F467891

General Info

Members Datasets Scaffolds Average Seq Length
599 424 1198 155

Family's Representative Sequence

Representative Sequence 3300034817|Ga0373948_0012802|Ga0373948_0012802_822_1385
Length 187
Sequence MLRIVAGGLEDPRVVHLLNLHLVTARAQTAPGSAHALDLAGLKSPDVTFWSAWQDSELVAVGALKWLSDRHGEVKSMHTAEAFRRHGFGSTILGHIIDEARRASMTRLSLETGSWDYFRPAVALYKRHGFIECGPFAHYRLDRNSIFMTLDLSAPISLAPQEPGKTDREEQASAGALPSSELGDVAS

Samples

Sample ID Description Type Environment
1 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
51 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
52 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
114 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
115 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
117 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
253 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
254 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
255 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
258 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
270 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
273 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
275 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
276 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
277 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
278 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
279 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
280 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
281 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
282 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
283 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
284 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
285 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
286 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
287 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
288 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
289 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
290 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
291 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
292 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
293 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
294 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
295 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
296 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
297 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
298 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
299 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
300 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
301 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
302 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
303 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
304 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
305 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
306 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
307 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
308 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
309 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
310 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
311 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
312 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
313 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
314 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
315 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
316 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
317 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
318 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
319 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
320 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
321 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
322 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
323 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
324 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
325 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
326 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
327 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
328 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
329 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
330 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
331 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
332 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
333 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
334 2922368715
335 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
336 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
337 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
338 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
339 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
340 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
341 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
342 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
343 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
344 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
345 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
346 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
347 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
348 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
349 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
350 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
351 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
352 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
353 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
354 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
355 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
356 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
357 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
358 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
359 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
360 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
361 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
362 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
363 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
364 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
365 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
366 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
367 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
368 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
369 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
370 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
371 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
372 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
373 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
374 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
375 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
376 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
377 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
378 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
379 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
380 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
381 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
382 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
383 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
384 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
385 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
386 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
387 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
388 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
389 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
390 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
391 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
392 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
393 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
394 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
395 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
396 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
397 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
398 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
399 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
400 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
401 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
402 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
403 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
404 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
405 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
406 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
407 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
408 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
409 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
410 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
411 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
412 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
413 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
414 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
415 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
416 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
417 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
418 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
419 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
420 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
421 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
422 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
423 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
424 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.42
Metatranscriptomes 0.17
Isolates 24.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.7
Nodule 21.7
Rhizoplane 7.18
Rhizosphere 39.57
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373948_0012802 3300034817 Bacteria 1504
2 JGI25153J46596_10002760 3300003215 Bacteria 9988
3 JGI25153J46596_10003032 3300003215 Bacteria 9495
4 JGI25153J46596_10003557 3300003215 Bacteria 8688
5 JGI25153J46596_10003984 3300003215 Bacteria 8073
6 rootH2_10195238 3300003320 Bacteria 1680
7 rootL2_10072823 3300003322 Bacteria 1599
8 JGI25160J50197_1000486 3300003354 Bacteria 23951
9 JGI25160J50197_1016156 3300003354 Bacteria 2416
10 Ga0055526_1033698 3300003771 Bacteria 1417
11 Ga0055531_10007130 3300003794 Bacteria 6168
12 Ga0065165_1001966 3300005262 Bacteria 19466
13 Ga0065165_1003663 3300005262 Bacteria 10488
14 Ga0065165_1056403 3300005262 Bacteria 1092
15 Ga0068869_100330398 3300005334 Bacteria 1239
16 Ga0070661_100492677 3300005344 Bacteria 980
17 Ga0070668_100119314 3300005347 Bacteria 2107
18 Ga0070668_100275093 3300005347 Bacteria 1405
19 Ga0070669_100186365 3300005353 Bacteria 1626
20 Ga0070671_100002377 3300005355 Bacteria 14535
21 Ga0070671_100004121 3300005355 Bacteria 11476
22 Ga0070673_100034309 3300005364 Bacteria 3838
23 Ga0070673_100221979 3300005364 Bacteria 1636
24 Ga0070688_100015950 3300005365 Bacteria 4284
25 Ga0070659_101494127 3300005366 Unclassified 602
26 Ga0070667_100053411 3300005367 Bacteria 3410
27 Ga0070714_100338803 3300005435 Bacteria 1410
28 Ga0070710_10276501 3300005437 Bacteria 1088
29 Ga0070678_100415143 3300005456 Bacteria 1172
30 Ga0070678_101561642 3300005456 Unclassified 619
31 Ga0070662_100420860 3300005457 Bacteria 1105
32 Ga0068867_101197333 3300005459 Bacteria 697
33 Ga0070684_100921721 3300005535 Bacteria 819
34 Ga0068853_100767706 3300005539 Bacteria 922
35 Ga0068853_100906441 3300005539 Bacteria 847
36 Ga0070665_100194575 3300005548 Bacteria 2029
37 Ga0070665_100266806 3300005548 Bacteria 1713
38 Ga0070665_100645475 3300005548 Bacteria 1071
39 Ga0070664_100071692 3300005564 Bacteria 2969
40 Ga0068857_100085907 3300005577 Bacteria 2812
41 Ga0068854_100617222 3300005578 Bacteria 927
42 Ga0068854_100920335 3300005578 Bacteria 769
43 Ga0068854_101182667 3300005578 Unclassified 684
44 Ga0068856_100048537 3300005614 Bacteria 4184
45 Ga0068856_100088833 3300005614 Bacteria 3073
46 Ga0068852_100144598 3300005616 Bacteria 2204
47 Ga0068852_100199111 3300005616 Bacteria 1895
48 Ga0068852_100444407 3300005616 Bacteria 1282
49 Ga0068852_101089171 3300005616 Bacteria 819
50 Ga0068859_100670127 3300005617 Bacteria 1129
51 Ga0068864_100795858 3300005618 Bacteria 929
52 Ga0068864_100979556 3300005618 Bacteria 838
53 Ga0068861_100695983 3300005719 Bacteria 944
54 Ga0068863_100268557 3300005841 Bacteria 1651
55 Ga0068858_100238723 3300005842 Bacteria 1724
56 Ga0068858_100623878 3300005842 Bacteria 1047
57 Ga0068860_100990919 3300005843 Bacteria 858
58 Ga0081540_1019995 3300005983 Bacteria 4045
59 Ga0070717_10302018 3300006028 Bacteria 1423
60 Ga0075365_10025602 3300006038 Bacteria 3736
61 Ga0075365_10039044 3300006038 Bacteria 3089
62 Ga0075365_10105987 3300006038 Bacteria 1928
63 Ga0075368_10015421 3300006042 Bacteria 2835
64 Ga0075363_100009077 3300006048 Bacteria 4666
65 Ga0075364_10033939 3300006051 Bacteria 3289
66 Ga0075364_10406860 3300006051 Bacteria 929
67 Ga0070716_100397602 3300006173 Bacteria 990
68 Ga0075362_10026952 3300006177 Bacteria 2458
69 Ga0075362_10111839 3300006177 Bacteria 1286
70 Ga0075367_10051562 3300006178 Bacteria 2432
71 Ga0075367_10131393 3300006178 Bacteria 1548
72 Ga0075367_10388758 3300006178 Bacteria 882
73 Ga0075369_10049048 3300006186 Bacteria 1823
74 Ga0075366_10019615 3300006195 Bacteria 3916
75 Ga0075366_10130782 3300006195 Bacteria 1515
76 Ga0075366_10173665 3300006195 Bacteria 1308
77 Ga0075370_10042737 3300006353 Bacteria 2560
78 Ga0075370_10110984 3300006353 Bacteria 1593
79 Ga0097620_100669991 3300006931 Bacteria 1129
80 Ga0099824_1008958 3300006942 Bacteria 12537
81 Ga0099822_1044570 3300006943 Bacteria 2184
82 Ga0099823_1022099 3300006944 Bacteria 5906
83 Ga0099794_10106975 3300007265 Bacteria 1399
84 Ga0105240_10283633 3300009093 Bacteria 1902
85 Ga0105240_10759483 3300009093 Unclassified 1053
86 Ga0105240_11188131 3300009093 Bacteria 808
87 Ga0105245_10079203 3300009098 Bacteria 3000
88 Ga0105245_10135330 3300009098 Bacteria 2315
89 Ga0105245_11970423 3300009098 Bacteria 637
90 Ga0105247_10017662 3300009101 Bacteria 4278
91 Ga0105243_10060118 3300009148 Bacteria 3035
92 Ga0105243_10261969 3300009148 Bacteria 1548
93 Ga0105248_10521352 3300009177 Bacteria 1340
94 Ga0105248_10863403 3300009177 Bacteria 1021
95 Ga0105248_11189284 3300009177 Bacteria 862
96 Ga0105237_10047122 3300009545 Bacteria 4334
97 Ga0105237_10403160 3300009545 Bacteria 1372
98 Ga0105238_10323833 3300009551 Bacteria 1527
99 Ga0099796_10055395 3300010159 Bacteria 1389
100 Ga0105239_10052979 3300010375 Bacteria 4450
101 Ga0105239_10074422 3300010375 Bacteria 3734
102 Ga0105239_10260622 3300010375 Bacteria 1948
103 Ga0105246_10106368 3300011119 Bacteria 2052
104 Ga0105246_11460027 3300011119 Unclassified 641
105 Ga0157313_1039481 3300012503 Bacteria 573
106 Ga0157378_10576726 3300013297 Bacteria 1133
107 Ga0163162_10197634 3300013306 Bacteria 2140
108 Ga0157375_10244762 3300013308 Bacteria 1953
109 Ga0163163_10633659 3300014325 Bacteria 1132
110 Ga0157379_10091804 3300014968 Bacteria 2724
111 Ga0157379_10406745 3300014968 Bacteria 1252
112 Ga0157376_10545282 3300014969 Bacteria 1147
113 Ga0157376_11021555 3300014969 Bacteria 850
114 Ga0214544_1000003 3300021320 Bacteria 643752
115 Ga0214542_1000003 3300021321 Bacteria 435700
116 Ga0214542_1032853 3300021321 Bacteria 1799
117 Ga0214545_1000004 3300021324 Bacteria 453352
118 Ga0214545_1028276 3300021324 Bacteria 2715
119 Ga0214543_1000007 3300021327 Bacteria 414744
120 Ga0214543_1029549 3300021327 Bacteria 2433
121 Ga0213872_10122908 3300021361 Bacteria 1147
122 Ga0209677_105081 3300025253 Bacteria 3554
123 Ga0209233_1002498 3300025261 Bacteria 6743
124 Ga0209233_1044419 3300025261 Bacteria 940
125 Ga0209455_1052279 3300025272 Bacteria 567
126 Ga0209564_1006276 3300025295 Bacteria 6477
127 Ga0209564_1027035 3300025295 Bacteria 1874
128 Ga0209758_1000015 3300025297 Bacteria 851943
129 Ga0209758_1000389 3300025297 Bacteria 75919
130 Ga0209758_1000716 3300025297 Bacteria 48984
131 Ga0209758_1002865 3300025297 Bacteria 16738
132 Ga0209758_1017648 3300025297 Bacteria 3539
133 Ga0209758_1025358 3300025297 Bacteria 2605
134 Ga0209256_1005691 3300025299 Bacteria 7003
135 Ga0209256_1025812 3300025299 Bacteria 1705
136 Ga0209256_1049884 3300025299 Bacteria 1017
137 Ga0209256_1057471 3300025299 Bacteria 918
138 Ga0207426_1000380 3300025302 Bacteria 76046
139 Ga0209257_1001378 3300025304 Bacteria 29161
140 Ga0209257_1044825 3300025304 Bacteria 1288
141 Ga0207680_10027920 3300025903 Bacteria 3151
142 Ga0207680_10142068 3300025903 Bacteria 1592
143 Ga0207705_10096495 3300025909 Bacteria 2170
144 Ga0207654_10127875 3300025911 Bacteria 1604
145 Ga0207671_10050592 3300025914 Bacteria 3077
146 Ga0207693_10083893 3300025915 Bacteria 2496
147 Ga0207663_10272809 3300025916 Bacteria 1253
148 Ga0207681_10279547 3300025923 Bacteria 1314
149 Ga0207650_10003204 3300025925 Bacteria 11284
150 Ga0207659_10337996 3300025926 Bacteria 1246
151 Ga0207687_10179603 3300025927 Bacteria 1639
152 Ga0207700_10132850 3300025928 Bacteria 2035
153 Ga0207690_10521391 3300025932 Bacteria 963
154 Ga0207706_10062646 3300025933 Bacteria 3275
155 Ga0207706_10304329 3300025933 Bacteria 1389
156 Ga0207709_10047359 3300025935 Bacteria 2613
157 Ga0207709_11257204 3300025935 Bacteria 611
158 Ga0207704_11229852 3300025938 Bacteria 639
159 Ga0207711_10046798 3300025941 Bacteria 3697
160 Ga0207711_10402571 3300025941 Bacteria 1272
161 Ga0207711_11212028 3300025941 Bacteria 696
162 Ga0207679_10475945 3300025945 Bacteria 1111
163 Ga0207667_10112155 3300025949 Bacteria 2812
164 Ga0207651_10085933 3300025960 Bacteria 2284
165 Ga0207651_10376077 3300025960 Bacteria 1203
166 Ga0207712_10330194 3300025961 Bacteria 1261
167 Ga0207640_10392861 3300025981 Bacteria 1127
168 Ga0207640_10921070 3300025981 Bacteria 764
169 Ga0207640_11162428 3300025981 Unclassified 685
170 Ga0207658_10064582 3300025986 Bacteria 2746
171 Ga0207658_10229935 3300025986 Bacteria 1565
172 Ga0207703_10218921 3300026035 Bacteria 1701
173 Ga0207703_10508939 3300026035 Bacteria 1131
174 Ga0207678_10062487 3300026067 Bacteria 3201
175 Ga0207702_10303997 3300026078 Bacteria 1514
176 Ga0207674_10084709 3300026116 Bacteria 3167
177 Ga0207675_100129979 3300026118 Bacteria 2388
178 Ga0207683_10146552 3300026121 Bacteria 2129
179 Ga0207683_10500482 3300026121 Bacteria 1122
180 Ga0207698_10225005 3300026142 Bacteria 1699
181 Ga0209389_1000168 3300027296 Bacteria 52990
182 Ga0209389_1000180 3300027296 Bacteria 49331
183 Ga0209589_1000570 3300027357 Bacteria 52985
184 Ga0209489_101190 3300027361 Bacteria 52985
185 Ga0209489_101411 3300027361 Bacteria 49331
186 Ga0209700_101443 3300027363 Bacteria 49345
187 Ga0209179_1008423 3300027512 Bacteria 1737
188 Ga0209813_10063909 3300027866 Bacteria 1182
189 Ga0268266_10967657 3300028379 Bacteria 823
190 Ga0268265_10163303 3300028380 Bacteria 1895
191 Ga0265763_1000013 3300030763 Bacteria 7184
192 Ga0307509_10204518 3300031507 Bacteria 1807
193 Ga0307509_10359703 3300031507 Bacteria 1175
194 Ga0307516_10045493 3300031730 Bacteria 4335
195 Ga0307507_10246811 3300033179 Bacteria 1159
196 Ga0307507_10269357 3300033179 Bacteria 1078
197 Ga0307510_10003428 3300033180 Bacteria 18490
198 Ga0307510_10225330 3300033180 Bacteria 1382
199 Ga0373926_0171735 3300035083 Bacteria 830
200 Ga0373932_0020615 3300035112 Bacteria 1731
201 Ga0373957_0181841 3300035120 Bacteria 872
202 Ga0373942_0016557 3300035207 Bacteria 1809
203 Ga0373924_0009815 3300035410 Bacteria 3517
204 Ga0373927_0004873 3300035695 Bacteria 9327
205 Ga0373947_0286618 3300035725 Bacteria 1096
206 Ga0373947_0370019 3300035725 Bacteria 964
207 Ga0373937_0731512 3300036401 Bacteria 936
208 Ga0373925_0323558 3300037068 Bacteria 1248
209 Ga0395900_0946680 3300037418 Bacteria 783
210 Ga0395898_0082704 3300037466 Bacteria 3095
211 Ga0395898_1753443 3300037466 Bacteria 543
212 Ga0395905_0003588 3300037471 Bacteria 16513
213 Ga0436361_0094554 3300039447 Bacteria 1061
214 Ga0451833_0840840 3300041491 Bacteria 1463
215 Ga0451839_0659138 3300041496 Bacteria 577
216 Ga0451841_0738847 3300041498 Bacteria 1420
217 Ga0451851_1165506 3300041507 Bacteria 785
218 Ga0451853_1357962 3300041512 Bacteria 1476
219 Ga0451853_3641322 3300041512 Bacteria 1128
220 Ga0466972_0000171 3300044658 Bacteria 50915
221 Ga0466972_0025721 3300044658 Bacteria 2915
222 Ga0466972_0216955 3300044658 Bacteria 895
223 Ga0466965_0052729 3300044683 Bacteria 2021
224 Ga0466965_0486853 3300044683 Bacteria 690
225 Ga0466966_0000287 3300044684 Bacteria 33106
226 Ga0466961_0000126 3300044693 Bacteria 51032
227 Ga0466961_0331220 3300044693 Bacteria 928
228 Ga0466968_0198499 3300044735 Bacteria 939
229 Ga0466957_0076676 3300044842 Bacteria 2076
230 Ga0466960_0006686 3300044901 Bacteria 4639
231 Ga0466960_0041824 3300044901 Bacteria 2173
232 Ga0466960_0232945 3300044901 Bacteria 1017
233 Ga0466959_0020395 3300045049 Bacteria 4882
234 Ga0466959_0803358 3300045049 Bacteria 629
235 Ga0466958_0202052 3300045836 Bacteria 1265
236 Ga0466958_0452251 3300045836 Bacteria 832
237 Ga0466967_0004486 3300045976 Bacteria 9423
238 Ga0495592_0386792 3300046454 Bacteria 889
239 Ga0495603_0021121 3300046455 Bacteria 3942
240 Ga0495590_0117663 3300046457 Bacteria 951
241 Ga0495629_0054362 3300046459 Bacteria 2800
242 Ga0495638_0010811 3300046460 Bacteria 6312
243 Ga0495638_0570612 3300046460 Bacteria 560
244 Ga0495651_0093991 3300046462 Bacteria 2244
245 Ga0495651_0172561 3300046462 Bacteria 1538
246 Ga0495580_0008346 3300046472 Bacteria 8238
247 Ga0495582_0367627 3300046473 Unclassified 828
248 Ga0495607_0164954 3300046501 Bacteria 1123
249 Ga0495583_0037327 3300046506 Bacteria 2304
250 Ga0495583_0276392 3300046506 Bacteria 670
251 Ga0495606_0024173 3300046507 Bacteria 4386
252 Ga0495606_0034507 3300046507 Bacteria 3473
253 Ga0495608_0074506 3300046511 Bacteria 2212
254 Ga0495616_0010409 3300046513 Bacteria 5384
255 Ga0495616_0103993 3300046513 Bacteria 1328
256 Ga0495618_0044059 3300046514 Bacteria 2815
257 Ga0495620_0050452 3300046515 Bacteria 1775
258 Ga0495643_0013979 3300046522 Bacteria 4785
259 Ga0495643_0064463 3300046522 Bacteria 1936
260 Ga0495643_0122069 3300046522 Bacteria 1315
261 Ga0495648_0014992 3300046524 Bacteria 5646
262 Ga0495648_0116319 3300046524 Bacteria 1445
263 Ga0495648_0224470 3300046524 Bacteria 924
264 Ga0495652_0096736 3300046529 Bacteria 2403
265 Ga0495652_0631404 3300046529 Bacteria 727
266 Ga0495654_0146651 3300046530 Bacteria 1047
267 Ga0495640_0045011 3300046533 Bacteria 3064
268 Ga0495587_0110409 3300046536 Bacteria 1580
269 Ga0495587_0571272 3300046536 Bacteria 623
270 Ga0495609_0251023 3300046538 Bacteria 728
271 Ga0495645_0053120 3300046543 Bacteria 2946
272 Ga0495622_0048120 3300046557 Bacteria 1981
273 Ga0495622_0089832 3300046557 Bacteria 1411
274 Ga0495622_0126864 3300046557 Bacteria 1163
275 Ga0495668_0110649 3300046616 Bacteria 1502
276 Ga0495668_0179090 3300046616 Bacteria 1161
277 Ga0495611_0098482 3300046648 Bacteria 1356
278 Ga0495625_0077978 3300046660 Bacteria 2313
279 Ga0495635_0001988 3300046663 Bacteria 13902
280 Ga0495661_0202025 3300046665 Bacteria 1040
281 Ga0495588_0001753 3300046674 Bacteria 9238
282 Ga0495588_0178348 3300046674 Bacteria 1123
283 Ga0495657_0065232 3300046675 Bacteria 2395
284 Ga0495623_0168357 3300046679 Bacteria 1282
285 Ga0495646_0042185 3300046680 Bacteria 2801
286 Ga0495647_0229756 3300046681 Bacteria 821
287 Ga0495658_0004453 3300046683 Bacteria 6896
288 Ga0495613_0037355 3300046689 Bacteria 3601
289 Ga0495613_0373643 3300046689 Bacteria 976
290 Ga0495624_0033063 3300046690 Bacteria 3350
291 Ga0495649_0010914 3300046694 Bacteria 5351
292 Ga0495649_0295697 3300046694 Bacteria 825
293 Ga0495600_0035626 3300046809 Bacteria 3233
294 Ga0495600_0246452 3300046809 Bacteria 1137
295 Ga0495581_0109662 3300047315 Unclassified 1605
296 Ga0495581_0119932 3300047315 Bacteria 1530
297 Ga0495604_0068754 3300047317 Bacteria 2687
298 Ga0495604_0210012 3300047317 Bacteria 1345
299 Ga0495674_0397542 3300047319 Bacteria 1113
300 Ga0495676_0048463 3300047321 Bacteria 3425
301 Ga0495676_0121696 3300047321 Bacteria 1897
302 Ga0495680_0439198 3300047322 Bacteria 895
303 Ga0495683_0062261 3300047323 Bacteria 1846
304 Ga0495683_0478092 3300047323 Bacteria 508
305 Ga0495687_006948 3300047443 Bacteria 6806
306 Ga0495673_0116222 3300047469 Bacteria 1064
307 Ga0495673_0162248 3300047469 Bacteria 857
308 Ga0495684_0056493 3300047471 Unclassified 2993
309 Ga0495686_0044642 3300047472 Bacteria 2806
310 Ga0495593_0016209 3300047673 Bacteria 4206
311 Ga0495593_0676363 3300047673 Bacteria 518
312 Ga0495602_0064489 3300048088 Bacteria 3167
313 Ga0495626_0202917 3300048091 Bacteria 812
314 Ga0496100_0115198 3300048903 Bacteria 1874
315 Ga0496101_0068702 3300048904 Bacteria 2591
316 Ga0496101_0614862 3300048904 Bacteria 859
317 Ga0496102_0073053 3300048905 Bacteria 3153
318 Ga0496102_0268143 3300048905 Bacteria 1609
319 Ga0496102_1068498 3300048905 Bacteria 727
320 Ga0496103_0005475 3300048906 Bacteria 7592
321 Ga0496104_0059026 3300048907 Bacteria 3632
322 Ga0496104_0069889 3300048907 Bacteria 3338
323 Ga0496104_0080570 3300048907 Bacteria 3104
324 Ga0496104_0207397 3300048907 Bacteria 1871
325 Ga0496104_0610096 3300048907 Bacteria 1001
326 Ga0496105_0010573 3300048908 Bacteria 7259
327 Ga0496105_0022265 3300048908 Bacteria 5132
328 Ga0496105_0184901 3300048908 Bacteria 1705
329 Ga0496105_0609723 3300048908 Bacteria 846
330 Ga0496106_0042271 3300048909 Bacteria 3418
331 Ga0496106_0062940 3300048909 Bacteria 2818
332 Ga0496106_0526390 3300048909 Bacteria 949
333 Ga0496107_0156896 3300048910 Bacteria 1685
334 Ga0496108_0697002 3300048911 Bacteria 881
335 Ga0496109_0027348 3300048912 Bacteria 5092
336 Ga0496109_0193921 3300048912 Bacteria 1909
337 Ga0496109_0194981 3300048912 Unclassified 1904
338 Ga0496109_0713696 3300048912 Bacteria 940
339 Ga0496110_0060520 3300048913 Bacteria 3340
340 Ga0496110_0061848 3300048913 Bacteria 3306
341 Ga0496110_0088962 3300048913 Bacteria 2759
342 Ga0496110_0161223 3300048913 Bacteria 2033
343 Ga0496111_0033389 3300048914 Bacteria 3670
344 Ga0496112_0068167 3300048915 Bacteria 3513
345 Ga0496112_0105810 3300048915 Bacteria 2783
346 Ga0496112_0125700 3300048915 Bacteria 2535
347 Ga0496112_0418281 3300048915 Bacteria 1279
348 Ga0496112_0781555 3300048915 Bacteria 880
349 Ga0496112_1081569 3300048915 Unclassified 720
350 Ga0496113_0011450 3300048916 Bacteria 5918
351 Ga0496113_0045302 3300048916 Bacteria 3262
352 Ga0496113_0370278 3300048916 Unclassified 1150
353 Ga0496114_0152163 3300048917 Bacteria 2007
354 Ga0496114_0168518 3300048917 Bacteria 1908
355 Ga0496115_0139714 3300048918 Bacteria 1998
356 Ga0496115_0165175 3300048918 Bacteria 1831
357 Ga0496116_0031279 3300048919 Bacteria 3814
358 Ga0496116_0169150 3300048919 Bacteria 1187
359 Ga0496117_0017937 3300048920 Bacteria 5893
360 Ga0496117_0132028 3300048920 Bacteria 1512
361 Ga0496117_0311188 3300048920 Bacteria 829
362 Ga0496118_0027170 3300048921 Bacteria 4851
363 Ga0496118_0033432 3300048921 Bacteria 4219
364 Ga0496118_0040808 3300048921 Bacteria 3684
365 Ga0496118_0042180 3300048921 Bacteria 3602
366 Ga0496118_0103003 3300048921 Bacteria 1922
367 Ga0496119_0007759 3300048922 Bacteria 9571
368 Ga0496119_0026402 3300048922 Bacteria 4027
369 Ga0496119_0115093 3300048922 Bacteria 1486
370 Ga0496120_0015188 3300048923 Bacteria 5090
371 Ga0496120_0070254 3300048923 Bacteria 1926
372 Ga0496120_0089055 3300048923 Bacteria 1653
373 Ga0496121_0098817 3300048924 Bacteria 2257
374 Ga0496121_0136844 3300048924 Bacteria 1823
375 Ga0496121_0609059 3300048924 Bacteria 672
376 Ga0496122_0214541 3300048925 Bacteria 1111
377 Ga0496124_0036277 3300048927 Bacteria 4303
378 Ga0496124_0063999 3300048927 Bacteria 3071
379 Ga0496124_0083050 3300048927 Bacteria 2629
380 Ga0496125_0031925 3300048928 Bacteria 4685
381 Ga0496125_0065468 3300048928 Bacteria 2879
382 Ga0496126_0065141 3300048929 Bacteria 3261
383 Ga0496126_0137704 3300048929 Bacteria 2104
384 Ga0496126_0569063 3300048929 Bacteria 897
385 Ga0496126_0943130 3300048929 Bacteria 651
386 Ga0495682_0005691 3300049460 Bacteria 5145
387 Ga0495682_0155829 3300049460 Bacteria 814
388 Ga0495682_0359480 3300049460 Bacteria 513
389 nmdc:mga03683_145017_c1 3300050489 Bacteria 1069
390 nmdc:mga03683_91933_c1 3300050489 Bacteria 1324
391 nmdc:mga03n38_480644_c1 3300050490 Bacteria 695
392 nmdc:mga00v17_168701_c1 3300050491 Bacteria 1411
393 nmdc:mga00v17_72069_c1 3300050491 Bacteria 2143
394 nmdc:mga0yw44_217340_c1 3300050492 Bacteria 1266
395 nmdc:mga0yw44_54701_c1 3300050492 Bacteria 2427
396 nmdc:mga0yw44_553687_c1 3300050492 Bacteria 781
397 nmdc:mga0k408_125473_c1 3300050493 Bacteria 1522
398 nmdc:mga0k408_156025_c1 3300050493 Bacteria 1360
399 nmdc:mga06z11_316387_c1 3300050494 Bacteria 930
400 nmdc:mga06z11_367147_c1 3300050494 Bacteria 863
401 nmdc:mga06z11_532636_c1 3300050494 Bacteria 713
402 nmdc:mga06z11_71508_c1 3300050494 Bacteria 1837
403 nmdc:mga07m45_16366_c1 3300050496 Bacteria 3971
404 nmdc:mga07m45_44086_c1 3300050496 Bacteria 2502
405 nmdc:mga07m45_51014_c1 3300050496 Bacteria 2333
406 nmdc:mga0sz30_58048_c1 3300050516 Bacteria 1650
407 nmdc:mga0sz30_8769_c1 3300050516 Bacteria 3828
408 Ga0495655_0017713 3300053083 Bacteria 1555
409 Ga0500578_0044781 3300053086 Bacteria 2840
410 Ga0500643_000278 3300053087 Bacteria 44354
411 Ga0500643_149799 3300053087 Bacteria 626
412 Ga0500647_0053036 3300053091 Bacteria 1951
413 Ga0500583_0001543 3300053092 Bacteria 6650
414 Ga0500651_0139891 3300053093 Bacteria 1460
415 Ga0500566_0000565 3300053094 Bacteria 20802
416 Ga0500566_0226617 3300053094 Bacteria 925
417 Ga0500566_0401536 3300053094 Bacteria 613
418 Ga0500641_0025988 3300053096 Bacteria 2270
419 Ga0500650_0046065 3300053098 Bacteria 2021
420 Ga0500553_167433 3300053101 Bacteria 814
421 Ga0500556_0007584 3300053104 Bacteria 3105
422 Ga0500557_000028 3300053105 Bacteria 78414
423 Ga0500562_001440 3300053108 Bacteria 5857
424 Ga0500572_021608 3300053111 Bacteria 1706
425 Ga0500592_024552 3300053116 Bacteria 972
426 Ga0500595_042565 3300053119 Bacteria 1452
427 Ga0500597_355699 3300053120 Bacteria 569
428 Ga0500607_109179 3300053121 Bacteria 1359
429 Ga0500618_014440 3300053125 Bacteria 2016
430 Ga0500642_0000189 3300053130 Bacteria 25159
431 Ga0500642_0412598 3300053130 Bacteria 587
432 Ga0500658_0152459 3300053134 Bacteria 1042
433 Ga0500559_0014457 3300053136 Bacteria 3336
434 Ga0500559_0020397 3300053136 Bacteria 2802
435 Ga0500564_044818 3300053138 Bacteria 2030
436 Ga0500568_0006091 3300053139 Bacteria 6113
437 Ga0500588_0247774 3300053146 Bacteria 668
438 Ga0500616_0082394 3300053153 Bacteria 1614
439 Ga0500620_079198 3300053155 Bacteria 1136
440 Ga0500622_0029668 3300053156 Bacteria 2874
441 Ga0500634_0240693 3300053161 Bacteria 760
442 Ga0500638_083689 3300053162 Bacteria 1512
443 Ga0500638_125751 3300053162 Bacteria 1168
444 Ga0500636_0000246 3300053177 Bacteria 29834
445 Ga0500636_0142543 3300053177 Bacteria 1325
446 Ga0500636_0193797 3300053177 Bacteria 1080
447 Ga0500637_0296398 3300053178 Bacteria 883
448 Ga0500625_015809 3300053729 Bacteria 3506
449 Ga0500645_006672 3300053730 Bacteria 4093
450 Ga0500599_005091 3300053736 Bacteria 1645
451 Ga0500587_053969 3300053739 Bacteria 602
452 Ga0500661_031528 3300055283 Bacteria 935
453 2507504743 2507262055 Bacteria 8048963
454 2508539841 2508501009 Bacteria 7784016
455 2508695028 2508501042 Bacteria 8719808
456 2513626673 2513237092 Bacteria 8341956
457 2513641806 2513237094 Bacteria 8789602
458 2513648116 2513237095 Bacteria 8976980
459 2513704763 2513237102 Bacteria 7703324
460 2513715588 2513237104 Bacteria 10034502
461 2515627827 2515154112 Bacteria 8294334
462 2517106975 2517093001 Bacteria 9002274
463 2528850285 2528768022 Bacteria 10457665
464 2617374238 2617270741 Bacteria 8201522
465 2818237168 2816332527 Bacteria 8933356
466 2824608681 2824600985 Bacteria 8488197
467 2824612758 2824609381 Bacteria 8672835
468 2824626360 2824617872 Bacteria 8814715
469 2824632495 2824626560 Bacteria 8813858
470 2824643639 2824635225 Bacteria 8785348
471 2824652525 2824644064 Bacteria 8743947
472 2824658998 2824653114 Bacteria 8493680
473 2824670996 2824661429 Bacteria 9877870
474 2824713200 2824704595 Bacteria 9667483
475 2824723329 2824714736 Bacteria 8717648
476 2824732462 2824723954 Bacteria 8758240
477 2824736943 2824732956 Bacteria 7810675
478 2824748235 2824746037 Bacteria 7911610
479 2824760635 2824753945 Bacteria 9787441
480 2824772026 2824763712 Bacteria 9792355
481 2841965997 2841957949 Bacteria 8652217
482 2842044000 2842038055 Bacteria 8002051
483 2842052011 2842045827 Bacteria 8006841
484 2847939685 2847930680 Bacteria 9342022
485 2874591477 2874590934 Bacteria 8299676
486 2874615560 2874612657 Bacteria 8252029
487 2874634079 2874628541 Bacteria 8630250
488 2874647727 2874645413 Bacteria 8214782
489 2876764545 2876761206 Bacteria 10111113
490 2876771627 2876771140 Bacteria 8287509
491 2876826520 2876818435 Bacteria 8274608
492 2879075441 2879074833 Bacteria 8279565
493 2879090512 2879083081 Bacteria 8587928
494 2879101853 2879099564 Bacteria 10442239
495 2879130669 2879127579 Bacteria 8294491
496 2879142983 2879142872 Bacteria 8267021
497 2881364984 2881364244 Bacteria 7710352
498 2881672306 2881665667 Bacteria 8175609
499 2885368110 2885366525 Bacteria 8326213
500 2885410919 2885409591 Bacteria 9235467
501 2888380123 2888378607 Bacteria 9652610
502 2888391138 2888388044 Bacteria 7304136
503 2888420885 2888419890 Bacteria 7857137
504 2903727736 2903727486 Bacteria 8281579
505 2904717930 2904711408 Bacteria 9771557
506 2906602778 2906602504 Bacteria 8295279
507 2906645051 2906643746 Bacteria 8722424
508 2908776713 2908775508 Bacteria 8092255
509 2922378475
510 2929622436 2929615660 Bacteria 9193770
511 2929631347 2929624759 Bacteria 9339455
512 2932786236 2932784394 Bacteria 9704911
513 2932794805 2932794094 Bacteria 7915132
514 2932805403 2932801729 Bacteria 7987968
515 2932812690 2932809354 Bacteria 9135765
516 2932823052 2932818245 Bacteria 9955613
517 2932829474 2932828146 Bacteria 9745859
518 2933584484 2933577622 Bacteria 9116884
519 2935615060 2935608549 Bacteria 8203142
520 2935617906 2935616580 Bacteria 9032984
521 2935641610 2935638405 Bacteria 10015038
522 2935651588 2935648319 Bacteria 8801166
523 2935659644 2935656913 Bacteria 8965014
524 2935669332 2935665750 Bacteria 9571747
525 2935678072 2935675223 Bacteria 9928132
526 2935693609 2935684952 Bacteria 9590419
527 2935702929 2935694250 Bacteria 9291695
528 2935707155 2935703347 Bacteria 10242284
529 2935716973 2935713505 Bacteria 9608509
530 2935730193 2935722832 Bacteria 9608746
531 2935738412 2935732158 Bacteria 9706831
532 2935750200 2935741537 Bacteria 9707219
533 2935759794 2935750917 Bacteria 9590372
534 2935764555 2935760218 Bacteria 9817913
535 2935777084 2935769743 Bacteria 7878163
536 2935777987 2935777560 Bacteria 8077691
537 2935787192 2935785616 Bacteria 7962367
538 2935796020 2935793552 Bacteria 8012592
539 2935804464 2935801545 Bacteria 9301974
540 2935819135 2935810662 Bacteria 9401221
541 2935825902 2935819856 Bacteria 8261050
542 2935831341 2935827899 Bacteria 10038562
543 2935841950 2935837841 Bacteria 9454360
544 2935851521 2935847175 Bacteria 8228321
545 2935856595 2935855204 Bacteria 9035059
546 2935870210 2935864058 Bacteria 9784707
547 2935874465 2935873716 Bacteria 9632195
548 2935887515 2935883170 Bacteria 7964738
549 2935910458 2935908558 Bacteria 8568796
550 2935918140 2935916978 Bacteria 9113783
551 2935927631 2935926038 Bacteria 8601059
552 2935936497 2935934488 Bacteria 8602579
553 2935943950 2935942939 Bacteria 8599779
554 2935952387 2935951376 Bacteria 8602333
555 2935964256 2935959822 Bacteria 7869783
556 2935969227 2935967501 Bacteria 8603075
557 2935978012 2935975950 Bacteria 8347125
558 2935984688 2935984226 Bacteria 8302647
559 2935993926 2935992306 Bacteria 9802711
560 2936005063 2936002035 Bacteria 9362176
561 2936014060 2936011229 Bacteria 8801034
562 2936023031 2936019824 Bacteria 8804134
563 2936031167 2936028420 Bacteria 8965941
564 2936045714 2936037263 Bacteria 9446081
565 2936049289 2936046547 Bacteria 8903709
566 2936055831 2936055302 Bacteria 8785755
567 2940565752 2940556831 Bacteria 9590747
568 2941544023 2941538514 Bacteria 9402094
569 3005509653 3005506211 Bacteria 6943378
570 3005717799 3005710791 Bacteria 7622528
571 3005724852 3005718088 Bacteria 8283608
572 8016518759 8016511872 Bacteria 9921665
573 8016526709 8016522445 Bacteria 8156687
574 8016531793 8016530956 Bacteria 8155261
575 8016544999 8016539877 Bacteria 8155419
576 8016557074 8016548790 Bacteria 8155074
577 8016570074 8016566248 Bacteria 8158151
578 8016582644 8016575299 Bacteria 8154085
579 8016603061 8016595262 Bacteria 8149947
580 8016605963 8016603502 Bacteria 8731218
581 8016617848 8016613128 Bacteria 8794220
582 8016623726 8016622563 Bacteria 7999408
583 8016636403 8016630954 Bacteria 9217207
584 8017057918 8017057580 Bacteria 10023680
585 8019531623 8019530166 Bacteria 8155624
586 8019539911 8019538911 Bacteria 7872763
587 8019550745 8019547302 Bacteria 7996444
588 8019577806 8019576017 Bacteria 10049540
589 8019605848 8019597564 Bacteria 10041141
590 8019612686 8019608314 Bacteria 10042931
591 8019622435 8019619141 Bacteria 9218857
592 8019639752 8019638758 Bacteria 9062356
593 8019651939 8019648815 Bacteria 10014479
594 8019667860 8019659431 Bacteria 8577854
595 8019677275 8019668869 Bacteria 8791617
596 8019678707 8019678201 Bacteria 8863603
597 8019696809 8019687851 Bacteria 8712826
598 8055750887 8055742211 Bacteria 9226248
599 8056975570 8056967851 Bacteria 9038162
600 Ga0373948_0012802
601 JGI25153J46596_10002760
602 JGI25153J46596_10003032
603 JGI25153J46596_10003557
604 JGI25153J46596_10003984
605 rootH2_10195238
606 rootL2_10072823
607 JGI25160J50197_1000486
608 JGI25160J50197_1016156
609 Ga0055526_1033698
610 Ga0055531_10007130
611 Ga0065165_1001966
612 Ga0065165_1003663
613 Ga0065165_1056403
614 Ga0068869_100330398
615 Ga0070661_100492677
616 Ga0070668_100119314
617 Ga0070668_100275093
618 Ga0070669_100186365
619 Ga0070671_100002377
620 Ga0070671_100004121
621 Ga0070673_100034309
622 Ga0070673_100221979
623 Ga0070688_100015950
624 Ga0070659_101494127
625 Ga0070667_100053411
626 Ga0070714_100338803
627 Ga0070710_10276501
628 Ga0070678_100415143
629 Ga0070678_101561642
630 Ga0070662_100420860
631 Ga0068867_101197333
632 Ga0070684_100921721
633 Ga0068853_100767706
634 Ga0068853_100906441
635 Ga0070665_100194575
636 Ga0070665_100266806
637 Ga0070665_100645475
638 Ga0070664_100071692
639 Ga0068857_100085907
640 Ga0068854_100617222
641 Ga0068854_100920335
642 Ga0068854_101182667
643 Ga0068856_100048537
644 Ga0068856_100088833
645 Ga0068852_100144598
646 Ga0068852_100199111
647 Ga0068852_100444407
648 Ga0068852_101089171
649 Ga0068859_100670127
650 Ga0068864_100795858
651 Ga0068864_100979556
652 Ga0068861_100695983
653 Ga0068863_100268557
654 Ga0068858_100238723
655 Ga0068858_100623878
656 Ga0068860_100990919
657 Ga0081540_1019995
658 Ga0070717_10302018
659 Ga0075365_10025602
660 Ga0075365_10039044
661 Ga0075365_10105987
662 Ga0075368_10015421
663 Ga0075363_100009077
664 Ga0075364_10033939
665 Ga0075364_10406860
666 Ga0070716_100397602
667 Ga0075362_10026952
668 Ga0075362_10111839
669 Ga0075367_10051562
670 Ga0075367_10131393
671 Ga0075367_10388758
672 Ga0075369_10049048
673 Ga0075366_10019615
674 Ga0075366_10130782
675 Ga0075366_10173665
676 Ga0075370_10042737
677 Ga0075370_10110984
678 Ga0097620_100669991
679 Ga0099824_1008958
680 Ga0099822_1044570
681 Ga0099823_1022099
682 Ga0099794_10106975
683 Ga0105240_10283633
684 Ga0105240_10759483
685 Ga0105240_11188131
686 Ga0105245_10079203
687 Ga0105245_10135330
688 Ga0105245_11970423
689 Ga0105247_10017662
690 Ga0105243_10060118
691 Ga0105243_10261969
692 Ga0105248_10521352
693 Ga0105248_10863403
694 Ga0105248_11189284
695 Ga0105237_10047122
696 Ga0105237_10403160
697 Ga0105238_10323833
698 Ga0099796_10055395
699 Ga0105239_10052979
700 Ga0105239_10074422
701 Ga0105239_10260622
702 Ga0105246_10106368
703 Ga0105246_11460027
704 Ga0157313_1039481
705 Ga0157378_10576726
706 Ga0163162_10197634
707 Ga0157375_10244762
708 Ga0163163_10633659
709 Ga0157379_10091804
710 Ga0157379_10406745
711 Ga0157376_10545282
712 Ga0157376_11021555
713 Ga0214544_1000003
714 Ga0214542_1000003
715 Ga0214542_1032853
716 Ga0214545_1000004
717 Ga0214545_1028276
718 Ga0214543_1000007
719 Ga0214543_1029549
720 Ga0213872_10122908
721 Ga0209677_105081
722 Ga0209233_1002498
723 Ga0209233_1044419
724 Ga0209455_1052279
725 Ga0209564_1006276
726 Ga0209564_1027035
727 Ga0209758_1000015
728 Ga0209758_1000389
729 Ga0209758_1000716
730 Ga0209758_1002865
731 Ga0209758_1017648
732 Ga0209758_1025358
733 Ga0209256_1005691
734 Ga0209256_1025812
735 Ga0209256_1049884
736 Ga0209256_1057471
737 Ga0207426_1000380
738 Ga0209257_1001378
739 Ga0209257_1044825
740 Ga0207680_10027920
741 Ga0207680_10142068
742 Ga0207705_10096495
743 Ga0207654_10127875
744 Ga0207671_10050592
745 Ga0207693_10083893
746 Ga0207663_10272809
747 Ga0207681_10279547
748 Ga0207650_10003204
749 Ga0207659_10337996
750 Ga0207687_10179603
751 Ga0207700_10132850
752 Ga0207690_10521391
753 Ga0207706_10062646
754 Ga0207706_10304329
755 Ga0207709_10047359
756 Ga0207709_11257204
757 Ga0207704_11229852
758 Ga0207711_10046798
759 Ga0207711_10402571
760 Ga0207711_11212028
761 Ga0207679_10475945
762 Ga0207667_10112155
763 Ga0207651_10085933
764 Ga0207651_10376077
765 Ga0207712_10330194
766 Ga0207640_10392861
767 Ga0207640_10921070
768 Ga0207640_11162428
769 Ga0207658_10064582
770 Ga0207658_10229935
771 Ga0207703_10218921
772 Ga0207703_10508939
773 Ga0207678_10062487
774 Ga0207702_10303997
775 Ga0207674_10084709
776 Ga0207675_100129979
777 Ga0207683_10146552
778 Ga0207683_10500482
779 Ga0207698_10225005
780 Ga0209389_1000168
781 Ga0209389_1000180
782 Ga0209589_1000570
783 Ga0209489_101190
784 Ga0209489_101411
785 Ga0209700_101443
786 Ga0209179_1008423
787 Ga0209813_10063909
788 Ga0268266_10967657
789 Ga0268265_10163303
790 Ga0265763_1000013
791 Ga0307509_10204518
792 Ga0307509_10359703
793 Ga0307516_10045493
794 Ga0307507_10246811
795 Ga0307507_10269357
796 Ga0307510_10003428
797 Ga0307510_10225330
798 Ga0373926_0171735
799 Ga0373932_0020615
800 Ga0373957_0181841
801 Ga0373942_0016557
802 Ga0373924_0009815
803 Ga0373927_0004873
804 Ga0373947_0286618
805 Ga0373947_0370019
806 Ga0373937_0731512
807 Ga0373925_0323558
808 Ga0395900_0946680
809 Ga0395898_0082704
810 Ga0395898_1753443
811 Ga0395905_0003588
812 Ga0436361_0094554
813 Ga0451833_0840840
814 Ga0451839_0659138
815 Ga0451841_0738847
816 Ga0451851_1165506
817 Ga0451853_1357962
818 Ga0451853_3641322
819 Ga0466972_0000171
820 Ga0466972_0025721
821 Ga0466972_0216955
822 Ga0466965_0052729
823 Ga0466965_0486853
824 Ga0466966_0000287
825 Ga0466961_0000126
826 Ga0466961_0331220
827 Ga0466968_0198499
828 Ga0466957_0076676
829 Ga0466960_0006686
830 Ga0466960_0041824
831 Ga0466960_0232945
832 Ga0466959_0020395
833 Ga0466959_0803358
834 Ga0466958_0202052
835 Ga0466958_0452251
836 Ga0466967_0004486
837 Ga0495592_0386792
838 Ga0495603_0021121
839 Ga0495590_0117663
840 Ga0495629_0054362
841 Ga0495638_0010811
842 Ga0495638_0570612
843 Ga0495651_0093991
844 Ga0495651_0172561
845 Ga0495580_0008346
846 Ga0495582_0367627
847 Ga0495607_0164954
848 Ga0495583_0037327
849 Ga0495583_0276392
850 Ga0495606_0024173
851 Ga0495606_0034507
852 Ga0495608_0074506
853 Ga0495616_0010409
854 Ga0495616_0103993
855 Ga0495618_0044059
856 Ga0495620_0050452
857 Ga0495643_0013979
858 Ga0495643_0064463
859 Ga0495643_0122069
860 Ga0495648_0014992
861 Ga0495648_0116319
862 Ga0495648_0224470
863 Ga0495652_0096736
864 Ga0495652_0631404
865 Ga0495654_0146651
866 Ga0495640_0045011
867 Ga0495587_0110409
868 Ga0495587_0571272
869 Ga0495609_0251023
870 Ga0495645_0053120
871 Ga0495622_0048120
872 Ga0495622_0089832
873 Ga0495622_0126864
874 Ga0495668_0110649
875 Ga0495668_0179090
876 Ga0495611_0098482
877 Ga0495625_0077978
878 Ga0495635_0001988
879 Ga0495661_0202025
880 Ga0495588_0001753
881 Ga0495588_0178348
882 Ga0495657_0065232
883 Ga0495623_0168357
884 Ga0495646_0042185
885 Ga0495647_0229756
886 Ga0495658_0004453
887 Ga0495613_0037355
888 Ga0495613_0373643
889 Ga0495624_0033063
890 Ga0495649_0010914
891 Ga0495649_0295697
892 Ga0495600_0035626
893 Ga0495600_0246452
894 Ga0495581_0109662
895 Ga0495581_0119932
896 Ga0495604_0068754
897 Ga0495604_0210012
898 Ga0495674_0397542
899 Ga0495676_0048463
900 Ga0495676_0121696
901 Ga0495680_0439198
902 Ga0495683_0062261
903 Ga0495683_0478092
904 Ga0495687_006948
905 Ga0495673_0116222
906 Ga0495673_0162248
907 Ga0495684_0056493
908 Ga0495686_0044642
909 Ga0495593_0016209
910 Ga0495593_0676363
911 Ga0495602_0064489
912 Ga0495626_0202917
913 Ga0496100_0115198
914 Ga0496101_0068702
915 Ga0496101_0614862
916 Ga0496102_0073053
917 Ga0496102_0268143
918 Ga0496102_1068498
919 Ga0496103_0005475
920 Ga0496104_0059026
921 Ga0496104_0069889
922 Ga0496104_0080570
923 Ga0496104_0207397
924 Ga0496104_0610096
925 Ga0496105_0010573
926 Ga0496105_0022265
927 Ga0496105_0184901
928 Ga0496105_0609723
929 Ga0496106_0042271
930 Ga0496106_0062940
931 Ga0496106_0526390
932 Ga0496107_0156896
933 Ga0496108_0697002
934 Ga0496109_0027348
935 Ga0496109_0193921
936 Ga0496109_0194981
937 Ga0496109_0713696
938 Ga0496110_0060520
939 Ga0496110_0061848
940 Ga0496110_0088962
941 Ga0496110_0161223
942 Ga0496111_0033389
943 Ga0496112_0068167
944 Ga0496112_0105810
945 Ga0496112_0125700
946 Ga0496112_0418281
947 Ga0496112_0781555
948 Ga0496112_1081569
949 Ga0496113_0011450
950 Ga0496113_0045302
951 Ga0496113_0370278
952 Ga0496114_0152163
953 Ga0496114_0168518
954 Ga0496115_0139714
955 Ga0496115_0165175
956 Ga0496116_0031279
957 Ga0496116_0169150
958 Ga0496117_0017937
959 Ga0496117_0132028
960 Ga0496117_0311188
961 Ga0496118_0027170
962 Ga0496118_0033432
963 Ga0496118_0040808
964 Ga0496118_0042180
965 Ga0496118_0103003
966 Ga0496119_0007759
967 Ga0496119_0026402
968 Ga0496119_0115093
969 Ga0496120_0015188
970 Ga0496120_0070254
971 Ga0496120_0089055
972 Ga0496121_0098817
973 Ga0496121_0136844
974 Ga0496121_0609059
975 Ga0496122_0214541
976 Ga0496124_0036277
977 Ga0496124_0063999
978 Ga0496124_0083050
979 Ga0496125_0031925
980 Ga0496125_0065468
981 Ga0496126_0065141
982 Ga0496126_0137704
983 Ga0496126_0569063
984 Ga0496126_0943130
985 Ga0495682_0005691
986 Ga0495682_0155829
987 Ga0495682_0359480
988 nmdc:mga03683_145017_c1
989 nmdc:mga03683_91933_c1
990 nmdc:mga03n38_480644_c1
991 nmdc:mga00v17_168701_c1
992 nmdc:mga00v17_72069_c1
993 nmdc:mga0yw44_217340_c1
994 nmdc:mga0yw44_54701_c1
995 nmdc:mga0yw44_553687_c1
996 nmdc:mga0k408_125473_c1
997 nmdc:mga0k408_156025_c1
998 nmdc:mga06z11_316387_c1
999 nmdc:mga06z11_367147_c1
1000 nmdc:mga06z11_532636_c1
1001 nmdc:mga06z11_71508_c1
1002 nmdc:mga07m45_16366_c1
1003 nmdc:mga07m45_44086_c1
1004 nmdc:mga07m45_51014_c1
1005 nmdc:mga0sz30_58048_c1
1006 nmdc:mga0sz30_8769_c1
1007 Ga0495655_0017713
1008 Ga0500578_0044781
1009 Ga0500643_000278
1010 Ga0500643_149799
1011 Ga0500647_0053036
1012 Ga0500583_0001543
1013 Ga0500651_0139891
1014 Ga0500566_0000565
1015 Ga0500566_0226617
1016 Ga0500566_0401536
1017 Ga0500641_0025988
1018 Ga0500650_0046065
1019 Ga0500553_167433
1020 Ga0500556_0007584
1021 Ga0500557_000028
1022 Ga0500562_001440
1023 Ga0500572_021608
1024 Ga0500592_024552
1025 Ga0500595_042565
1026 Ga0500597_355699
1027 Ga0500607_109179
1028 Ga0500618_014440
1029 Ga0500642_0000189
1030 Ga0500642_0412598
1031 Ga0500658_0152459
1032 Ga0500559_0014457
1033 Ga0500559_0020397
1034 Ga0500564_044818
1035 Ga0500568_0006091
1036 Ga0500588_0247774
1037 Ga0500616_0082394
1038 Ga0500620_079198
1039 Ga0500622_0029668
1040 Ga0500634_0240693
1041 Ga0500638_083689
1042 Ga0500638_125751
1043 Ga0500636_0000246
1044 Ga0500636_0142543
1045 Ga0500636_0193797
1046 Ga0500637_0296398
1047 Ga0500625_015809
1048 Ga0500645_006672
1049 Ga0500599_005091
1050 Ga0500587_053969
1051 Ga0500661_031528
1052 2507504743
1053 2508539841
1054 2508695028
1055 2513626673
1056 2513641806
1057 2513648116
1058 2513704763
1059 2513715588
1060 2515627827
1061 2517106975
1062 2528850285
1063 2617374238
1064 2818237168
1065 2824608681
1066 2824612758
1067 2824626360
1068 2824632495
1069 2824643639
1070 2824652525
1071 2824658998
1072 2824670996
1073 2824713200
1074 2824723329
1075 2824732462
1076 2824736943
1077 2824748235
1078 2824760635
1079 2824772026
1080 2841965997
1081 2842044000
1082 2842052011
1083 2847939685
1084 2874591477
1085 2874615560
1086 2874634079
1087 2874647727
1088 2876764545
1089 2876771627
1090 2876826520
1091 2879075441
1092 2879090512
1093 2879101853
1094 2879130669
1095 2879142983
1096 2881364984
1097 2881672306
1098 2885368110
1099 2885410919
1100 2888380123
1101 2888391138
1102 2888420885
1103 2903727736
1104 2904717930
1105 2906602778
1106 2906645051
1107 2908776713
1108 2922378475
1109 2929622436
1110 2929631347
1111 2932786236
1112 2932794805
1113 2932805403
1114 2932812690
1115 2932823052
1116 2932829474
1117 2933584484
1118 2935615060
1119 2935617906
1120 2935641610
1121 2935651588
1122 2935659644
1123 2935669332
1124 2935678072
1125 2935693609
1126 2935702929
1127 2935707155
1128 2935716973
1129 2935730193
1130 2935738412
1131 2935750200
1132 2935759794
1133 2935764555
1134 2935777084
1135 2935777987
1136 2935787192
1137 2935796020
1138 2935804464
1139 2935819135
1140 2935825902
1141 2935831341
1142 2935841950
1143 2935851521
1144 2935856595
1145 2935870210
1146 2935874465
1147 2935887515
1148 2935910458
1149 2935918140
1150 2935927631
1151 2935936497
1152 2935943950
1153 2935952387
1154 2935964256
1155 2935969227
1156 2935978012
1157 2935984688
1158 2935993926
1159 2936005063
1160 2936014060
1161 2936023031
1162 2936031167
1163 2936045714
1164 2936049289
1165 2936055831
1166 2940565752
1167 2941544023
1168 3005509653
1169 3005717799
1170 3005724852
1171 8016518759
1172 8016526709
1173 8016531793
1174 8016544999
1175 8016557074
1176 8016570074
1177 8016582644
1178 8016603061
1179 8016605963
1180 8016617848
1181 8016623726
1182 8016636403
1183 8017057918
1184 8019531623
1185 8019539911
1186 8019550745
1187 8019577806
1188 8019605848
1189 8019612686
1190 8019622435
1191 8019639752
1192 8019651939
1193 8019667860
1194 8019677275
1195 8019678707
1196 8019696809
1197 8055750887
1198 8056975570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

16

130

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

35

138

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

45

132

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.891 2 151
4bmh-assembly1.cif.gz_A crystal structure of sshat 0.8839 71 151
4b11-assembly3.cif.gz_C plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 13) 0.8643 57 114
5g22-assembly3.cif.gz_C plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 26) 0.8635 57 114
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.8566 2 151
ID Description Score Start End Superfamily
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9151 68 142 3.40.630.30
af_Q8N8M0_58_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9019 41 109 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.891 2 151 3.40.630.30
4bmhA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8839 71 151 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8566 2 151 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7D7D9J1-F1-model_v4 deleted 1 61 151
AF-A0A2S8PNJ3-F1-model_v4 GNAT family N-acetyltransferase 0.9967 49 150 GO:0016747
AF-A0A1V5J1X2-F1-model_v4 deleted 0.9957 59 153
AF-A0A561TZ86-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9955 58 150 GO:0016747
AF-A0A7I8E5N1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9925 48 150 GO:0016747

Map