F467951

General Info

Members Datasets Scaffolds Average Seq Length
600 231 1201 219

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100121040|Ga0070678_1001210401
Length 252
Sequence MMLLPQCREISFQCAGRFEKPARSTICNLTGVVCLHEMNNKILQLAKKLWDYHHVNHVLEPADCILALGSHDLRVAERAADLYLEGYAPILILSGGLGNFTKGLWTKSEADLFAEVAIKKGVPERDILIENKSSNTGENILFTQLLLKEKGLDPKRFIVVQKPYMERRSLATFKKHWPEKELMVTSPQISFEDYSNEEIPMERVINIMVGDLQRIHLYPEKGFQIYQEIPADVWQANEELIALGFDQHLVKE

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
231 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0
Rhizoplane 0.83
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100121040 3300005456 Bacteria 2064
2 JGI25406J46586_10000498 3300003203 Bacteria 18346
3 rootH2_10284087 3300003320 Bacteria 2605
4 rootL2_10121708 3300003322 Bacteria 2249
5 rootL2_10290662 3300003322 Bacteria 3166
6 rootH1_10020676 3300003316 Bacteria 5433
7 rootH1_10020676 3300003323 Bacteria 1403
8 JGI25160J50197_1030552 3300003354 Bacteria 1402
9 Ga0070658_10002739 3300005327 Bacteria 14664
10 Ga0070658_10031660 3300005327 Bacteria 4249
11 Ga0070658_10036250 3300005327 Bacteria 3975
12 Ga0070658_10168836 3300005327 Bacteria 1838
13 Ga0070676_10000105 3300005328 Bacteria 30184
14 Ga0070676_10002385 3300005328 Bacteria 9614
15 Ga0070676_10529999 3300005328 Unclassified 840
16 Ga0070683_100001519 3300005329 Bacteria 17932
17 Ga0070683_100022014 3300005329 Bacteria 5691
18 Ga0070683_100617522 3300005329 Bacteria 1038
19 Ga0070670_100087386 3300005331 Bacteria 2679
20 Ga0068869_100007650 3300005334 Bacteria 6919
21 Ga0068869_100055274 3300005334 Bacteria 2893
22 Ga0068869_100084719 3300005334 Bacteria 2373
23 Ga0068869_100143337 3300005334 Bacteria 1847
24 Ga0068869_100166213 3300005334 Bacteria 1721
25 Ga0070666_10003539 3300005335 Bacteria 9469
26 Ga0070680_100094021 3300005336 Bacteria 2484
27 Ga0070680_100095922 3300005336 Bacteria 2459
28 Ga0070682_100006246 3300005337 Bacteria 6682
29 Ga0070682_100081159 3300005337 Bacteria 2099
30 Ga0070682_100196342 3300005337 Bacteria 1421
31 Ga0068868_100002749 3300005338 Bacteria 12181
32 Ga0068868_100018083 3300005338 Bacteria 5262
33 Ga0068868_100021774 3300005338 Bacteria 4831
34 Ga0068868_100041604 3300005338 Bacteria 3580
35 Ga0068868_100128939 3300005338 Bacteria 2068
36 Ga0068868_100438202 3300005338 Bacteria 1134
37 Ga0070660_100106917 3300005339 Bacteria 2223
38 Ga0070660_100147545 3300005339 Bacteria 1890
39 Ga0070660_100232746 3300005339 Bacteria 1499
40 Ga0070660_100234395 3300005339 Bacteria 1494
41 Ga0070660_100366734 3300005339 Bacteria 1188
42 Ga0070689_100018257 3300005340 Bacteria 5164
43 Ga0070689_100025573 3300005340 Bacteria 4436
44 Ga0070689_100029503 3300005340 Bacteria 4153
45 Ga0070689_100323742 3300005340 Bacteria 1288
46 Ga0070691_10027523 3300005341 Bacteria 2653
47 Ga0070691_10144653 3300005341 Bacteria 1214
48 Ga0070687_100008324 3300005343 Bacteria 4386
49 Ga0070687_100045609 3300005343 Unclassified 2239
50 Ga0070687_100067921 3300005343 Bacteria 1904
51 Ga0070661_100061400 3300005344 Bacteria 2758
52 Ga0070661_100102767 3300005344 Bacteria 2128
53 Ga0070661_100142915 3300005344 Bacteria 1804
54 Ga0070668_100000189 3300005347 Bacteria 40304
55 Ga0070668_100102025 3300005347 Bacteria 2275
56 Ga0070668_100385647 3300005347 Bacteria 1193
57 Ga0070675_100328690 3300005354 Bacteria 1352
58 Ga0070675_100523149 3300005354 Bacteria 1070
59 Ga0070671_100030464 3300005355 Bacteria 4452
60 Ga0070671_100056261 3300005355 Bacteria 3273
61 Ga0070671_100114091 3300005355 Bacteria 2271
62 Ga0070674_100036680 3300005356 Bacteria 3293
63 Ga0070674_100046310 3300005356 Bacteria 2974
64 Ga0070673_100027847 3300005364 Bacteria 4194
65 Ga0070673_100104428 3300005364 Bacteria 2339
66 Ga0070673_100124169 3300005364 Bacteria 2158
67 Ga0070673_100125670 3300005364 Bacteria 2146
68 Ga0070673_100197045 3300005364 Bacteria 1733
69 Ga0070673_100412024 3300005364 Bacteria 1210
70 Ga0070688_100006297 3300005365 Bacteria 6334
71 Ga0070688_100012620 3300005365 Bacteria 4737
72 Ga0070659_100063006 3300005366 Bacteria 2932
73 Ga0070659_100186169 3300005366 Unclassified 1705
74 Ga0070659_100240653 3300005366 Bacteria 1498
75 Ga0070659_100795976 3300005366 Bacteria 822
76 Ga0070667_100001060 3300005367 Bacteria 25131
77 Ga0070667_100005714 3300005367 Bacteria 10394
78 Ga0070667_100036195 3300005367 Bacteria 4137
79 Ga0070667_100070866 3300005367 Bacteria 2968
80 Ga0070667_100116640 3300005367 Bacteria 2319
81 Ga0070705_100149273 3300005440 Bacteria 1549
82 Ga0070705_100239576 3300005440 Bacteria 1267
83 Ga0070700_100058531 3300005441 Bacteria 2421
84 Ga0070694_100173520 3300005444 Bacteria 1590
85 Ga0070694_100645359 3300005444 Unclassified 856
86 Ga0070663_100072392 3300005455 Bacteria 2511
87 Ga0070663_100224576 3300005455 Bacteria 1476
88 Ga0070663_100404477 3300005455 Bacteria 1117
89 Ga0070678_100010452 3300005456 Bacteria 5673
90 Ga0070678_100253261 3300005456 Unclassified 1477
91 Ga0070678_100263444 3300005456 Bacteria 1451
92 Ga0070662_100023305 3300005457 Bacteria 4251
93 Ga0070662_100036931 3300005457 Bacteria 3461
94 Ga0070662_100059205 3300005457 Bacteria 2790
95 Ga0070662_100200039 3300005457 Bacteria 1585
96 Ga0070681_10027177 3300005458 Bacteria 5754
97 Ga0070681_10070718 3300005458 Bacteria 3454
98 Ga0070681_10089198 3300005458 Bacteria 3035
99 Ga0070681_10149684 3300005458 Bacteria 2261
100 Ga0070681_10195589 3300005458 Bacteria 1941
101 Ga0070681_10317452 3300005458 Bacteria 1467
102 Ga0068867_100001612 3300005459 Bacteria 15673
103 Ga0068867_100001965 3300005459 Bacteria 14332
104 Ga0068867_100009942 3300005459 Bacteria 6701
105 Ga0068867_100081187 3300005459 Unclassified 2444
106 Ga0070685_10073643 3300005466 Bacteria 2030
107 Ga0070685_10198481 3300005466 Bacteria 1302
108 Ga0070685_10422140 3300005466 Unclassified 928
109 Ga0070706_100153131 3300005467 Bacteria 2152
110 Ga0070706_100458497 3300005467 Unclassified 1186
111 Ga0070707_100068533 3300005468 Bacteria 3415
112 Ga0070699_100083884 3300005518 Unclassified 2780
113 Ga0070699_100505608 3300005518 Bacteria 1098
114 Ga0070679_100000398 3300005530 Bacteria 37016
115 Ga0070679_100000575 3300005530 Bacteria 31162
116 Ga0070679_100014516 3300005530 Bacteria 7567
117 Ga0070679_100040400 3300005530 Bacteria 4641
118 Ga0070679_100066242 3300005530 Bacteria 3600
119 Ga0070679_100093818 3300005530 Bacteria 2988
120 Ga0070679_100209160 3300005530 Bacteria 1915
121 Ga0070684_100002578 3300005535 Bacteria 13385
122 Ga0070684_100117185 3300005535 Bacteria 2393
123 Ga0070684_100206665 3300005535 Bacteria 1789
124 Ga0070697_100277829 3300005536 Bacteria 1436
125 Ga0068853_100031172 3300005539 Bacteria 4509
126 Ga0068853_100112279 3300005539 Bacteria 2422
127 Ga0068853_100209532 3300005539 Bacteria 1776
128 Ga0068853_100358105 3300005539 Unclassified 1358
129 Ga0068853_100715117 3300005539 Bacteria 956
130 Ga0070672_100000795 3300005543 Bacteria 18799
131 Ga0070686_100164330 3300005544 Bacteria 1565
132 Ga0070695_100007851 3300005545 Bacteria 6321
133 Ga0070695_100193219 3300005545 Bacteria 1450
134 Ga0070696_100014627 3300005546 Bacteria 5268
135 Ga0070693_100070460 3300005547 Bacteria 2057
136 Ga0070665_100003694 3300005548 Bacteria 16208
137 Ga0070665_100147643 3300005548 Bacteria 2354
138 Ga0070665_100210466 3300005548 Bacteria 1945
139 Ga0070665_100461149 3300005548 Unclassified 1281
140 Ga0068855_100004470 3300005563 Bacteria 17094
141 Ga0068855_100027110 3300005563 Bacteria 6855
142 Ga0068855_100044821 3300005563 Bacteria 5233
143 Ga0068855_100114720 3300005563 Bacteria 3088
144 Ga0068855_100536186 3300005563 Bacteria 1268
145 Ga0068855_100647960 3300005563 Bacteria 1135
146 Ga0068855_101162887 3300005563 Bacteria 804
147 Ga0070664_100006938 3300005564 Bacteria 9127
148 Ga0070664_100009390 3300005564 Bacteria 7930
149 Ga0070664_100016869 3300005564 Bacteria 5993
150 Ga0070664_100023391 3300005564 Bacteria 5103
151 Ga0070664_100038267 3300005564 Bacteria 4037
152 Ga0070664_100371622 3300005564 Bacteria 1304
153 Ga0068857_100019349 3300005577 Bacteria 5977
154 Ga0068857_100033762 3300005577 Bacteria 4525
155 Ga0068857_100077839 3300005577 Unclassified 2960
156 Ga0068857_100112253 3300005577 Bacteria 2450
157 Ga0068857_100124149 3300005577 Bacteria 2326
158 Ga0068857_100378769 3300005577 Bacteria 1314
159 Ga0068857_100475304 3300005577 Bacteria 1171
160 Ga0068854_100061434 3300005578 Bacteria 2721
161 Ga0068854_100149102 3300005578 Bacteria 1802
162 Ga0068854_100219983 3300005578 Bacteria 1502
163 Ga0068854_100298858 3300005578 Bacteria 1302
164 Ga0068854_100450496 3300005578 Bacteria 1075
165 Ga0068856_100145159 3300005614 Bacteria 2381
166 Ga0068856_100215062 3300005614 Bacteria 1937
167 Ga0068856_100302037 3300005614 Bacteria 1618
168 Ga0068856_100701712 3300005614 Unclassified 1032
169 Ga0070702_100075769 3300005615 Bacteria 2000
170 Ga0070702_100319733 3300005615 Bacteria 1081
171 Ga0068852_100002787 3300005616 Bacteria 12105
172 Ga0068852_100010594 3300005616 Bacteria 6897
173 Ga0068852_100019977 3300005616 Bacteria 5318
174 Ga0068852_100382607 3300005616 Bacteria 1381
175 Ga0068852_100416112 3300005616 Bacteria 1325
176 Ga0068852_100567319 3300005616 Unclassified 1137
177 Ga0068859_100010349 3300005617 Bacteria 9386
178 Ga0068859_100084403 3300005617 Bacteria 3221
179 Ga0068859_100135626 3300005617 Unclassified 2534
180 Ga0068859_100693448 3300005617 Bacteria 1109
181 Ga0068859_101400647 3300005617 Bacteria 771
182 Ga0068864_100000441 3300005618 Bacteria 36073
183 Ga0068864_100004652 3300005618 Bacteria 11255
184 Ga0068864_100234323 3300005618 Bacteria 1699
185 Ga0068866_10166752 3300005718 Bacteria 1289
186 Ga0068866_10383944 3300005718 Bacteria 901
187 Ga0068861_100009427 3300005719 Bacteria 6739
188 Ga0068861_100010715 3300005719 Bacteria 6370
189 Ga0068861_100124421 3300005719 Bacteria 2084
190 Ga0068861_100192417 3300005719 Bacteria 1706
191 Ga0068851_10114688 3300005834 Bacteria 1442
192 Ga0068870_10281913 3300005840 Bacteria 1042
193 Ga0068863_100003174 3300005841 Bacteria 16254
194 Ga0068863_100103757 3300005841 Bacteria 2705
195 Ga0068858_100002665 3300005842 Bacteria 17956
196 Ga0068858_100011266 3300005842 Bacteria 8449
197 Ga0068858_100339058 3300005842 Unclassified 1438
198 Ga0068858_100484430 3300005842 Bacteria 1194
199 Ga0068860_100001075 3300005843 Bacteria 30099
200 Ga0068860_100396810 3300005843 Unclassified 1364
201 Ga0068860_101093717 3300005843 Bacteria 816
202 Ga0068862_100042844 3300005844 Bacteria 3857
203 Ga0068862_100081380 3300005844 Bacteria 2809
204 Ga0081539_10000708 3300005985 Bacteria 66782
205 Ga0075365_10053166 3300006038 Bacteria 2681
206 Ga0075368_10016646 3300006042 Bacteria 2742
207 Ga0075363_100015491 3300006048 Bacteria 3750
208 Ga0075364_10010737 3300006051 Bacteria 5541
209 Ga0075367_10007109 3300006178 Bacteria 5709
210 Ga0075366_10000078 3300006195 Bacteria 38200
211 Ga0097621_100001237 3300006237 Bacteria 17695
212 Ga0068871_100132856 3300006358 Bacteria 2111
213 Ga0068871_100250639 3300006358 Bacteria 1542
214 Ga0075428_100095242 3300006844 Bacteria 3245
215 Ga0075428_100684851 3300006844 Unclassified 1092
216 Ga0075430_100182597 3300006846 Bacteria 1745
217 Ga0075433_10074807 3300006852 Bacteria 2981
218 Ga0075434_100017024 3300006871 Bacteria 6994
219 Ga0075434_100483124 3300006871 Bacteria 1260
220 Ga0075434_100659936 3300006871 Unclassified 1064
221 Ga0075429_100102417 3300006880 Bacteria 2499
222 Ga0068865_100006455 3300006881 Bacteria 7154
223 Ga0068865_100448553 3300006881 Bacteria 1066
224 Ga0097620_100010349 3300006931 Bacteria 9386
225 Ga0097620_100084402 3300006931 Bacteria 3221
226 Ga0097620_100135629 3300006931 Unclassified 2534
227 Ga0097620_100693546 3300006931 Bacteria 1109
228 Ga0097620_101400649 3300006931 Bacteria 771
229 Ga0105240_10091050 3300009093 Bacteria 3727
230 Ga0105240_10482708 3300009093 Bacteria 1381
231 Ga0105240_10801989 3300009093 Bacteria 1020
232 Ga0111539_10000234 3300009094 Bacteria 66163
233 Ga0111539_10041153 3300009094 Bacteria 5557
234 Ga0111539_10113191 3300009094 Bacteria 3183
235 Ga0111539_10257045 3300009094 Bacteria 2034
236 Ga0105245_10292527 3300009098 Bacteria 1596
237 Ga0105247_10053843 3300009101 Bacteria 2483
238 Ga0114129_10034187 3300009147 Bacteria 7178
239 Ga0114129_10042079 3300009147 Bacteria 6433
240 Ga0114129_10060913 3300009147 Bacteria 5276
241 Ga0114129_10099519 3300009147 Bacteria 4024
242 Ga0114129_10393665 3300009147 Bacteria 1827
243 Ga0105243_10004665 3300009148 Bacteria 10794
244 Ga0105241_10000820 3300009174 Bacteria 23583
245 Ga0105241_10293181 3300009174 Bacteria 1393
246 Ga0105241_10519099 3300009174 Bacteria 1065
247 Ga0105241_10902369 3300009174 Bacteria 821
248 Ga0105242_10297933 3300009176 Bacteria 1471
249 Ga0105242_10563321 3300009176 Bacteria 1095
250 Ga0105248_10044301 3300009177 Bacteria 4991
251 Ga0105248_10911430 3300009177 Bacteria 992
252 Ga0105237_10027032 3300009545 Bacteria 5860
253 Ga0105237_10070282 3300009545 Unclassified 3497
254 Ga0105237_10225678 3300009545 Bacteria 1873
255 Ga0105237_10708028 3300009545 Bacteria 1013
256 Ga0105238_10097210 3300009551 Bacteria 2930
257 Ga0105249_10004646 3300009553 Bacteria 11857
258 Ga0105249_10206681 3300009553 Bacteria 1924
259 Ga0105239_10000370 3300010375 Bacteria 66106
260 Ga0105239_10003047 3300010375 Bacteria 20835
261 Ga0105239_10430687 3300010375 Bacteria 1495
262 Ga0105239_10794826 3300010375 Bacteria 1084
263 Ga0105246_10105341 3300011119 Bacteria 2061
264 Ga0157373_10004945 3300013100 Bacteria 10023
265 Ga0157373_10005201 3300013100 Bacteria 9776
266 Ga0157373_10006129 3300013100 Bacteria 8990
267 Ga0157373_10030796 3300013100 Bacteria 3860
268 Ga0157373_10037183 3300013100 Bacteria 3491
269 Ga0157373_10432368 3300013100 Bacteria 946
270 Ga0157371_10000178 3300013102 Bacteria 92872
271 Ga0157371_10002157 3300013102 Bacteria 19159
272 Ga0157371_10002541 3300013102 Bacteria 17330
273 Ga0157371_10018789 3300013102 Bacteria 5106
274 Ga0157371_10024252 3300013102 Bacteria 4432
275 Ga0157371_10025074 3300013102 Bacteria 4350
276 Ga0157371_10091054 3300013102 Bacteria 2160
277 Ga0157371_10131616 3300013102 Bacteria 1780
278 Ga0157371_10309127 3300013102 Bacteria 1145
279 Ga0157370_10001924 3300013104 Bacteria 25541
280 Ga0157370_10004426 3300013104 Bacteria 16098
281 Ga0157370_10097336 3300013104 Bacteria 2760
282 Ga0157370_10294513 3300013104 Bacteria 1499
283 Ga0157370_10333869 3300013104 Bacteria 1397
284 Ga0157369_10009321 3300013105 Bacteria 11225
285 Ga0157369_10054153 3300013105 Bacteria 4333
286 Ga0157369_10061089 3300013105 Bacteria 4063
287 Ga0157374_10007485 3300013296 Bacteria 9312
288 Ga0157374_10019045 3300013296 Bacteria 6072
289 Ga0157374_10155877 3300013296 Bacteria 2223
290 Ga0157374_10205482 3300013296 Unclassified 1930
291 Ga0157378_10010289 3300013297 Bacteria 8167
292 Ga0157378_10014883 3300013297 Bacteria 6807
293 Ga0157378_10027774 3300013297 Bacteria 4991
294 Ga0157378_10131798 3300013297 Bacteria 2314
295 Ga0163162_10000567 3300013306 Bacteria 34135
296 Ga0163162_10007848 3300013306 Bacteria 10400
297 Ga0163162_10023563 3300013306 Bacteria 6076
298 Ga0163162_10094828 3300013306 Bacteria 3071
299 Ga0163162_10138028 3300013306 Bacteria 2550
300 Ga0163162_10191366 3300013306 Bacteria 2174
301 Ga0163162_11373328 3300013306 Unclassified 803
302 Ga0157372_10015208 3300013307 Bacteria 8242
303 Ga0157372_10035714 3300013307 Bacteria 5473
304 Ga0157372_10056809 3300013307 Bacteria 4373
305 Ga0157372_10106462 3300013307 Bacteria 3207
306 Ga0157372_10129952 3300013307 Unclassified 2897
307 Ga0157372_10204959 3300013307 Bacteria 2285
308 Ga0157372_10295712 3300013307 Bacteria 1883
309 Ga0157372_10301426 3300013307 Bacteria 1864
310 Ga0157372_10358966 3300013307 Bacteria 1698
311 Ga0157372_10616215 3300013307 Bacteria 1265
312 Ga0157372_10621915 3300013307 Bacteria 1258
313 Ga0157372_10935565 3300013307 Bacteria 1005
314 Ga0157375_10017830 3300013308 Bacteria 6420
315 Ga0157375_10019594 3300013308 Bacteria 6157
316 Ga0157375_10026666 3300013308 Bacteria 5390
317 Ga0157375_10203663 3300013308 Bacteria 2135
318 Ga0157375_10381563 3300013308 Bacteria 1576
319 Ga0157375_11126845 3300013308 Bacteria 919
320 Ga0163163_10001667 3300014325 Bacteria 18724
321 Ga0163163_10002723 3300014325 Bacteria 14926
322 Ga0163163_10012596 3300014325 Bacteria 7712
323 Ga0163163_10101171 3300014325 Bacteria 2904
324 Ga0163163_10230533 3300014325 Bacteria 1901
325 Ga0163163_11337171 3300014325 Bacteria 778
326 Ga0157380_10002904 3300014326 Bacteria 11653
327 Ga0157380_10025329 3300014326 Bacteria 4499
328 Ga0157380_11070264 3300014326 Bacteria 844
329 Ga0157377_10009154 3300014745 Bacteria 4850
330 Ga0157377_10028575 3300014745 Bacteria 3002
331 Ga0157377_10097687 3300014745 Bacteria 1744
332 Ga0157379_10007535 3300014968 Bacteria 9421
333 Ga0157379_10083852 3300014968 Bacteria 2857
334 Ga0157376_10000630 3300014969 Bacteria 22861
335 Ga0163161_10104329 3300017792 Bacteria 2113
336 Ga0163161_10165554 3300017792 Bacteria 1688
337 Ga0163161_10254140 3300017792 Bacteria 1371
338 Ga0207426_1000132 3300025302 Bacteria 209623
339 Ga0207642_10240967 3300025899 Bacteria 1021
340 Ga0207680_10001073 3300025903 Bacteria 12895
341 Ga0207680_10265644 3300025903 Unclassified 1189
342 Ga0207680_10379251 3300025903 Bacteria 997
343 Ga0207647_10000358 3300025904 Bacteria 37132
344 Ga0207647_10017940 3300025904 Bacteria 4800
345 Ga0207647_10031931 3300025904 Bacteria 3387
346 Ga0207647_10150745 3300025904 Bacteria 1359
347 Ga0207647_10303523 3300025904 Unclassified 909
348 Ga0207645_10008267 3300025907 Bacteria 7274
349 Ga0207643_10108584 3300025908 Unclassified 1633
350 Ga0207705_10006816 3300025909 Bacteria 8441
351 Ga0207705_10072926 3300025909 Bacteria 2490
352 Ga0207705_10133450 3300025909 Bacteria 1849
353 Ga0207705_10430854 3300025909 Bacteria 1022
354 Ga0207684_10082403 3300025910 Bacteria 2739
355 Ga0207684_10089214 3300025910 Bacteria 2627
356 Ga0207654_10066109 3300025911 Bacteria 2132
357 Ga0207654_10114724 3300025911 Bacteria 1682
358 Ga0207654_10198390 3300025911 Bacteria 1320
359 Ga0207707_10000738 3300025912 Bacteria 32353
360 Ga0207707_10077101 3300025912 Bacteria 2909
361 Ga0207707_10150164 3300025912 Bacteria 2037
362 Ga0207707_10163568 3300025912 Bacteria 1945
363 Ga0207695_10093764 3300025913 Bacteria 3011
364 Ga0207695_10231117 3300025913 Bacteria 1754
365 Ga0207671_10038680 3300025914 Bacteria 3535
366 Ga0207671_10075141 3300025914 Unclassified 2526
367 Ga0207671_10218827 3300025914 Bacteria 1491
368 Ga0207660_10003448 3300025917 Bacteria 10319
369 Ga0207660_10014842 3300025917 Bacteria 5133
370 Ga0207662_10032441 3300025918 Bacteria 3041
371 Ga0207657_10000767 3300025919 Bacteria 34034
372 Ga0207657_10025764 3300025919 Bacteria 5417
373 Ga0207657_10084443 3300025919 Bacteria 2661
374 Ga0207657_10156921 3300025919 Bacteria 1850
375 Ga0207657_10365773 3300025919 Bacteria 1136
376 Ga0207649_10040184 3300025920 Bacteria 2841
377 Ga0207649_10275169 3300025920 Bacteria 1222
378 Ga0207652_10000051 3300025921 Bacteria 120327
379 Ga0207652_10005167 3300025921 Bacteria 10595
380 Ga0207652_10168931 3300025921 Bacteria 1962
381 Ga0207652_10251878 3300025921 Unclassified 1592
382 Ga0207652_10426122 3300025921 Bacteria 1196
383 Ga0207694_10254842 3300025924 Bacteria 1437
384 Ga0207650_10279698 3300025925 Bacteria 1358
385 Ga0207650_10459180 3300025925 Unclassified 1061
386 Ga0207659_10433514 3300025926 Unclassified 1104
387 Ga0207659_10966215 3300025926 Bacteria 733
388 Ga0207644_10079488 3300025931 Bacteria 2420
389 Ga0207644_10162883 3300025931 Bacteria 1735
390 Ga0207644_10638468 3300025931 Unclassified 886
391 Ga0207690_10006352 3300025932 Bacteria 7003
392 Ga0207706_10004231 3300025933 Bacteria 13522
393 Ga0207706_10014466 3300025933 Bacteria 7152
394 Ga0207706_10019761 3300025933 Bacteria 6058
395 Ga0207706_10031587 3300025933 Bacteria 4717
396 Ga0207706_10091260 3300025933 Bacteria 2678
397 Ga0207706_10197227 3300025933 Bacteria 1766
398 Ga0207686_10187601 3300025934 Bacteria 1471
399 Ga0207686_10608603 3300025934 Bacteria 861
400 Ga0207670_10136862 3300025936 Bacteria 1801
401 Ga0207670_10171440 3300025936 Unclassified 1627
402 Ga0207670_10260880 3300025936 Bacteria 1343
403 Ga0207670_10463465 3300025936 Bacteria 1023
404 Ga0207669_10023476 3300025937 Bacteria 3296
405 Ga0207704_10001685 3300025938 Bacteria 9898
406 Ga0207704_10358522 3300025938 Bacteria 1138
407 Ga0207691_10000010 3300025940 Bacteria 150194
408 Ga0207691_10008917 3300025940 Bacteria 9629
409 Ga0207691_10094356 3300025940 Bacteria 2678
410 Ga0207689_10006043 3300025942 Bacteria 10704
411 Ga0207689_10025625 3300025942 Bacteria 4942
412 Ga0207689_10036270 3300025942 Bacteria 4094
413 Ga0207661_10022435 3300025944 Bacteria 4755
414 Ga0207661_10060761 3300025944 Bacteria 3051
415 Ga0207661_10193569 3300025944 Bacteria 1784
416 Ga0207679_10017712 3300025945 Bacteria 4757
417 Ga0207679_10049940 3300025945 Bacteria 3054
418 Ga0207679_10091239 3300025945 Bacteria 2357
419 Ga0207679_10207947 3300025945 Bacteria 1639
420 Ga0207667_10011842 3300025949 Bacteria 10102
421 Ga0207667_10053988 3300025949 Bacteria 4227
422 Ga0207667_10154453 3300025949 Bacteria 2362
423 Ga0207667_10521161 3300025949 Unclassified 1204
424 Ga0207651_10000470 3300025960 Bacteria 17016
425 Ga0207651_10018691 3300025960 Bacteria 4133
426 Ga0207651_10449268 3300025960 Bacteria 1106
427 Ga0207651_10730776 3300025960 Bacteria 874
428 Ga0207712_10561356 3300025961 Bacteria 983
429 Ga0207668_10000674 3300025972 Bacteria 20969
430 Ga0207668_10025969 3300025972 Bacteria 3798
431 Ga0207668_10679513 3300025972 Bacteria 903
432 Ga0207640_10044978 3300025981 Unclassified 2832
433 Ga0207640_10101026 3300025981 Bacteria 2022
434 Ga0207640_10127668 3300025981 Bacteria 1833
435 Ga0207658_10001882 3300025986 Bacteria 15708
436 Ga0207658_10035983 3300025986 Bacteria 3549
437 Ga0207658_10300703 3300025986 Bacteria 1382
438 Ga0207658_10343599 3300025986 Unclassified 1298
439 Ga0207677_10002419 3300026023 Bacteria 9793
440 Ga0207677_10006283 3300026023 Bacteria 6503
441 Ga0207677_10029982 3300026023 Bacteria 3465
442 Ga0207677_10329503 3300026023 Bacteria 1272
443 Ga0207703_10001274 3300026035 Bacteria 23393
444 Ga0207703_10039737 3300026035 Bacteria 3761
445 Ga0207703_10094998 3300026035 Bacteria 2514
446 Ga0207703_10356023 3300026035 Bacteria 1349
447 Ga0207703_10408258 3300026035 Bacteria 1261
448 Ga0207703_10628660 3300026035 Bacteria 1017
449 Ga0207639_10015016 3300026041 Bacteria 5455
450 Ga0207639_10048405 3300026041 Bacteria 3218
451 Ga0207639_10091570 3300026041 Bacteria 2435
452 Ga0207639_10284848 3300026041 Unclassified 1455
453 Ga0207639_10529246 3300026041 Unclassified 1080
454 Ga0207639_10563926 3300026041 Unclassified 1047
455 Ga0207639_10896642 3300026041 Bacteria 829
456 Ga0207678_10004032 3300026067 Bacteria 13213
457 Ga0207678_10149956 3300026067 Bacteria 1991
458 Ga0207678_10197496 3300026067 Bacteria 1719
459 Ga0207678_10264052 3300026067 Bacteria 1476
460 Ga0207678_10305374 3300026067 Bacteria 1368
461 Ga0207678_10464596 3300026067 Bacteria 1101
462 Ga0207678_10960687 3300026067 Unclassified 756
463 Ga0207708_10048738 3300026075 Bacteria 3225
464 Ga0207708_10211555 3300026075 Bacteria 1550
465 Ga0207702_10020698 3300026078 Bacteria 5442
466 Ga0207702_10133785 3300026078 Bacteria 2235
467 Ga0207702_10473830 3300026078 Unclassified 1217
468 Ga0207648_10002433 3300026089 Bacteria 20028
469 Ga0207648_10020777 3300026089 Bacteria 5911
470 Ga0207648_10026319 3300026089 Bacteria 5171
471 Ga0207648_10168878 3300026089 Unclassified 1933
472 Ga0207648_10230597 3300026089 Bacteria 1647
473 Ga0207648_10773469 3300026089 Bacteria 893
474 Ga0207648_11017313 3300026089 Unclassified 776
475 Ga0207676_10026875 3300026095 Bacteria 4281
476 Ga0207674_10004429 3300026116 Bacteria 16885
477 Ga0207674_10131015 3300026116 Bacteria 2471
478 Ga0207674_10158414 3300026116 Bacteria 2219
479 Ga0207674_10172415 3300026116 Unclassified 2116
480 Ga0207674_10181511 3300026116 Bacteria 2056
481 Ga0207674_10255161 3300026116 Bacteria 1701
482 Ga0207675_100011132 3300026118 Bacteria 8427
483 Ga0207675_100018042 3300026118 Bacteria 6581
484 Ga0207675_100056419 3300026118 Bacteria 3664
485 Ga0207683_10113293 3300026121 Bacteria 2429
486 Ga0207683_10150085 3300026121 Bacteria 2103
487 Ga0207683_10232469 3300026121 Unclassified 1682
488 Ga0207683_10554115 3300026121 Bacteria 1063
489 Ga0207698_10014430 3300026142 Bacteria 5251
490 Ga0207698_10052360 3300026142 Unclassified 3127
491 Ga0207698_10097749 3300026142 Bacteria 2424
492 Ga0207698_10156312 3300026142 Bacteria 1987
493 Ga0207698_10175716 3300026142 Bacteria 1891
494 Ga0207698_10382194 3300026142 Bacteria 1340
495 Ga0207428_10000079 3300027907 Bacteria 136472
496 Ga0207428_10075452 3300027907 Bacteria 2642
497 Ga0207428_10194197 3300027907 Bacteria 1529
498 Ga0268266_10004570 3300028379 Bacteria 13224
499 Ga0268266_10058613 3300028379 Unclassified 3316
500 Ga0268266_10426899 3300028379 Bacteria 1257
501 Ga0268265_10342174 3300028380 Unclassified 1362
502 Ga0268265_10787898 3300028380 Bacteria 925
503 Ga0268264_10022558 3300028381 Bacteria 5137
504 Ga0307517_10002587 3300028786 Bacteria 28819
505 Ga0307515_10000001 3300028794 Bacteria 4259510
506 Ga0265327_10000395 3300031251 Bacteria 81944
507 Ga0307513_10537116 3300031456 Bacteria 883
508 Ga0373931_0349916 3300035691 Bacteria 925
509 Ga0373925_0637505 3300037068 Bacteria 878
510 Ga0395899_0010404 3300037312 Bacteria 7129
511 Ga0395899_0031956 3300037312 Bacteria 3954
512 Ga0395899_0048414 3300037312 Bacteria 3163
513 Ga0395899_0080124 3300037312 Bacteria 2377
514 Ga0395900_0002306 3300037418 Bacteria 21189
515 Ga0395900_0016501 3300037418 Bacteria 7532
516 Ga0395900_0046112 3300037418 Bacteria 4488
517 Ga0395900_0250297 3300037418 Bacteria 1773
518 Ga0395900_0282986 3300037418 Bacteria 1649
519 Ga0395898_0001447 3300037466 Bacteria 33615
520 Ga0395898_0118991 3300037466 Bacteria 2530
521 Ga0395898_0168696 3300037466 Bacteria 2092
522 Ga0395898_0171578 3300037466 Bacteria 2073
523 Ga0395898_0228609 3300037466 Bacteria 1774
524 Ga0395898_0520659 3300037466 Unclassified 1130
525 Ga0395905_0057241 3300037471 Bacteria 3647
526 Ga0395901_0001349 3300038443 Bacteria 25743
527 Ga0395901_0060887 3300038443 Bacteria 3928
528 Ga0395901_0083341 3300038443 Bacteria 3342
529 Ga0395901_0520760 3300038443 Bacteria 1208
530 Ga0450892_008792 3300042130 Bacteria 867
531 Ga0451577_0004314 3300042876 Bacteria 15097
532 Ga0466969_0006579 3300044656 Bacteria 6178
533 Ga0466972_0000010 3300044658 Bacteria 256339
534 Ga0453683_0458137 3300044673 Bacteria 825
535 Ga0453683_0481697 3300044673 Bacteria 804
536 Ga0466966_0000053 3300044684 Bacteria 84809
537 Ga0453684_0014752 3300044712 Bacteria 12456
538 Ga0466970_0057704 3300044765 Bacteria 2076
539 Ga0466957_0158002 3300044842 Unclassified 1471
540 Ga0466959_0000005 3300045049 Bacteria 213958
541 Ga0451576_0001124 3300045051 Bacteria 48656
542 Ga0451576_0075568 3300045051 Bacteria 3506
543 Ga0466967_0378003 3300045976 Bacteria 1375
544 Ga0495638_0041444 3300046460 Bacteria 2913
545 Ga0495643_0089006 3300046522 Bacteria 1595
546 Ga0495625_0335060 3300046660 Bacteria 960
547 Ga0495674_0314774 3300047319 Bacteria 1276
548 Ga0495672_0228759 3300047320 Bacteria 914
549 Ga0495677_0114151 3300047445 Unclassified 1028
550 Ga0496104_0290325 3300048907 Unclassified 1548
551 Ga0496108_0159164 3300048911 Bacteria 1951
552 Ga0496110_0607960 3300048913 Bacteria 991
553 Ga0496111_0067436 3300048914 Bacteria 2600
554 Ga0496115_0179940 3300048918 Bacteria 1748
555 Ga0496124_0359786 3300048927 Bacteria 1026
556 Ga0501034_0046484 3300049571 Bacteria 4385
557 Ga0501034_0272937 3300049571 Bacteria 1632
558 Ga0501034_0461225 3300049571 Bacteria 1187
559 Ga0501036_0541015 3300049572 Bacteria 968
560 Ga0501043_0023646 3300049579 Bacteria 4820
561 Ga0501047_0351932 3300049581 Bacteria 1310
562 Ga0501067_0054669 3300049583 Bacteria 2212
563 Ga0501070_0092397 3300049586 Bacteria 2504
564 Ga0501072_0269056 3300049588 Unclassified 1356
565 Ga0501075_0265528 3300049591 Bacteria 1308
566 Ga0501076_0807575 3300049592 Unclassified 774
567 Ga0501225_0025254 3300049705 Unclassified 1635
568 Ga0501079_0274025 3300049741 Bacteria 1319
569 Ga0501079_0612267 3300049741 Bacteria 857
570 Ga0501080_0175311 3300049742 Bacteria 1975
571 Ga0501035_0629131 3300049822 Unclassified 872
572 Ga0501044_0264310 3300049823 Bacteria 1658
573 nmdc:mga00v17_273289_c1 3300050491 Unclassified 1097
574 nmdc:mga0yw44_5060_c1 3300050492 Bacteria 6157
575 nmdc:mga0k408_73_c1 3300050493 Bacteria 47723
576 nmdc:mga06z11_184495_c1 3300050494 Bacteria 1205
577 nmdc:mga05p37_118482_c1 3300050507 Bacteria 3253
578 nmdc:mga05p37_131128_c1 3300050507 Unclassified 3075
579 nmdc:mga05p37_1882_c2 3300050507 Bacteria 12283
580 nmdc:mga05p37_345328_c1 3300050507 Bacteria 1754
581 nmdc:mga05p37_597338_c1 3300050507 Bacteria 1247
582 nmdc:mga09592_44614_c1 3300050508 Bacteria 3733
583 nmdc:mga06r32_168385_c1 3300050510 Bacteria 2174
584 nmdc:mga06r32_23757_c1 3300050510 Bacteria 5678
585 nmdc:mga08y16_108792_c1 3300050511 Bacteria 2886
586 nmdc:mga08y16_113636_c1 3300050511 Bacteria 2819
587 nmdc:mga08y16_377_c1 3300050511 Bacteria 40560
588 nmdc:mga0n895_31726_c1 3300050512 Bacteria 5062
589 nmdc:mga0n895_66981_c1 3300050512 Bacteria 3555
590 nmdc:mga0n895_90756_c1 3300050512 Bacteria 3057
591 nmdc:mga0rr50_911135_c1 3300050513 Unclassified 749
592 nmdc:mga0a205_28504_c1 3300050515 Bacteria 5340
593 nmdc:mga0a205_48237_c1 3300050515 Bacteria 4110
594 Ga0500655_014191 3300053133 Unclassified 1457
595 Ga0500588_0010214 3300053146 Bacteria 2259
596 Ga0500622_0005910 3300053156 Bacteria 7217
597 Ga0500637_0078810 3300053178 Unclassified 1902
598 Ga0501084_0112806 3300054114 Bacteria 2284
599 Ga0501084_0477019 3300054114 Unclassified 1054
600 2910246912 2910245624 Bacteria 6935613
601 2929156723 2929154850 Bacteria 6753285
602 Ga0070678_100121040
603 JGI25406J46586_10000498
604 rootH2_10284087
605 rootL2_10121708
606 rootL2_10290662
607 rootH1_10020676
608 JGI25160J50197_1030552
609 Ga0070658_10002739
610 Ga0070658_10031660
611 Ga0070658_10036250
612 Ga0070658_10168836
613 Ga0070676_10000105
614 Ga0070676_10002385
615 Ga0070676_10529999
616 Ga0070683_100001519
617 Ga0070683_100022014
618 Ga0070683_100617522
619 Ga0070670_100087386
620 Ga0068869_100007650
621 Ga0068869_100055274
622 Ga0068869_100084719
623 Ga0068869_100143337
624 Ga0068869_100166213
625 Ga0070666_10003539
626 Ga0070680_100094021
627 Ga0070680_100095922
628 Ga0070682_100006246
629 Ga0070682_100081159
630 Ga0070682_100196342
631 Ga0068868_100002749
632 Ga0068868_100018083
633 Ga0068868_100021774
634 Ga0068868_100041604
635 Ga0068868_100128939
636 Ga0068868_100438202
637 Ga0070660_100106917
638 Ga0070660_100147545
639 Ga0070660_100232746
640 Ga0070660_100234395
641 Ga0070660_100366734
642 Ga0070689_100018257
643 Ga0070689_100025573
644 Ga0070689_100029503
645 Ga0070689_100323742
646 Ga0070691_10027523
647 Ga0070691_10144653
648 Ga0070687_100008324
649 Ga0070687_100045609
650 Ga0070687_100067921
651 Ga0070661_100061400
652 Ga0070661_100102767
653 Ga0070661_100142915
654 Ga0070668_100000189
655 Ga0070668_100102025
656 Ga0070668_100385647
657 Ga0070675_100328690
658 Ga0070675_100523149
659 Ga0070671_100030464
660 Ga0070671_100056261
661 Ga0070671_100114091
662 Ga0070674_100036680
663 Ga0070674_100046310
664 Ga0070673_100027847
665 Ga0070673_100104428
666 Ga0070673_100124169
667 Ga0070673_100125670
668 Ga0070673_100197045
669 Ga0070673_100412024
670 Ga0070688_100006297
671 Ga0070688_100012620
672 Ga0070659_100063006
673 Ga0070659_100186169
674 Ga0070659_100240653
675 Ga0070659_100795976
676 Ga0070667_100001060
677 Ga0070667_100005714
678 Ga0070667_100036195
679 Ga0070667_100070866
680 Ga0070667_100116640
681 Ga0070705_100149273
682 Ga0070705_100239576
683 Ga0070700_100058531
684 Ga0070694_100173520
685 Ga0070694_100645359
686 Ga0070663_100072392
687 Ga0070663_100224576
688 Ga0070663_100404477
689 Ga0070678_100010452
690 Ga0070678_100253261
691 Ga0070678_100263444
692 Ga0070662_100023305
693 Ga0070662_100036931
694 Ga0070662_100059205
695 Ga0070662_100200039
696 Ga0070681_10027177
697 Ga0070681_10070718
698 Ga0070681_10089198
699 Ga0070681_10149684
700 Ga0070681_10195589
701 Ga0070681_10317452
702 Ga0068867_100001612
703 Ga0068867_100001965
704 Ga0068867_100009942
705 Ga0068867_100081187
706 Ga0070685_10073643
707 Ga0070685_10198481
708 Ga0070685_10422140
709 Ga0070706_100153131
710 Ga0070706_100458497
711 Ga0070707_100068533
712 Ga0070699_100083884
713 Ga0070699_100505608
714 Ga0070679_100000398
715 Ga0070679_100000575
716 Ga0070679_100014516
717 Ga0070679_100040400
718 Ga0070679_100066242
719 Ga0070679_100093818
720 Ga0070679_100209160
721 Ga0070684_100002578
722 Ga0070684_100117185
723 Ga0070684_100206665
724 Ga0070697_100277829
725 Ga0068853_100031172
726 Ga0068853_100112279
727 Ga0068853_100209532
728 Ga0068853_100358105
729 Ga0068853_100715117
730 Ga0070672_100000795
731 Ga0070686_100164330
732 Ga0070695_100007851
733 Ga0070695_100193219
734 Ga0070696_100014627
735 Ga0070693_100070460
736 Ga0070665_100003694
737 Ga0070665_100147643
738 Ga0070665_100210466
739 Ga0070665_100461149
740 Ga0068855_100004470
741 Ga0068855_100027110
742 Ga0068855_100044821
743 Ga0068855_100114720
744 Ga0068855_100536186
745 Ga0068855_100647960
746 Ga0068855_101162887
747 Ga0070664_100006938
748 Ga0070664_100009390
749 Ga0070664_100016869
750 Ga0070664_100023391
751 Ga0070664_100038267
752 Ga0070664_100371622
753 Ga0068857_100019349
754 Ga0068857_100033762
755 Ga0068857_100077839
756 Ga0068857_100112253
757 Ga0068857_100124149
758 Ga0068857_100378769
759 Ga0068857_100475304
760 Ga0068854_100061434
761 Ga0068854_100149102
762 Ga0068854_100219983
763 Ga0068854_100298858
764 Ga0068854_100450496
765 Ga0068856_100145159
766 Ga0068856_100215062
767 Ga0068856_100302037
768 Ga0068856_100701712
769 Ga0070702_100075769
770 Ga0070702_100319733
771 Ga0068852_100002787
772 Ga0068852_100010594
773 Ga0068852_100019977
774 Ga0068852_100382607
775 Ga0068852_100416112
776 Ga0068852_100567319
777 Ga0068859_100010349
778 Ga0068859_100084403
779 Ga0068859_100135626
780 Ga0068859_100693448
781 Ga0068859_101400647
782 Ga0068864_100000441
783 Ga0068864_100004652
784 Ga0068864_100234323
785 Ga0068866_10166752
786 Ga0068866_10383944
787 Ga0068861_100009427
788 Ga0068861_100010715
789 Ga0068861_100124421
790 Ga0068861_100192417
791 Ga0068851_10114688
792 Ga0068870_10281913
793 Ga0068863_100003174
794 Ga0068863_100103757
795 Ga0068858_100002665
796 Ga0068858_100011266
797 Ga0068858_100339058
798 Ga0068858_100484430
799 Ga0068860_100001075
800 Ga0068860_100396810
801 Ga0068860_101093717
802 Ga0068862_100042844
803 Ga0068862_100081380
804 Ga0081539_10000708
805 Ga0075365_10053166
806 Ga0075368_10016646
807 Ga0075363_100015491
808 Ga0075364_10010737
809 Ga0075367_10007109
810 Ga0075366_10000078
811 Ga0097621_100001237
812 Ga0068871_100132856
813 Ga0068871_100250639
814 Ga0075428_100095242
815 Ga0075428_100684851
816 Ga0075430_100182597
817 Ga0075433_10074807
818 Ga0075434_100017024
819 Ga0075434_100483124
820 Ga0075434_100659936
821 Ga0075429_100102417
822 Ga0068865_100006455
823 Ga0068865_100448553
824 Ga0097620_100010349
825 Ga0097620_100084402
826 Ga0097620_100135629
827 Ga0097620_100693546
828 Ga0097620_101400649
829 Ga0105240_10091050
830 Ga0105240_10482708
831 Ga0105240_10801989
832 Ga0111539_10000234
833 Ga0111539_10041153
834 Ga0111539_10113191
835 Ga0111539_10257045
836 Ga0105245_10292527
837 Ga0105247_10053843
838 Ga0114129_10034187
839 Ga0114129_10042079
840 Ga0114129_10060913
841 Ga0114129_10099519
842 Ga0114129_10393665
843 Ga0105243_10004665
844 Ga0105241_10000820
845 Ga0105241_10293181
846 Ga0105241_10519099
847 Ga0105241_10902369
848 Ga0105242_10297933
849 Ga0105242_10563321
850 Ga0105248_10044301
851 Ga0105248_10911430
852 Ga0105237_10027032
853 Ga0105237_10070282
854 Ga0105237_10225678
855 Ga0105237_10708028
856 Ga0105238_10097210
857 Ga0105249_10004646
858 Ga0105249_10206681
859 Ga0105239_10000370
860 Ga0105239_10003047
861 Ga0105239_10430687
862 Ga0105239_10794826
863 Ga0105246_10105341
864 Ga0157373_10004945
865 Ga0157373_10005201
866 Ga0157373_10006129
867 Ga0157373_10030796
868 Ga0157373_10037183
869 Ga0157373_10432368
870 Ga0157371_10000178
871 Ga0157371_10002157
872 Ga0157371_10002541
873 Ga0157371_10018789
874 Ga0157371_10024252
875 Ga0157371_10025074
876 Ga0157371_10091054
877 Ga0157371_10131616
878 Ga0157371_10309127
879 Ga0157370_10001924
880 Ga0157370_10004426
881 Ga0157370_10097336
882 Ga0157370_10294513
883 Ga0157370_10333869
884 Ga0157369_10009321
885 Ga0157369_10054153
886 Ga0157369_10061089
887 Ga0157374_10007485
888 Ga0157374_10019045
889 Ga0157374_10155877
890 Ga0157374_10205482
891 Ga0157378_10010289
892 Ga0157378_10014883
893 Ga0157378_10027774
894 Ga0157378_10131798
895 Ga0163162_10000567
896 Ga0163162_10007848
897 Ga0163162_10023563
898 Ga0163162_10094828
899 Ga0163162_10138028
900 Ga0163162_10191366
901 Ga0163162_11373328
902 Ga0157372_10015208
903 Ga0157372_10035714
904 Ga0157372_10056809
905 Ga0157372_10106462
906 Ga0157372_10129952
907 Ga0157372_10204959
908 Ga0157372_10295712
909 Ga0157372_10301426
910 Ga0157372_10358966
911 Ga0157372_10616215
912 Ga0157372_10621915
913 Ga0157372_10935565
914 Ga0157375_10017830
915 Ga0157375_10019594
916 Ga0157375_10026666
917 Ga0157375_10203663
918 Ga0157375_10381563
919 Ga0157375_11126845
920 Ga0163163_10001667
921 Ga0163163_10002723
922 Ga0163163_10012596
923 Ga0163163_10101171
924 Ga0163163_10230533
925 Ga0163163_11337171
926 Ga0157380_10002904
927 Ga0157380_10025329
928 Ga0157380_11070264
929 Ga0157377_10009154
930 Ga0157377_10028575
931 Ga0157377_10097687
932 Ga0157379_10007535
933 Ga0157379_10083852
934 Ga0157376_10000630
935 Ga0163161_10104329
936 Ga0163161_10165554
937 Ga0163161_10254140
938 Ga0207426_1000132
939 Ga0207642_10240967
940 Ga0207680_10001073
941 Ga0207680_10265644
942 Ga0207680_10379251
943 Ga0207647_10000358
944 Ga0207647_10017940
945 Ga0207647_10031931
946 Ga0207647_10150745
947 Ga0207647_10303523
948 Ga0207645_10008267
949 Ga0207643_10108584
950 Ga0207705_10006816
951 Ga0207705_10072926
952 Ga0207705_10133450
953 Ga0207705_10430854
954 Ga0207684_10082403
955 Ga0207684_10089214
956 Ga0207654_10066109
957 Ga0207654_10114724
958 Ga0207654_10198390
959 Ga0207707_10000738
960 Ga0207707_10077101
961 Ga0207707_10150164
962 Ga0207707_10163568
963 Ga0207695_10093764
964 Ga0207695_10231117
965 Ga0207671_10038680
966 Ga0207671_10075141
967 Ga0207671_10218827
968 Ga0207660_10003448
969 Ga0207660_10014842
970 Ga0207662_10032441
971 Ga0207657_10000767
972 Ga0207657_10025764
973 Ga0207657_10084443
974 Ga0207657_10156921
975 Ga0207657_10365773
976 Ga0207649_10040184
977 Ga0207649_10275169
978 Ga0207652_10000051
979 Ga0207652_10005167
980 Ga0207652_10168931
981 Ga0207652_10251878
982 Ga0207652_10426122
983 Ga0207694_10254842
984 Ga0207650_10279698
985 Ga0207650_10459180
986 Ga0207659_10433514
987 Ga0207659_10966215
988 Ga0207644_10079488
989 Ga0207644_10162883
990 Ga0207644_10638468
991 Ga0207690_10006352
992 Ga0207706_10004231
993 Ga0207706_10014466
994 Ga0207706_10019761
995 Ga0207706_10031587
996 Ga0207706_10091260
997 Ga0207706_10197227
998 Ga0207686_10187601
999 Ga0207686_10608603
1000 Ga0207670_10136862
1001 Ga0207670_10171440
1002 Ga0207670_10260880
1003 Ga0207670_10463465
1004 Ga0207669_10023476
1005 Ga0207704_10001685
1006 Ga0207704_10358522
1007 Ga0207691_10000010
1008 Ga0207691_10008917
1009 Ga0207691_10094356
1010 Ga0207689_10006043
1011 Ga0207689_10025625
1012 Ga0207689_10036270
1013 Ga0207661_10022435
1014 Ga0207661_10060761
1015 Ga0207661_10193569
1016 Ga0207679_10017712
1017 Ga0207679_10049940
1018 Ga0207679_10091239
1019 Ga0207679_10207947
1020 Ga0207667_10011842
1021 Ga0207667_10053988
1022 Ga0207667_10154453
1023 Ga0207667_10521161
1024 Ga0207651_10000470
1025 Ga0207651_10018691
1026 Ga0207651_10449268
1027 Ga0207651_10730776
1028 Ga0207712_10561356
1029 Ga0207668_10000674
1030 Ga0207668_10025969
1031 Ga0207668_10679513
1032 Ga0207640_10044978
1033 Ga0207640_10101026
1034 Ga0207640_10127668
1035 Ga0207658_10001882
1036 Ga0207658_10035983
1037 Ga0207658_10300703
1038 Ga0207658_10343599
1039 Ga0207677_10002419
1040 Ga0207677_10006283
1041 Ga0207677_10029982
1042 Ga0207677_10329503
1043 Ga0207703_10001274
1044 Ga0207703_10039737
1045 Ga0207703_10094998
1046 Ga0207703_10356023
1047 Ga0207703_10408258
1048 Ga0207703_10628660
1049 Ga0207639_10015016
1050 Ga0207639_10048405
1051 Ga0207639_10091570
1052 Ga0207639_10284848
1053 Ga0207639_10529246
1054 Ga0207639_10563926
1055 Ga0207639_10896642
1056 Ga0207678_10004032
1057 Ga0207678_10149956
1058 Ga0207678_10197496
1059 Ga0207678_10264052
1060 Ga0207678_10305374
1061 Ga0207678_10464596
1062 Ga0207678_10960687
1063 Ga0207708_10048738
1064 Ga0207708_10211555
1065 Ga0207702_10020698
1066 Ga0207702_10133785
1067 Ga0207702_10473830
1068 Ga0207648_10002433
1069 Ga0207648_10020777
1070 Ga0207648_10026319
1071 Ga0207648_10168878
1072 Ga0207648_10230597
1073 Ga0207648_10773469
1074 Ga0207648_11017313
1075 Ga0207676_10026875
1076 Ga0207674_10004429
1077 Ga0207674_10131015
1078 Ga0207674_10158414
1079 Ga0207674_10172415
1080 Ga0207674_10181511
1081 Ga0207674_10255161
1082 Ga0207675_100011132
1083 Ga0207675_100018042
1084 Ga0207675_100056419
1085 Ga0207683_10113293
1086 Ga0207683_10150085
1087 Ga0207683_10232469
1088 Ga0207683_10554115
1089 Ga0207698_10014430
1090 Ga0207698_10052360
1091 Ga0207698_10097749
1092 Ga0207698_10156312
1093 Ga0207698_10175716
1094 Ga0207698_10382194
1095 Ga0207428_10000079
1096 Ga0207428_10075452
1097 Ga0207428_10194197
1098 Ga0268266_10004570
1099 Ga0268266_10058613
1100 Ga0268266_10426899
1101 Ga0268265_10342174
1102 Ga0268265_10787898
1103 Ga0268264_10022558
1104 Ga0307517_10002587
1105 Ga0307515_10000001
1106 Ga0265327_10000395
1107 Ga0307513_10537116
1108 Ga0373931_0349916
1109 Ga0373925_0637505
1110 Ga0395899_0010404
1111 Ga0395899_0031956
1112 Ga0395899_0048414
1113 Ga0395899_0080124
1114 Ga0395900_0002306
1115 Ga0395900_0016501
1116 Ga0395900_0046112
1117 Ga0395900_0250297
1118 Ga0395900_0282986
1119 Ga0395898_0001447
1120 Ga0395898_0118991
1121 Ga0395898_0168696
1122 Ga0395898_0171578
1123 Ga0395898_0228609
1124 Ga0395898_0520659
1125 Ga0395905_0057241
1126 Ga0395901_0001349
1127 Ga0395901_0060887
1128 Ga0395901_0083341
1129 Ga0395901_0520760
1130 Ga0450892_008792
1131 Ga0451577_0004314
1132 Ga0466969_0006579
1133 Ga0466972_0000010
1134 Ga0453683_0458137
1135 Ga0453683_0481697
1136 Ga0466966_0000053
1137 Ga0453684_0014752
1138 Ga0466970_0057704
1139 Ga0466957_0158002
1140 Ga0466959_0000005
1141 Ga0451576_0001124
1142 Ga0451576_0075568
1143 Ga0466967_0378003
1144 Ga0495638_0041444
1145 Ga0495643_0089006
1146 Ga0495625_0335060
1147 Ga0495674_0314774
1148 Ga0495672_0228759
1149 Ga0495677_0114151
1150 Ga0496104_0290325
1151 Ga0496108_0159164
1152 Ga0496110_0607960
1153 Ga0496111_0067436
1154 Ga0496115_0179940
1155 Ga0496124_0359786
1156 Ga0501034_0046484
1157 Ga0501034_0272937
1158 Ga0501034_0461225
1159 Ga0501036_0541015
1160 Ga0501043_0023646
1161 Ga0501047_0351932
1162 Ga0501067_0054669
1163 Ga0501070_0092397
1164 Ga0501072_0269056
1165 Ga0501075_0265528
1166 Ga0501076_0807575
1167 Ga0501225_0025254
1168 Ga0501079_0274025
1169 Ga0501079_0612267
1170 Ga0501080_0175311
1171 Ga0501035_0629131
1172 Ga0501044_0264310
1173 nmdc:mga00v17_273289_c1
1174 nmdc:mga0yw44_5060_c1
1175 nmdc:mga0k408_73_c1
1176 nmdc:mga06z11_184495_c1
1177 nmdc:mga05p37_118482_c1
1178 nmdc:mga05p37_131128_c1
1179 nmdc:mga05p37_1882_c2
1180 nmdc:mga05p37_345328_c1
1181 nmdc:mga05p37_597338_c1
1182 nmdc:mga09592_44614_c1
1183 nmdc:mga06r32_168385_c1
1184 nmdc:mga06r32_23757_c1
1185 nmdc:mga08y16_108792_c1
1186 nmdc:mga08y16_113636_c1
1187 nmdc:mga08y16_377_c1
1188 nmdc:mga0n895_31726_c1
1189 nmdc:mga0n895_66981_c1
1190 nmdc:mga0n895_90756_c1
1191 nmdc:mga0rr50_911135_c1
1192 nmdc:mga0a205_28504_c1
1193 nmdc:mga0a205_48237_c1
1194 Ga0500655_014191
1195 Ga0500588_0010214
1196 Ga0500622_0005910
1197 Ga0500637_0078810
1198 Ga0501084_0112806
1199 Ga0501084_0477019
1200 2910246912
1201 2929156723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02698

DUF218

DUF218 domain

63

216

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ca8-assembly2.cif.gz_B crystal structure of escherichia coli ydcf, an s-adenosyl-l-methionine utilizing enzyme 0.8244 1 209
3ca8-assembly2.cif.gz_B crystal structure of escherichia coli ydcf, an s-adenosyl-l-methionine utilizing enzyme 0.7996 1 209
6l1g-assembly2.cif.gz_B crystal structure of light-dependent protochlorophyllide oxidoreductase from synechocystis sp. pcc 6803 0.6443 27 122
6l1h-assembly2.cif.gz_B crystal structure of light-dependent protochlorophyllide oxidoreductase from thermosynechococcus elongatus 0.6401 27 122
6r48-assembly1.cif.gz_A crystal structure of lpor (synechocystis) complexed with nadph at 1.87a resolution. 0.6363 27 122
ID Description Score Start End Superfamily
af_P34209_28_181_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8328 19 149 3.40.50.620
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8223 18 133 3.40.50.620
af_Q54FL1_98_236_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7635 27 147 3.40.50.620
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7198 18 133 3.40.50.620
af_P34209_28_181_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7119 19 149 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7W1C0Y2-F1-model_v4 YdcF family protein 0.9969 4 158 GO:0005886
AF-A0A2V7U9C9-F1-model_v4 DUF218 domain-containing protein 0.9946 4 215 GO:0005886
AF-A0A2V7VN22-F1-model_v4 DUF218 domain-containing protein 0.994 6 215 GO:0005886
AF-A0A0G0IXS8-F1-model_v4 DUF218 domain-containing protein 0.9918 87 214 GO:0005886
AF-A0A6P1TT74-F1-model_v4 YdcF family protein 0.9911 6 215 GO:0005886

Map