_c1 | nmdc:mga0sz30_8564_c1_543_1394 | 236 |
| 108 | 3300053077 | Ga0495601_0032063 | Ga0495601_0032063_1051_1887 | 236 |
| 109 | 3300005347 | Ga0070668_100277076 | Ga0070668_1002770762 | 237 |
| 110 | 3300005353 | Ga0070669_100173734 | Ga0070669_1001737342 | 237 |
| 111 | 3300005364 | Ga0070673_100120925 | Ga0070673_1001209252 | 237 |
| 112 | 3300005535 | Ga0070684_100451596 | Ga0070684_1004515962 | 237 |
| 113 | 3300005547 | Ga0070693_100041764 | Ga0070693_1000417643 | 237 |
| 114 | 3300005616 | Ga0068852_100114694 | Ga0068852_1001146942 | 237 |
| 115 | 3300013104 | Ga0157370_10530964 | Ga0157370_105309641 | 237 |
| 116 | 3300013307 | Ga0157372_10368357 | Ga0157372_103683572 | 237 |
| 117 | 3300025944 | Ga0207661_10037727 | Ga0207661_100377275 | 237 |
| 118 | 3300025945 | Ga0207679_10030713 | Ga0207679_100307134 | 237 |
| 119 | 3300025986 | Ga0207658_10202601 | Ga0207658_102026013 | 237 |
| 120 | 3300026095 | Ga0207676_10551427 | Ga0207676_105514272 | 237 |
| 121 | 3300053154 | Ga0500619_000006 | Ga0500619_000006_12501_13313 | 237 |
| 122 | 3300005328 | Ga0070676_10021221 | Ga0070676_100212211 | 238 |
| 123 | 3300005330 | Ga0070690_100017758 | Ga0070690_1000177585 | 238 |
| 124 | 3300005331 | Ga0070670_100080193 | Ga0070670_1000801933 | 238 |
| 125 | 3300005333 | Ga0070677_10005615 | Ga0070677_100056157 | 238 |
| 126 | 3300005335 | Ga0070666_10004086 | Ga0070666_100040869 | 238 |
| 127 | 3300005338 | Ga0068868_100001343 | Ga0068868_10000134310 | 238 |
| 128 | 3300005340 | Ga0070689_100156502 | Ga0070689_1001565022 | 238 |
| 129 | 3300005354 | Ga0070675_100003418 | Ga0070675_10000341810 | 238 |
| 130 | 3300005365 | Ga0070688_100019843 | Ga0070688_1000198436 | 238 |
| 131 | 3300005456 | Ga0070678_100081202 | Ga0070678_1000812022 | 238 |
| 132 | 3300005459 | Ga0068867_100071487 | Ga0068867_1000714872 | 238 |
| 133 | 3300005548 | Ga0070665_100007443 | Ga0070665_1000074435 | 238 |
| 134 | 3300005617 | Ga0068859_100001451 | Ga0068859_1000014518 | 238 |
| 135 | 3300005618 | Ga0068864_100002901 | Ga0068864_10000290110 | 238 |
| 136 | 3300005719 | Ga0068861_100145774 | Ga0068861_1001457742 | 238 |
| 137 | 3300005719 | Ga0068861_100329349 | Ga0068861_1003293492 | 238 |
| 138 | 3300005841 | Ga0068863_100010181 | Ga0068863_1000101812 | 238 |
| 139 | 3300005844 | Ga0068862_100042040 | Ga0068862_1000420403 | 238 |
| 140 | 3300006237 | Ga0097621_100009422 | Ga0097621_1000094223 | 238 |
| 141 | 3300006358 | Ga0068871_100076558 | Ga0068871_1000765584 | 238 |
| 142 | 3300006931 | Ga0097620_100001451 | Ga0097620_1000014518 | 238 |
| 143 | 3300009177 | Ga0105248_10008335 | Ga0105248_1000833510 | 238 |
| 144 | 3300013297 | Ga0157378_10192154 | Ga0157378_101921542 | 238 |
| 145 | 3300013306 | Ga0163162_10178661 | Ga0163162_101786613 | 238 |
| 146 | 3300013306 | Ga0163162_10206812 | Ga0163162_102068123 | 238 |
| 147 | 3300013308 | Ga0157375_10027908 | Ga0157375_100279085 | 238 |
| 148 | 3300013308 | Ga0157375_10417487 | Ga0157375_104174872 | 238 |
| 149 | 3300014325 | Ga0163163_10003570 | Ga0163163_1000357010 | 238 |
| 150 | 3300014326 | Ga0157380_10215411 | Ga0157380_102154112 | 238 |
| 151 | 3300014968 | Ga0157379_10229954 | Ga0157379_102299542 | 238 |
| 152 | 3300014968 | Ga0157379_10424267 | Ga0157379_104242672 | 238 |
| 153 | 3300014969 | Ga0157376_10248362 | Ga0157376_102483622 | 238 |
| 154 | 3300017792 | Ga0163161_10430928 | Ga0163161_104309282 | 238 |
| 155 | 3300025893 | Ga0207682_10005911 | Ga0207682_100059112 | 238 |
| 156 | 3300025903 | Ga0207680_10010662 | Ga0207680_100106624 | 238 |
| 157 | 3300025908 | Ga0207643_10197607 | Ga0207643_101976071 | 238 |
| 158 | 3300025923 | Ga0207681_10037524 | Ga0207681_100375242 | 238 |
| 159 | 3300025926 | Ga0207659_10002886 | Ga0207659_1000288611 | 238 |
| 160 | 3300025931 | Ga0207644_10024131 | Ga0207644_100241313 | 238 |
| 161 | 3300025933 | Ga0207706_10043492 | Ga0207706_100434925 | 238 |
| 162 | 3300025936 | Ga0207670_10183929 | Ga0207670_101839292 | 238 |
| 163 | 3300025940 | Ga0207691_10109769 | Ga0207691_101097692 | 238 |
| 164 | 3300025941 | Ga0207711_10028615 | Ga0207711_100286155 | 238 |
| 165 | 3300025960 | Ga0207651_10001062 | Ga0207651_100010626 | 238 |
| 166 | 3300025961 | Ga0207712_10048342 | Ga0207712_100483423 | 238 |
| 167 | 3300025972 | Ga0207668_10178318 | Ga0207668_101783182 | 238 |
| 168 | 3300026023 | Ga0207677_10002493 | Ga0207677_100024932 | 238 |
| 169 | 3300026035 | Ga0207703_10005450 | Ga0207703_1000545010 | 238 |
| 170 | 3300026067 | Ga0207678_10112336 | Ga0207678_101123362 | 238 |
| 171 | 3300026075 | Ga0207708_10460076 | Ga0207708_104600761 | 238 |
| 172 | 3300026088 | Ga0207641_10002150 | Ga0207641_100021508 | 238 |
| 173 | 3300026089 | Ga0207648_10094008 | Ga0207648_100940082 | 238 |
| 174 | 3300026095 | Ga0207676_10004991 | Ga0207676_100049912 | 238 |
| 175 | 3300026118 | Ga0207675_100161335 | Ga0207675_1001613352 | 238 |
| 176 | 3300026118 | Ga0207675_100187106 | Ga0207675_1001871061 | 238 |
| 177 | 3300026121 | Ga0207683_10163204 | Ga0207683_101632042 | 238 |
| 178 | 3300028379 | Ga0268266_10060195 | Ga0268266_100601956 | 238 |
| 179 | 3300031456 | Ga0307513_10017125 | Ga0307513_100171256 | 238 |
| 180 | 3300044658 | Ga0466972_0034624 | Ga0466972_0034624_1296_2117 | 238 |
| 181 | 3300046681 | Ga0495647_0003210 | Ga0495647_0003210_4260_5108 | 238 |
| 182 | 3300048908 | Ga0496105_0126952 | Ga0496105_0126952_604_1440 | 238 |
| 183 | 3300048911 | Ga0496108_0014761 | Ga0496108_0014761_2781_3626 | 238 |
| 184 | 3300002773 | JGI25152J39213_1000662 | JGI25152J39213_100066213 | 239 |
| 185 | 3300003215 | JGI25153J46596_10003371 | JGI25153J46596_100033717 | 239 |
| 186 | 3300003771 | Ga0055526_1001626 | Ga0055526_10016267 | 239 |
| 187 | 3300005459 | Ga0068867_100017829 | Ga0068867_1000178292 | 239 |
| 188 | 3300006195 | Ga0075366_10221944 | Ga0075366_102219441 | 239 |
| 189 | 3300013308 | Ga0157375_10014262 | Ga0157375_100142625 | 239 |
| 190 | 3300025245 | Ga0207425_1000802 | Ga0207425_100080215 | 239 |
| 191 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012263 | 239 |
| 192 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022251 | 239 |
| 193 | 3300025297 | Ga0209758_1000234 | Ga0209758_1000234108 | 239 |
| 194 | 3300025925 | Ga0207650_10007499 | Ga0207650_100074998 | 239 |
| 195 | 3300025960 | Ga0207651_10410093 | Ga0207651_104100932 | 239 |
| 196 | 3300025986 | Ga0207658_10210366 | Ga0207658_102103663 | 239 |
| 197 | 3300025986 | Ga0207658_10403049 | Ga0207658_104030492 | 239 |
| 198 | 3300026089 | Ga0207648_10358799 | Ga0207648_103587992 | 239 |
| 199 | iso_pu_bacteria | 2585428062 | 2587759504 | 239 |
| 200 | 3300005331 | Ga0070670_100013611 | Ga0070670_1000136112 | 240 |
| 201 | 3300005841 | Ga0068863_100831740 | Ga0068863_1008317401 | 240 |
| 202 | 3300014325 | Ga0163163_10115810 | Ga0163163_101158103 | 240 |
| 203 | 3300037471 | Ga0395905_0000140 | Ga0395905_0000140_76413_77378 | 240 |
| 204 | 3300050493 | nmdc:mga0k408_4061_c1 | nmdc:mga0k408_4061_c1_1556_2305 | 240 |
| 205 | 3300005344 | Ga0070661_100181398 | Ga0070661_1001813982 | 241 |
| 206 | 3300005354 | Ga0070675_100137894 | Ga0070675_1001378942 | 241 |
| 207 | 3300005355 | Ga0070671_100169440 | Ga0070671_1001694403 | 241 |
| 208 | 3300005456 | Ga0070678_100033281 | Ga0070678_1000332815 | 241 |
| 209 | 3300005543 | Ga0070672_100086298 | Ga0070672_1000862982 | 241 |
| 210 | 3300005544 | Ga0070686_100364279 | Ga0070686_1003642791 | 241 |
| 211 | 3300005564 | Ga0070664_100224211 | Ga0070664_1002242113 | 241 |
| 212 | 3300005718 | Ga0068866_10130962 | Ga0068866_101309621 | 241 |
| 213 | 3300006048 | Ga0075363_100024753 | Ga0075363_1000247533 | 241 |
| 214 | 3300006178 | Ga0075367_10049792 | Ga0075367_100497922 | 241 |
| 215 | 3300006186 | Ga0075369_10018641 | Ga0075369_100186413 | 241 |
| 216 | 3300006237 | Ga0097621_100151519 | Ga0097621_1001515192 | 241 |
| 217 | 3300006353 | Ga0075370_10012585 | Ga0075370_100125853 | 241 |
| 218 | 3300006358 | Ga0068871_100082655 | Ga0068871_1000826554 | 241 |
| 219 | 3300009147 | Ga0114129_10080001 | Ga0114129_100800014 | 241 |
| 220 | 3300014969 | Ga0157376_10239807 | Ga0157376_102398072 | 241 |
| 221 | 3300025907 | Ga0207645_10027684 | Ga0207645_100276845 | 241 |
| 222 | 3300031507 | Ga0307509_10003703 | Ga0307509_1000370312 | 241 |
| 223 | 3300031731 | Ga0307405_10118973 | Ga0307405_101189732 | 241 |
| 224 | 3300031911 | Ga0307412_10034896 | Ga0307412_100348963 | 241 |
| 225 | 3300032002 | Ga0307416_100014114 | Ga0307416_1000141142 | 241 |
| 226 | 3300046473 | Ga0495582_0252674 | Ga0495582_0252674_103_969 | 241 |
| 227 | 3300050490 | nmdc:mga03n38_208194_c1 | nmdc:mga03n38_208194_c1_95_916 | 241 |
| 228 | 3300050493 | nmdc:mga0k408_32874_c1 | nmdc:mga0k408_32874_c1_101_922 | 241 |
| 229 | 3300050493 | nmdc:mga0k408_7292_c1 | nmdc:mga0k408_7292_c1_1443_2174 | 241 |
| 230 | 3300050496 | nmdc:mga07m45_1153_c1 | nmdc:mga07m45_1153_c1_101_922 | 241 |
| 231 | 3300005331 | Ga0070670_100034305 | Ga0070670_1000343053 | 242 |
| 232 | 3300005333 | Ga0070677_10052567 | Ga0070677_100525672 | 242 |
| 233 | 3300005333 | Ga0070677_10063098 | Ga0070677_100630982 | 242 |
| 234 | 3300005344 | Ga0070661_100225204 | Ga0070661_1002252042 | 242 |
| 235 | 3300005354 | Ga0070675_100343512 | Ga0070675_1003435122 | 242 |
| 236 | 3300005355 | Ga0070671_100135962 | Ga0070671_1001359622 | 242 |
| 237 | 3300005355 | Ga0070671_100232935 | Ga0070671_1002329352 | 242 |
| 238 | 3300005364 | Ga0070673_100295974 | Ga0070673_1002959742 | 242 |
| 239 | 3300005367 | Ga0070667_100030336 | Ga0070667_1000303366 | 242 |
| 240 | 3300005456 | Ga0070678_100163811 | Ga0070678_1001638112 | 242 |
| 241 | 3300005459 | Ga0068867_100030867 | Ga0068867_1000308674 | 242 |
| 242 | 3300005616 | Ga0068852_100185077 | Ga0068852_1001850772 | 242 |
| 243 | 3300005842 | Ga0068858_100010630 | Ga0068858_1000106308 | 242 |
| 244 | 3300009177 | Ga0105248_10232105 | Ga0105248_102321052 | 242 |
| 245 | 3300013308 | Ga0157375_10043978 | Ga0157375_100439785 | 242 |
| 246 | 3300014325 | Ga0163163_10170197 | Ga0163163_101701974 | 242 |
| 247 | 3300014969 | Ga0157376_10154832 | Ga0157376_101548322 | 242 |
| 248 | 3300025315 | Ga0207697_10015695 | Ga0207697_100156954 | 242 |
| 249 | 3300025893 | Ga0207682_10011716 | Ga0207682_100117162 | 242 |
| 250 | 3300025893 | Ga0207682_10092786 | Ga0207682_100927862 | 242 |
| 251 | 3300025901 | Ga0207688_10227898 | Ga0207688_102278981 | 242 |
| 252 | 3300025907 | Ga0207645_10023445 | Ga0207645_100234455 | 242 |
| 253 | 3300025907 | Ga0207645_10204488 | Ga0207645_102044882 | 242 |
| 254 | 3300025920 | Ga0207649_10041035 | Ga0207649_100410354 | 242 |
| 255 | 3300025925 | Ga0207650_10023626 | Ga0207650_100236263 | 242 |
| 256 | 3300025925 | Ga0207650_10127027 | Ga0207650_101270272 | 242 |
| 257 | 3300025926 | Ga0207659_10057723 | Ga0207659_100577233 | 242 |
| 258 | 3300025931 | Ga0207644_10026585 | Ga0207644_100265853 | 242 |
| 259 | 3300025931 | Ga0207644_10057199 | Ga0207644_100571994 | 242 |
| 260 | 3300025933 | Ga0207706_10125634 | Ga0207706_101256342 | 242 |
| 261 | 3300025937 | Ga0207669_10342931 | Ga0207669_103429311 | 242 |
| 262 | 3300025938 | Ga0207704_10070145 | Ga0207704_100701453 | 242 |
| 263 | 3300025940 | Ga0207691_10101973 | Ga0207691_101019732 | 242 |
| 264 | 3300025940 | Ga0207691_10149842 | Ga0207691_101498423 | 242 |
| 265 | 3300025941 | Ga0207711_10048247 | Ga0207711_100482474 | 242 |
| 266 | 3300025941 | Ga0207711_10149051 | Ga0207711_101490512 | 242 |
| 267 | 3300025945 | Ga0207679_10266734 | Ga0207679_102667342 | 242 |
| 268 | 3300025981 | Ga0207640_10087561 | Ga0207640_100875612 | 242 |
| 269 | 3300025986 | Ga0207658_10140191 | Ga0207658_101401912 | 242 |
| 270 | 3300026023 | Ga0207677_10151054 | Ga0207677_101510541 | 242 |
| 271 | 3300026067 | Ga0207678_10154674 | Ga0207678_101546743 | 242 |
| 272 | 3300026088 | Ga0207641_10115113 | Ga0207641_101151132 | 242 |
| 273 | 3300026089 | Ga0207648_10010311 | Ga0207648_100103116 | 242 |
| 274 | 3300026089 | Ga0207648_10039013 | Ga0207648_100390132 | 242 |
| 275 | 3300026089 | Ga0207648_10311599 | Ga0207648_103115992 | 242 |
| 276 | 3300026095 | Ga0207676_10079068 | Ga0207676_100790683 | 242 |
| 277 | 3300026121 | Ga0207683_10025450 | Ga0207683_100254504 | 242 |
| 278 | 3300026121 | Ga0207683_10195091 | Ga0207683_101950913 | 242 |
| 279 | 3300027866 | Ga0209813_10069947 | Ga0209813_100699472 | 242 |
| 280 | 3300028379 | Ga0268266_10190097 | Ga0268266_101900973 | 242 |
| 281 | 3300028794 | Ga0307515_10001206 | Ga0307515_1000120623 | 242 |
| 282 | 3300031616 | Ga0307508_10006698 | Ga0307508_100066983 | 242 |
| 283 | 3300031730 | Ga0307516_10006485 | Ga0307516_1000648513 | 242 |
| 284 | 3300041498 | Ga0451841_0104201 | Ga0451841_0104201_87_917 | 242 |
| 285 | 3300041512 | Ga0451853_1937147 | Ga0451853_1937147_117_947 | 242 |
| 286 | 3300044712 | Ga0453684_0086122 | Ga0453684_0086122_1513_2250 | 242 |
| 287 | 3300046519 | Ga0495632_0010839 | Ga0495632_0010839_1316_2146 | 242 |
| 288 | 3300046616 | Ga0495668_0153315 | Ga0495668_0153315_279_1121 | 242 |
| 289 | 3300047472 | Ga0495686_0182833 | Ga0495686_0182833_244_1074 | 242 |
| 290 | 3300050489 | nmdc:mga03683_159822_c1 | nmdc:mga03683_159822_c1_105_935 | 242 |
| 291 | 3300053739 | Ga0500587_000047 | Ga0500587_000047_9010_9840 | 242 |
| 292 | 3300005328 | Ga0070676_10017134 | Ga0070676_100171342 | 243 |
| 293 | 3300005330 | Ga0070690_100028629 | Ga0070690_1000286292 | 243 |
| 294 | 3300005333 | Ga0070677_10015649 | Ga0070677_100156493 | 243 |
| 295 | 3300005334 | Ga0068869_100003488 | Ga0068869_1000034886 | 243 |
| 296 | 3300005334 | Ga0068869_100031544 | Ga0068869_1000315442 | 243 |
| 297 | 3300005338 | Ga0068868_100003534 | Ga0068868_1000035347 | 243 |
| 298 | 3300005338 | Ga0068868_100329171 | Ga0068868_1003291711 | 243 |
| 299 | 3300005344 | Ga0070661_100108494 | Ga0070661_1001084942 | 243 |
| 300 | 3300005347 | Ga0070668_100043016 | Ga0070668_1000430165 | 243 |
| 301 | 3300005353 | Ga0070669_100044294 | Ga0070669_1000442943 | 243 |
| 302 | 3300005353 | Ga0070669_100155058 | Ga0070669_1001550581 | 243 |
| 303 | 3300005354 | Ga0070675_100010402 | Ga0070675_1000104027 | 243 |
| 304 | 3300005354 | Ga0070675_100133968 | Ga0070675_1001339682 | 243 |
| 305 | 3300005356 | Ga0070674_100121621 | Ga0070674_1001216212 | 243 |
| 306 | 3300005366 | Ga0070659_100011449 | Ga0070659_1000114497 | 243 |
| 307 | 3300005367 | Ga0070667_100138756 | Ga0070667_1001387562 | 243 |
| 308 | 3300005441 | Ga0070700_100067380 | Ga0070700_1000673803 | 243 |
| 309 | 3300005455 | Ga0070663_100107129 | Ga0070663_1001071292 | 243 |
| 310 | 3300005455 | Ga0070663_100109227 | Ga0070663_1001092272 | 243 |
| 311 | 3300005456 | Ga0070678_100282192 | Ga0070678_1002821922 | 243 |
| 312 | 3300005457 | Ga0070662_100005695 | Ga0070662_1000056957 | 243 |
| 313 | 3300005457 | Ga0070662_100028238 | Ga0070662_1000282382 | 243 |
| 314 | 3300005457 | Ga0070662_100031932 | Ga0070662_1000319322 | 243 |
| 315 | 3300005459 | Ga0068867_100011992 | Ga0068867_1000119923 | 243 |
| 316 | 3300005539 | Ga0068853_100006811 | Ga0068853_1000068117 | 243 |
| 317 | 3300005544 | Ga0070686_100209678 | Ga0070686_1002096781 | 243 |
| 318 | 3300005547 | Ga0070693_100044620 | Ga0070693_1000446203 | 243 |
| 319 | 3300005563 | Ga0068855_100018761 | Ga0068855_1000187617 | 243 |
| 320 | 3300005564 | Ga0070664_100304190 | Ga0070664_1003041901 | 243 |
| 321 | 3300005564 | Ga0070664_100472159 | Ga0070664_1004721592 | 243 |
| 322 | 3300005578 | Ga0068854_100085075 | Ga0068854_1000850752 | 243 |
| 323 | 3300005578 | Ga0068854_100093842 | Ga0068854_1000938422 | 243 |
| 324 | 3300005614 | Ga0068856_100074496 | Ga0068856_1000744964 | 243 |
| 325 | 3300005616 | Ga0068852_100009092 | Ga0068852_1000090925 | 243 |
| 326 | 3300005616 | Ga0068852_100128266 | Ga0068852_1001282662 | 243 |
| 327 | 3300005618 | Ga0068864_100009398 | Ga0068864_1000093987 | 243 |
| 328 | 3300005618 | Ga0068864_100201517 | Ga0068864_1002015171 | 243 |
| 329 | 3300005718 | Ga0068866_10019689 | Ga0068866_100196893 | 243 |
| 330 | 3300005719 | Ga0068861_100005459 | Ga0068861_1000054597 | 243 |
| 331 | 3300005719 | Ga0068861_100013781 | Ga0068861_1000137815 | 243 |
| 332 | 3300005841 | Ga0068863_100018287 | Ga0068863_1000182877 | 243 |
| 333 | 3300005842 | Ga0068858_100285693 | Ga0068858_1002856932 | 243 |
| 334 | 3300005842 | Ga0068858_100368842 | Ga0068858_1003688422 | 243 |
| 335 | 3300005843 | Ga0068860_100039824 | Ga0068860_1000398243 | 243 |
| 336 | 3300005843 | Ga0068860_100172465 | Ga0068860_1001724652 | 243 |
| 337 | 3300005844 | Ga0068862_100086453 | Ga0068862_1000864534 | 243 |
| 338 | 3300006237 | Ga0097621_100033628 | Ga0097621_1000336286 | 243 |
| 339 | 3300006358 | Ga0068871_100016972 | Ga0068871_1000169727 | 243 |
| 340 | 3300006881 | Ga0068865_100041024 | Ga0068865_1000410244 | 243 |
| 341 | 3300007076 | Ga0075435_100170830 | Ga0075435_1001708302 | 243 |
| 342 | 3300009094 | Ga0111539_10644569 | Ga0111539_106445691 | 243 |
| 343 | 3300009098 | Ga0105245_10112084 | Ga0105245_101120843 | 243 |
| 344 | 3300009148 | Ga0105243_10149234 | Ga0105243_101492342 | 243 |
| 345 | 3300009174 | Ga0105241_10050051 | Ga0105241_100500513 | 243 |
| 346 | 3300009177 | Ga0105248_10011079 | Ga0105248_100110796 | 243 |
| 347 | 3300009545 | Ga0105237_10035404 | Ga0105237_100354043 | 243 |
| 348 | 3300009551 | Ga0105238_10152230 | Ga0105238_101522303 | 243 |
| 349 | 3300009553 | Ga0105249_10074684 | Ga0105249_100746843 | 243 |
| 350 | 3300013296 | Ga0157374_10031054 | Ga0157374_100310545 | 243 |
| 351 | 3300013306 | Ga0163162_10047853 | Ga0163162_100478535 | 243 |
| 352 | 3300013307 | Ga0157372_10163891 | Ga0157372_101638913 | 243 |
| 353 | 3300013308 | Ga0157375_10203394 | Ga0157375_102033942 | 243 |
| 354 | 3300014326 | Ga0157380_10088041 | Ga0157380_100880413 | 243 |
| 355 | 3300014745 | Ga0157377_10001565 | Ga0157377_100015658 | 243 |
| 356 | 3300014968 | Ga0157379_10043362 | Ga0157379_100433626 | 243 |
| 357 | 3300014968 | Ga0157379_10214716 | Ga0157379_102147162 | 243 |
| 358 | 3300014969 | Ga0157376_10003307 | Ga0157376_100033078 | 243 |
| 359 | 3300017792 | Ga0163161_10006298 | Ga0163161_100062986 | 243 |
| 360 | 3300025321 | Ga0207656_10067121 | Ga0207656_100671212 | 243 |
| 361 | 3300025893 | Ga0207682_10033543 | Ga0207682_100335432 | 243 |
| 362 | 3300025899 | Ga0207642_10010828 | Ga0207642_100108283 | 243 |
| 363 | 3300025901 | Ga0207688_10058459 | Ga0207688_100584592 | 243 |
| 364 | 3300025907 | Ga0207645_10049830 | Ga0207645_100498302 | 243 |
| 365 | 3300025911 | Ga0207654_10052847 | Ga0207654_100528474 | 243 |
| 366 | 3300025914 | Ga0207671_10048096 | Ga0207671_100480963 | 243 |
| 367 | 3300025918 | Ga0207662_10006607 | Ga0207662_100066077 | 243 |
| 368 | 3300025923 | Ga0207681_10025216 | Ga0207681_100252164 | 243 |
| 369 | 3300025926 | Ga0207659_10011834 | Ga0207659_100118347 | 243 |
| 370 | 3300025927 | Ga0207687_10065044 | Ga0207687_100650442 | 243 |
| 371 | 3300025927 | Ga0207687_10100888 | Ga0207687_101008882 | 243 |
| 372 | 3300025933 | Ga0207706_10006211 | Ga0207706_100062116 | 243 |
| 373 | 3300025933 | Ga0207706_10019872 | Ga0207706_100198723 | 243 |
| 374 | 3300025935 | Ga0207709_10048637 | Ga0207709_100486372 | 243 |
| 375 | 3300025938 | Ga0207704_10032069 | Ga0207704_100320694 | 243 |
| 376 | 3300025941 | Ga0207711_10004582 | Ga0207711_100045828 | 243 |
| 377 | 3300025942 | Ga0207689_10003664 | Ga0207689_100036647 | 243 |
| 378 | 3300025942 | Ga0207689_10035048 | Ga0207689_100350483 | 243 |
| 379 | 3300025945 | Ga0207679_10093087 | Ga0207679_100930872 | 243 |
| 380 | 3300025972 | Ga0207668_10020637 | Ga0207668_100206372 | 243 |
| 381 | 3300025972 | Ga0207668_10033710 | Ga0207668_100337104 | 243 |
| 382 | 3300025981 | Ga0207640_10049149 | Ga0207640_100491492 | 243 |
| 383 | 3300025981 | Ga0207640_10073760 | Ga0207640_100737603 | 243 |
| 384 | 3300025986 | Ga0207658_10016179 | Ga0207658_100161796 | 243 |
| 385 | 3300026023 | Ga0207677_10028700 | Ga0207677_100287004 | 243 |
| 386 | 3300026035 | Ga0207703_10036096 | Ga0207703_100360966 | 243 |
| 387 | 3300026041 | Ga0207639_10117864 | Ga0207639_101178642 | 243 |
| 388 | 3300026067 | Ga0207678_10040687 | Ga0207678_100406874 | 243 |
| 389 | 3300026067 | Ga0207678_10082065 | Ga0207678_100820654 | 243 |
| 390 | 3300026075 | Ga0207708_10012477 | Ga0207708_100124772 | 243 |
| 391 | 3300026088 | Ga0207641_10009103 | Ga0207641_100091034 | 243 |
| 392 | 3300026088 | Ga0207641_10019205 | Ga0207641_100192056 | 243 |
| 393 | 3300026095 | Ga0207676_10011582 | Ga0207676_100115823 | 243 |
| 394 | 3300026095 | Ga0207676_10254464 | Ga0207676_102544642 | 243 |
| 395 | 3300026118 | Ga0207675_100008151 | Ga0207675_1000081514 | 243 |
| 396 | 3300026118 | Ga0207675_100023191 | Ga0207675_1000231916 | 243 |
| 397 | 3300026121 | Ga0207683_10080603 | Ga0207683_100806035 | 243 |
| 398 | 3300026142 | Ga0207698_10016587 | Ga0207698_100165874 | 243 |
| 399 | 3300026142 | Ga0207698_10157641 | Ga0207698_101576413 | 243 |
| 400 | 3300027876 | Ga0209974_10001641 | Ga0209974_100016414 | 243 |
| 401 | 3300028381 | Ga0268264_10020755 | Ga0268264_100207552 | 243 |
| 402 | 3300028381 | Ga0268264_10206482 | Ga0268264_102064823 | 243 |
| 403 | 3300028794 | Ga0307515_10011495 | Ga0307515_1001149510 | 243 |
| 404 | 3300031456 | Ga0307513_10106681 | Ga0307513_101066812 | 243 |
| 405 | 3300031507 | Ga0307509_10197563 | Ga0307509_101975631 | 243 |
| 406 | 3300031616 | Ga0307508_10000216 | Ga0307508_1000021657 | 243 |
| 407 | 3300031649 | Ga0307514_10015854 | Ga0307514_100158547 | 243 |
| 408 | 3300033179 | Ga0307507_10058387 | Ga0307507_100583874 | 243 |
| 409 | 3300035090 | Ga0373949_0046589 | Ga0373949_0046589_186_1043 | 243 |
| 410 | 3300035691 | Ga0373931_0002695 | Ga0373931_0002695_2597_3454 | 243 |
| 411 | 3300041452 | Ga0451793_0320329 | Ga0451793_0320329_76_903 | 243 |
| 412 | 3300041452 | Ga0451793_0659484 | Ga0451793_0659484_110_937 | 243 |
| 413 | 3300045051 | Ga0451576_0212037 | Ga0451576_0212037_877_1734 | 243 |
| 414 | 3300046519 | Ga0495632_0035845 | Ga0495632_0035845_617_1444 | 243 |
| 415 | 3300046537 | Ga0495598_0048524 | Ga0495598_0048524_310_1137 | 243 |
| 416 | 3300048903 | Ga0496100_0004969 | Ga0496100_0004969_2414_3271 | 243 |
| 417 | 3300048907 | Ga0496104_0146090 | Ga0496104_0146090_1102_1959 | 243 |
| 418 | 3300048909 | Ga0496106_0025160 | Ga0496106_0025160_428_1285 | 243 |
| 419 | 3300048910 | Ga0496107_0003649 | Ga0496107_0003649_4735_5592 | 243 |
| 420 | 3300048912 | Ga0496109_0185242 | Ga0496109_0185242_629_1486 | 243 |
| 421 | 3300048913 | Ga0496110_0034479 | Ga0496110_0034479_2937_3794 | 243 |
| 422 | 3300048914 | Ga0496111_0246096 | Ga0496111_0246096_86_943 | 243 |
| 423 | 3300050490 | nmdc:mga03n38_164991_c1 | nmdc:mga03n38_164991_c1_15_842 | 243 |
| 424 | 3300050493 | nmdc:mga0k408_669_c1 | nmdc:mga0k408_669_c1_9010_9837 | 243 |
| 425 | 3300050496 | nmdc:mga07m45_52553_c1 | nmdc:mga07m45_52553_c1_427_1245 | 243 |
| 426 | 3300050496 | nmdc:mga07m45_6321_c1 | nmdc:mga07m45_6321_c1_2144_2971 | 243 |
| 427 | 3300053098 | Ga0500650_0046776 | Ga0500650_0046776_412_1239 | 243 |
| 428 | 3300053129 | Ga0500628_019472 | Ga0500628_019472_409_1236 | 243 |
| 429 | 3300053131 | Ga0500652_056670 | Ga0500652_056670_102_929 | 243 |
| 430 | 3300053139 | Ga0500568_0028336 | Ga0500568_0028336_1093_1920 | 243 |
| 431 | 3300053156 | Ga0500622_0000872 | Ga0500622_0000872_1131_1958 | 243 |
| 432 | 3300003215 | JGI25153J46596_10007545 | JGI25153J46596_100075456 | 244 |
| 433 | 3300005331 | Ga0070670_100026210 | Ga0070670_1000262102 | 244 |
| 434 | 3300005338 | Ga0068868_100060065 | Ga0068868_1000600654 | 244 |
| 435 | 3300005355 | Ga0070671_100008407 | Ga0070671_1000084076 | 244 |
| 436 | 3300005355 | Ga0070671_100020559 | Ga0070671_1000205595 | 244 |
| 437 | 3300005364 | Ga0070673_100321953 | Ga0070673_1003219532 | 244 |
| 438 | 3300005543 | Ga0070672_100047279 | Ga0070672_1000472794 | 244 |
| 439 | 3300005548 | Ga0070665_100104794 | Ga0070665_1001047944 | 244 |
| 440 | 3300005617 | Ga0068859_100101507 | Ga0068859_1001015072 | 244 |
| 441 | 3300005618 | Ga0068864_100104355 | Ga0068864_1001043554 | 244 |
| 442 | 3300005841 | Ga0068863_100040067 | Ga0068863_1000400676 | 244 |
| 443 | 3300005841 | Ga0068863_100154915 | Ga0068863_1001549152 | 244 |
| 444 | 3300005843 | Ga0068860_100182469 | Ga0068860_1001824692 | 244 |
| 445 | 3300006163 | Ga0070715_10179035 | Ga0070715_101790351 | 244 |
| 446 | 3300006237 | Ga0097621_100009144 | Ga0097621_1000091445 | 244 |
| 447 | 3300006358 | Ga0068871_100008132 | Ga0068871_1000081328 | 244 |
| 448 | 3300006931 | Ga0097620_100101507 | Ga0097620_1001015072 | 244 |
| 449 | 3300009098 | Ga0105245_10061239 | Ga0105245_100612391 | 244 |
| 450 | 3300009176 | Ga0105242_10129773 | Ga0105242_101297733 | 244 |
| 451 | 3300009177 | Ga0105248_10018942 | Ga0105248_100189423 | 244 |
| 452 | 3300009551 | Ga0105238_10016299 | Ga0105238_100162991 | 244 |
| 453 | 3300011119 | Ga0105246_10061627 | Ga0105246_100616273 | 244 |
| 454 | 3300013296 | Ga0157374_10040878 | Ga0157374_100408785 | 244 |
| 455 | 3300013296 | Ga0157374_10064219 | Ga0157374_100642195 | 244 |
| 456 | 3300013308 | Ga0157375_10005174 | Ga0157375_100051748 | 244 |
| 457 | 3300013308 | Ga0157375_10239083 | Ga0157375_102390832 | 244 |
| 458 | 3300014325 | Ga0163163_10313596 | Ga0163163_103135962 | 244 |
| 459 | 3300014968 | Ga0157379_10020334 | Ga0157379_100203347 | 244 |
| 460 | 3300014968 | Ga0157379_10350325 | Ga0157379_103503252 | 244 |
| 461 | 3300025893 | Ga0207682_10058226 | Ga0207682_100582261 | 244 |
| 462 | 3300025907 | Ga0207645_10082477 | Ga0207645_100824772 | 244 |
| 463 | 3300025931 | Ga0207644_10001757 | Ga0207644_100017578 | 244 |
| 464 | 3300025934 | Ga0207686_10174035 | Ga0207686_101740352 | 244 |
| 465 | 3300025940 | Ga0207691_10061268 | Ga0207691_100612684 | 244 |
| 466 | 3300025940 | Ga0207691_10131704 | Ga0207691_101317042 | 244 |
| 467 | 3300025941 | Ga0207711_10008794 | Ga0207711_100087948 | 244 |
| 468 | 3300025944 | Ga0207661_10203771 | Ga0207661_102037712 | 244 |
| 469 | 3300025960 | Ga0207651_10479793 | Ga0207651_104797931 | 244 |
| 470 | 3300025986 | Ga0207658_10552786 | Ga0207658_105527861 | 244 |
| 471 | 3300026088 | Ga0207641_10021621 | Ga0207641_100216215 | 244 |
| 472 | 3300026088 | Ga0207641_10059586 | Ga0207641_100595863 | 244 |
| 473 | 3300026089 | Ga0207648_10143164 | Ga0207648_101431642 | 244 |
| 474 | 3300026095 | Ga0207676_10033040 | Ga0207676_100330401 | 244 |
| 475 | 3300026095 | Ga0207676_10045595 | Ga0207676_100455954 | 244 |
| 476 | 3300026116 | Ga0207674_10159975 | Ga0207674_101599753 | 244 |
| 477 | 3300026121 | Ga0207683_10156000 | Ga0207683_101560002 | 244 |
| 478 | 3300028380 | Ga0268265_10106367 | Ga0268265_101063672 | 244 |
| 479 | 3300028380 | Ga0268265_10162748 | Ga0268265_101627482 | 244 |
| 480 | 3300046660 | Ga0495625_0004997 | Ga0495625_0004997_942_1793 | 244 |
| 481 | 3300048905 | Ga0496102_0002898 | Ga0496102_0002898_1594_2505 | 244 |
| 482 | 3300048915 | Ga0496112_0241198 | Ga0496112_0241198_210_1067 | 244 |
| 483 | 3300050494 | nmdc:mga06z11_215045_c1 | nmdc:mga06z11_215045_c1_25_774 | 244 |
| 484 | 3300003323 | rootH1_10004482 | rootH1_100044821 | 245 |
| 485 | 3300005335 | Ga0070666_10217538 | Ga0070666_102175381 | 245 |
| 486 | 3300005335 | Ga0070666_10229530 | Ga0070666_102295301 | 245 |
| 487 | 3300005367 | Ga0070667_100012357 | Ga0070667_1000123576 | 245 |
| 488 | 3300005455 | Ga0070663_100284977 | Ga0070663_1002849772 | 245 |
| 489 | 3300005459 | Ga0068867_100064789 | Ga0068867_1000647892 | 245 |
| 490 | 3300005468 | Ga0070707_100026153 | Ga0070707_1000261535 | 245 |
| 491 | 3300005539 | Ga0068853_100435425 | Ga0068853_1004354251 | 245 |
| 492 | 3300005543 | Ga0070672_100025769 | Ga0070672_1000257692 | 245 |
| 493 | 3300005616 | Ga0068852_100066202 | Ga0068852_1000662022 | 245 |
| 494 | 3300006195 | Ga0075366_10040736 | Ga0075366_100407363 | 245 |
| 495 | 3300006353 | Ga0075370_10024268 | Ga0075370_100242683 | 245 |
| 496 | 3300006358 | Ga0068871_100318388 | Ga0068871_1003183882 | 245 |
| 497 | 3300006881 | Ga0068865_100091208 | Ga0068865_1000912082 | 245 |
| 498 | 3300014326 | Ga0157380_10159855 | Ga0157380_101598552 | 245 |
| 499 | 3300014326 | Ga0157380_10363464 | Ga0157380_103634641 | 245 |
| 500 | 3300014968 | Ga0157379_10010130 | Ga0157379_100101308 | 245 |
| 501 | 3300025297 | Ga0209758_1000124 | Ga0209758_10001244 | 245 |
| 502 | 3300025903 | Ga0207680_10058549 | Ga0207680_100585492 | 245 |
| 503 | 3300025910 | Ga0207684_10003264 | Ga0207684_100032642 | 245 |
| 504 | 3300025925 | Ga0207650_10205477 | Ga0207650_102054772 | 245 |
| 505 | 3300025940 | Ga0207691_10044552 | Ga0207691_100445522 | 245 |
| 506 | 3300026041 | Ga0207639_10489276 | Ga0207639_104892761 | 245 |
| 507 | 3300026142 | Ga0207698_10245947 | Ga0207698_102459472 | 245 |
| 508 | 3300028381 | Ga0268264_10003375 | Ga0268264_100033756 | 245 |
| 509 | 3300044693 | Ga0466961_0187416 | Ga0466961_0187416_179_988 | 245 |
| 510 | 3300048905 | Ga0496102_0066858 | Ga0496102_0066858_106_1011 | 245 |
| 511 | iso_pu_bacteria | 2585428057 | 2587725241 | 245 |
| 512 | iso_pu_bacteria | 2585428058 | 2587731403 | 245 |
| 513 | 3300005616 | Ga0068852_100085162 | Ga0068852_1000851622 | 246 |
| 514 | 3300025923 | Ga0207681_10470868 | Ga0207681_104708682 | 246 |
| 515 | 3300050493 | nmdc:mga0k408_105924_c1 | nmdc:mga0k408_105924_c1_245_1096 | 246 |
| 516 | 3300053108 | Ga0500562_024019 | Ga0500562_024019_444_1280 | 246 |
| 517 | 3300031239 | Ga0265328_10013306 | Ga0265328_100133064 | 247 |
| 518 | 3300031456 | Ga0307513_10098065 | Ga0307513_100980654 | 247 |
| 519 | 3300031995 | Ga0307409_100131501 | Ga0307409_1001315013 | 247 |
| 520 | 3300032002 | Ga0307416_100061065 | Ga0307416_1000610654 | 247 |
| 521 | 3300050493 | nmdc:mga0k408_1245_c1 | nmdc:mga0k408_1245_c1_10198_11049 | 247 |
| 522 | 3300050494 | nmdc:mga06z11_2171_c1 | nmdc:mga06z11_2171_c1_6199_7050 | 247 |
| 523 | 3300053086 | Ga0500578_0000673 | Ga0500578_0000673_9420_10268 | 247 |
| 524 | 3300006195 | Ga0075366_10021753 | Ga0075366_100217535 | 248 |
| 525 | 3300044901 | Ga0466960_0184303 | Ga0466960_0184303_125_952 | 248 |
| 526 | 3300005548 | Ga0070665_100115538 | Ga0070665_1001155383 | 249 |
| 527 | 3300044658 | Ga0466972_0000594 | Ga0466972_0000594_11796_12605 | 249 |
| 528 | 3300044683 | Ga0466965_0040218 | Ga0466965_0040218_428_1237 | 249 |
| 529 | 3300044712 | Ga0453684_0020128 | Ga0453684_0020128_2053_2838 | 249 |
| 530 | 3300039450 | Ga0436363_0457939 | Ga0436363_0457939_1376_2242 | 250 |
| 531 | 3300028379 | Ga0268266_10072607 | Ga0268266_100726073 | 251 |
| 532 | 3300041463 | Ga0451804_0090619 | Ga0451804_0090619_209_1108 | 251 |
| 533 | 3300041486 | Ga0451807_0096601 | Ga0451807_0096601_350_1219 | 251 |
| 534 | 3300050496 | nmdc:mga07m45_3113_c1 | nmdc:mga07m45_3113_c1_473_1327 | 251 |
| 535 | 3300031903 | Ga0307407_10210016 | Ga0307407_102100161 | 253 |
| 536 | 3300037471 | Ga0395905_0285650 | Ga0395905_0285650_81_1013 | 253 |
| 537 | 3300025927 | Ga0207687_10329200 | Ga0207687_103292002 | 254 |
| 538 | 3300037471 | Ga0395905_0010653 | Ga0395905_0010653_7458_8258 | 255 |
| 539 | 3300044683 | Ga0466965_0040007 | Ga0466965_0040007_1085_1900 | 255 |
| 540 | 3300044719 | Ga0466971_0064726 | Ga0466971_0064726_420_1235 | 255 |
| 541 | 3300044765 | Ga0466970_0046815 | Ga0466970_0046815_927_1742 | 255 |
| 542 | 3300044842 | Ga0466957_0047364 | Ga0466957_0047364_1672_2487 | 255 |
| 543 | 3300045976 | Ga0466967_0291581 | Ga0466967_0291581_165_980 | 255 |
| 544 | 3300061719 | Ga0466962_0006584 | Ga0466962_0006584_3369_4184 | 255 |
| 545 | 3300005331 | Ga0070670_100099934 | Ga0070670_1000999343 | 259 |
| 546 | 3300005457 | Ga0070662_100001432 | Ga0070662_1000014326 | 259 |
| 547 | 3300025933 | Ga0207706_10001906 | Ga0207706_1000190612 | 259 |
| 548 | 3300002155 | JGI24033J26618_1014872 | JGI24033J26618_10148721 | 260 |
| 549 | 3300005328 | Ga0070676_10034601 | Ga0070676_100346013 | 260 |
| 550 | 3300005331 | Ga0070670_100021917 | Ga0070670_1000219173 | 260 |
| 551 | 3300005333 | Ga0070677_10054709 | Ga0070677_100547091 | 260 |
| 552 | 3300005334 | Ga0068869_100168989 | Ga0068869_1001689892 | 260 |
| 553 | 3300005335 | Ga0070666_10114353 | Ga0070666_101143532 | 260 |
| 554 | 3300005338 | Ga0068868_100046664 | Ga0068868_1000466642 | 260 |
| 555 | 3300005353 | Ga0070669_100050718 | Ga0070669_1000507183 | 260 |
| 556 | 3300005364 | Ga0070673_100002371 | Ga0070673_1000023718 | 260 |
| 557 | 3300005456 | Ga0070678_100006062 | Ga0070678_1000060623 | 260 |
| 558 | 3300005459 | Ga0068867_100005426 | Ga0068867_1000054265 | 260 |
| 559 | 3300005543 | Ga0070672_100026382 | Ga0070672_1000263824 | 260 |
| 560 | 3300005544 | Ga0070686_100082995 | Ga0070686_1000829953 | 260 |
| 561 | 3300005564 | Ga0070664_100343636 | Ga0070664_1003436361 | 260 |
| 562 | 3300005615 | Ga0070702_100169659 | Ga0070702_1001696591 | 260 |
| 563 | 3300005616 | Ga0068852_100187166 | Ga0068852_1001871662 | 260 |
| 564 | 3300005617 | Ga0068859_100357592 | Ga0068859_1003575922 | 260 |
| 565 | 3300005834 | Ga0068851_10008150 | Ga0068851_100081505 | 260 |
| 566 | 3300006237 | Ga0097621_100044849 | Ga0097621_1000448494 | 260 |
| 567 | 3300006358 | Ga0068871_100006200 | Ga0068871_1000062009 | 260 |
| 568 | 3300006931 | Ga0097620_100357572 | Ga0097620_1003575722 | 260 |
| 569 | 3300013296 | Ga0157374_10260256 | Ga0157374_102602562 | 260 |
| 570 | 3300013306 | Ga0163162_10271665 | Ga0163162_102716651 | 260 |
| 571 | 3300014745 | Ga0157377_10169007 | Ga0157377_101690071 | 260 |
| 572 | 3300014969 | Ga0157376_10077851 | Ga0157376_100778513 | 260 |
| 573 | 3300017792 | Ga0163161_10009331 | Ga0163161_100093316 | 260 |
| 574 | 3300025315 | Ga0207697_10003064 | Ga0207697_100030646 | 260 |
| 575 | 3300025893 | Ga0207682_10002801 | Ga0207682_100028013 | 260 |
| 576 | 3300025901 | Ga0207688_10058002 | Ga0207688_100580022 | 260 |
| 577 | 3300025907 | Ga0207645_10024932 | Ga0207645_100249324 | 260 |
| 578 | 3300025908 | Ga0207643_10084950 | Ga0207643_100849503 | 260 |
| 579 | 3300025923 | Ga0207681_10003514 | Ga0207681_100035146 | 260 |
| 580 | 3300025925 | Ga0207650_10001276 | Ga0207650_100012769 | 260 |
| 581 | 3300025926 | Ga0207659_10014054 | Ga0207659_100140544 | 260 |
| 582 | 3300025931 | Ga0207644_10000523 | Ga0207644_1000052316 | 260 |
| 583 | 3300025937 | Ga0207669_10016372 | Ga0207669_100163725 | 260 |
| 584 | 3300025940 | Ga0207691_10003381 | Ga0207691_1000338110 | 260 |
| 585 | 3300025945 | Ga0207679_10234094 | Ga0207679_102340941 | 260 |
| 586 | 3300025960 | Ga0207651_10014368 | Ga0207651_100143684 | 260 |
| 587 | 3300025981 | Ga0207640_10202395 | Ga0207640_102023952 | 260 |
| 588 | 3300026075 | Ga0207708_10233638 | Ga0207708_102336382 | 260 |
| 589 | 3300026089 | Ga0207648_10004239 | Ga0207648_100042395 | 260 |
| 590 | 3300026121 | Ga0207683_10083536 | Ga0207683_100835364 | 260 |
| 591 | 3300026142 | Ga0207698_10136893 | Ga0207698_101368931 | 260 |
| 592 | 3300031824 | Ga0307413_10057428 | Ga0307413_100574284 | 260 |
| 593 | 3300031824 | Ga0307413_10115720 | Ga0307413_101157203 | 260 |
| 594 | 3300031852 | Ga0307410_10138158 | Ga0307410_101381583 | 260 |
| 595 | 3300031901 | Ga0307406_10023123 | Ga0307406_100231234 | 260 |
| 596 | 3300031911 | Ga0307412_10027498 | Ga0307412_100274984 | 260 |
| 597 | 3300031995 | Ga0307409_100304806 | Ga0307409_1003048062 | 260 |
| 598 | 3300032005 | Ga0307411_10012282 | Ga0307411_100122824 | 260 |
| 599 | 3300032005 | Ga0307411_10016314 | Ga0307411_100163143 | 260 |
| 600 | 3300041458 | Ga0451798_0362761 | Ga0451798_0362761_275_1102 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8i8r-assembly1.cif.gz_D | cryo-em structure of ompc3-mlaa complex in msp2n2 nanodiscs | 0.764 | 38 | 228 |
| 5nuo-assembly1.cif.gz_D | structural basis for maintenance of bacterial outer membrane lipid asymmetry | 0.7607 | 38 | 232 |
| 5nuq-assembly1.cif.gz_H | structural basis for maintenance of bacterial outer membrane lipid asymmetry | 0.7598 | 38 | 232 |
| 5nuq-assembly1.cif.gz_H | structural basis for maintenance of bacterial outer membrane lipid asymmetry | 0.743 | 38 | 232 |
| 8i8r-assembly1.cif.gz_D | cryo-em structure of ompc3-mlaa complex in msp2n2 nanodiscs | 0.7413 | 38 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57935_5_362_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.3672 | 75 | 146 | 1.10.645.10 |
| 4zl5F00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3549 | 75 | 232 | 1.20.1260.10 |
| 2ib0B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.2958 | 72 | 204 | 1.20.1260.10 |
| 2ib0B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.292 | 72 | 204 | 1.20.1260.10 |
| 4zl5F00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.2811 | 75 | 232 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382TC89-F1-model_v4 | VacJ lipoprotein | 0.8969 | 34 | 216 |
GO:0016020
GO:0120010 |
| AF-A0A382TC89-F1-model_v4 | VacJ lipoprotein | 0.8831 | 34 | 216 |
GO:0016020
GO:0120010 |
| AF-A0A537E2Y9-F1-model_v4 | VacJ family lipoprotein | 0.8782 | 17 | 207 |
GO:0016020
GO:0120010 |
| AF-A0A3B8TRL5-F1-model_v4 | deleted | 0.8782 | 52 | 231 |
|
| AF-A0A3B8TRL5-F1-model_v4 | deleted | 0.8643 | 52 | 231 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar