F467883

General Info

Members Datasets Scaffolds Average Seq Length
599 443 1198 120

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10237992|Ga0307515_102379923
Length 117
Sequence MPSRSTVEAFVKLVEAGDYVGAIEQFYAADASTRENAAEPVVGRDALVAKERGVMASFARIEASRIGPSLIDGDTVAARWNSRSPAPTSLEEIAWQSWRGEQLIEERFFYDPRQMAA

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
52 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
53 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
54 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
66 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
81 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
82 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
83 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
125 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
126 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
127 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
241 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
242 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
243 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
246 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
247 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
248 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
249 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
250 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
251 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
252 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
258 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
259 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
260 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
266 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
267 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
268 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
269 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
270 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
271 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
272 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
273 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
274 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
275 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
276 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
277 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
278 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
279 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
280 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
281 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
282 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
283 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
284 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
285 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
286 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
287 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
288 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
289 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
290 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
291 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
292 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
293 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
294 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
295 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
296 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
297 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
298 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
299 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
300 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
301 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
302 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
303 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
304 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
305 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
306 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
307 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
308 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
309 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
310 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
311 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
312 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
313 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
314 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
315 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
316 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
317 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
318 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
319 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
320 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
321 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
322 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
323 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
324 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
325 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
326 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
327 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
328 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
329 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
330 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
331 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
332 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
333 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
334 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
335 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
336 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
337 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
338 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
339 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
340 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
341 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
342 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
343 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
344 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
345 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
346 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
347 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
348 2922368715
349 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
350 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
351 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
352 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
353 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
354 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
355 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
356 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
357 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
358 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
359 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
360 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
361 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
362 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
363 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
364 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
365 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
366 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
367 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
368 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
369 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
370 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
371 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
372 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
373 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
374 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
375 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
376 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
377 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
378 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
379 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
380 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
381 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
382 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
383 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
384 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
385 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
386 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
387 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
388 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
389 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
390 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
391 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
392 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
393 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
394 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
395 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
396 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
397 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
398 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
399 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
400 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
401 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
402 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
403 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
404 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
405 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
406 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
407 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
408 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
409 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
410 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
411 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
412 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
413 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
414 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
415 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
416 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
417 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
418 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
419 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
420 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
421 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
422 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
423 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
424 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
425 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
426 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
427 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
428 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
429 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
430 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
431 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
432 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
433 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
434 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
435 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
436 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
437 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
438 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
439 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
440 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
441 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
442 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
443 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.24
Metatranscriptomes 0
Isolates 28.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.04
Nodule 25.04
Rhizoplane 4.34
Rhizosphere 36.39
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10237992 3300028794 Bacteria 1598
2 JGI24739J22299_10177455 3300001989 Bacteria 627
3 JGI24735J21928_10130646 3300002067 Bacteria 724
4 JGI25165J46597_1012461 3300003214 Bacteria 1188
5 JGI25153J46596_10000990 3300003215 Bacteria 17268
6 JGI25153J46596_10005836 3300003215 Bacteria 6396
7 JGI25153J46596_10022175 3300003215 Bacteria 2348
8 rootH1_10061168 3300003316 Bacteria 1479
9 rootH1_10056275 3300003323 Bacteria 1262
10 JGI25160J50197_1000785 3300003354 Bacteria 17040
11 JGI25160J50197_1018184 3300003354 Bacteria 2198
12 Ga0055526_1031983 3300003771 Bacteria 1495
13 Ga0055531_10072067 3300003794 Bacteria 793
14 Ga0055543_1005393 3300004625 Bacteria 3271
15 Ga0065165_1001118 3300005262 Bacteria 31690
16 Ga0065165_1001953 3300005262 Bacteria 19545
17 Ga0065165_1006666 3300005262 Bacteria 5960
18 Ga0065165_1039596 3300005262 Bacteria 1410
19 Ga0065165_1078449 3300005262 Bacteria 862
20 Ga0070658_10077807 3300005327 Bacteria 2721
21 Ga0070676_10350330 3300005328 Bacteria 1015
22 Ga0070682_100232423 3300005337 Bacteria 1319
23 Ga0070660_100460466 3300005339 Bacteria 1056
24 Ga0070669_100228739 3300005353 Bacteria 1473
25 Ga0070671_100947895 3300005355 Bacteria 753
26 Ga0070673_101813631 3300005364 Bacteria 578
27 Ga0070667_101005764 3300005367 Bacteria 778
28 Ga0070714_100047143 3300005435 Bacteria 3660
29 Ga0070714_101792078 3300005435 Bacteria 599
30 Ga0070713_100115258 3300005436 Bacteria 2348
31 Ga0070713_101316511 3300005436 Bacteria 700
32 Ga0070663_100534859 3300005455 Bacteria 977
33 Ga0070663_101087622 3300005455 Bacteria 698
34 Ga0070663_101321764 3300005455 Bacteria 636
35 Ga0070662_100025690 3300005457 Bacteria 4070
36 Ga0068867_100387877 3300005459 Bacteria 1175
37 Ga0068853_100485110 3300005539 Bacteria 1165
38 Ga0068853_101748530 3300005539 Bacteria 603
39 Ga0068853_102362715 3300005539 Bacteria 515
40 Ga0070665_100091620 3300005548 Bacteria 3045
41 Ga0070665_100398128 3300005548 Bacteria 1385
42 Ga0070665_100762459 3300005548 Bacteria 980
43 Ga0068855_100611102 3300005563 Bacteria 1175
44 Ga0070664_101302768 3300005564 Bacteria 686
45 Ga0070664_101863040 3300005564 Bacteria 571
46 Ga0068857_102551489 3300005577 Bacteria 502
47 Ga0068854_100287538 3300005578 Bacteria 1326
48 Ga0068856_100051719 3300005614 Bacteria 4050
49 Ga0068856_100943253 3300005614 Bacteria 881
50 Ga0068852_100290720 3300005616 Bacteria 1579
51 Ga0068852_100772366 3300005616 Bacteria 974
52 Ga0068852_101524980 3300005616 Bacteria 691
53 Ga0068852_101762786 3300005616 Bacteria 642
54 Ga0068859_100469697 3300005617 Bacteria 1354
55 Ga0068861_100083062 3300005719 Bacteria 2512
56 Ga0068863_100528198 3300005841 Bacteria 1164
57 Ga0068858_100355946 3300005842 Bacteria 1403
58 Ga0068858_100569888 3300005842 Bacteria 1097
59 Ga0068862_100463929 3300005844 Bacteria 1196
60 Ga0081540_1148724 3300005983 Bacteria 928
61 Ga0075365_10205950 3300006038 Bacteria 1379
62 Ga0075365_10231447 3300006038 Bacteria 1297
63 Ga0075365_10860965 3300006038 Bacteria 639
64 Ga0075365_10925602 3300006038 Bacteria 614
65 Ga0075368_10012597 3300006042 Bacteria 3095
66 Ga0075368_10302632 3300006042 Bacteria 690
67 Ga0075363_100359826 3300006048 Bacteria 851
68 Ga0075363_100399511 3300006048 Bacteria 808
69 Ga0075363_100579651 3300006048 Bacteria 671
70 Ga0075364_10025542 3300006051 Bacteria 3760
71 Ga0075364_10027669 3300006051 Bacteria 3623
72 Ga0070716_100172515 3300006173 Bacteria 1413
73 Ga0075362_10084431 3300006177 Bacteria 1467
74 Ga0075367_10009217 3300006178 Bacteria 5150
75 Ga0075367_10164628 3300006178 Bacteria 1380
76 Ga0075369_10041095 3300006186 Bacteria 1979
77 Ga0075369_10289762 3300006186 Bacteria 763
78 Ga0075366_10009640 3300006195 Bacteria 5397
79 Ga0075370_10083071 3300006353 Bacteria 1842
80 Ga0075370_10106100 3300006353 Bacteria 1629
81 Ga0075370_10114549 3300006353 Bacteria 1567
82 Ga0097620_100469725 3300006931 Bacteria 1354
83 Ga0099825_1029437 3300006941 Bacteria 2549
84 Ga0099824_1009235 3300006942 Bacteria 12233
85 Ga0099824_1069773 3300006942 Bacteria 519
86 Ga0099822_1012535 3300006943 Bacteria 10122
87 Ga0099822_1109043 3300006943 Bacteria 544
88 Ga0099823_1004520 3300006944 Bacteria 13620
89 Ga0105251_10463386 3300009011 Bacteria 589
90 Ga0105240_10245735 3300009093 Bacteria 2072
91 Ga0105240_10283166 3300009093 Bacteria 1903
92 Ga0105240_10421185 3300009093 Bacteria 1500
93 Ga0105240_10927493 3300009093 Bacteria 935
94 Ga0105245_10283442 3300009098 Bacteria 1620
95 Ga0105247_10006166 3300009101 Bacteria 7440
96 Ga0105243_11526621 3300009148 Bacteria 692
97 Ga0105241_10260899 3300009174 Bacteria 1472
98 Ga0105241_10431708 3300009174 Bacteria 1162
99 Ga0105241_11199286 3300009174 Bacteria 719
100 Ga0105248_10190665 3300009177 Bacteria 2310
101 Ga0105248_11119831 3300009177 Bacteria 890
102 Ga0105237_10033263 3300009545 Bacteria 5223
103 Ga0105237_10189485 3300009545 Bacteria 2057
104 Ga0105237_10232630 3300009545 Bacteria 1844
105 Ga0105237_10365778 3300009545 Bacteria 1447
106 Ga0105237_10478147 3300009545 Bacteria 1252
107 Ga0105237_10832740 3300009545 Bacteria 929
108 Ga0105237_11000389 3300009545 Bacteria 843
109 Ga0105238_10076557 3300009551 Bacteria 3337
110 Ga0105238_10081164 3300009551 Bacteria 3232
111 Ga0105238_10310131 3300009551 Bacteria 1563
112 Ga0105238_10743304 3300009551 Bacteria 994
113 Ga0105238_11068299 3300009551 Bacteria 829
114 Ga0105239_10041315 3300010375 Bacteria 5055
115 Ga0105239_10090186 3300010375 Bacteria 3382
116 Ga0105239_10712196 3300010375 Bacteria 1148
117 Ga0105239_10963594 3300010375 Bacteria 980
118 Ga0105239_11087730 3300010375 Bacteria 920
119 Ga0157325_1030258 3300012485 Bacteria 539
120 Ga0157314_1029200 3300012500 Bacteria 610
121 Ga0157370_11274123 3300013104 Bacteria 662
122 Ga0157369_10555496 3300013105 Bacteria 1186
123 Ga0157374_10165527 3300013296 Bacteria 2155
124 Ga0157378_10144017 3300013297 Bacteria 2215
125 Ga0163162_10361779 3300013306 Bacteria 1584
126 Ga0157375_12935804 3300013308 Bacteria 570
127 Ga0163163_10015031 3300014325 Bacteria 7137
128 Ga0163163_10036772 3300014325 Bacteria 4758
129 Ga0163163_11320045 3300014325 Bacteria 783
130 Ga0157380_12699323 3300014326 Bacteria 563
131 Ga0157377_10232829 3300014745 Bacteria 1185
132 Ga0157379_10223994 3300014968 Bacteria 1704
133 Ga0157376_10534743 3300014969 Bacteria 1157
134 Ga0182006_1217741 3300015261 Bacteria 630
135 Ga0182007_10270628 3300015262 Bacteria 615
136 Ga0214544_1000053 3300021320 Bacteria 133908
137 Ga0214544_1033677 3300021320 Bacteria 1490
138 Ga0214542_1000058 3300021321 Bacteria 133923
139 Ga0214542_1035853 3300021321 Bacteria 1506
140 Ga0214542_1040406 3300021321 Bacteria 1198
141 Ga0214545_1000026 3300021324 Bacteria 133811
142 Ga0214545_1045082 3300021324 Bacteria 1025
143 Ga0214543_1002325 3300021327 Bacteria 37311
144 Ga0214543_1044773 3300021327 Bacteria 1025
145 Ga0209677_102085 3300025253 Bacteria 7892
146 Ga0209677_130488 3300025253 Bacteria 549
147 Ga0209233_1004790 3300025261 Bacteria 4559
148 Ga0209233_1009079 3300025261 Bacteria 3043
149 Ga0209233_1010690 3300025261 Bacteria 2736
150 Ga0209673_1037066 3300025273 Bacteria 1437
151 Ga0209564_1003388 3300025295 Bacteria 10986
152 Ga0209758_1000940 3300025297 Bacteria 39289
153 Ga0209758_1001235 3300025297 Bacteria 31935
154 Ga0209758_1001336 3300025297 Bacteria 29877
155 Ga0209758_1035794 3300025297 Bacteria 1950
156 Ga0209758_1043145 3300025297 Bacteria 1664
157 Ga0209758_1084131 3300025297 Bacteria 952
158 Ga0209256_1046720 3300025299 Bacteria 1069
159 Ga0209256_1079137 3300025299 Bacteria 722
160 Ga0207426_1000505 3300025302 Bacteria 57583
161 Ga0207426_1000551 3300025302 Bacteria 51985
162 Ga0207426_1010417 3300025302 Bacteria 3606
163 Ga0207426_1033314 3300025302 Bacteria 1662
164 Ga0207426_1041285 3300025302 Bacteria 1431
165 Ga0207426_1112002 3300025302 Bacteria 686
166 Ga0209051_1107868 3300025303 Bacteria 733
167 Ga0209257_1010303 3300025304 Bacteria 4757
168 Ga0209257_1028282 3300025304 Bacteria 1848
169 Ga0207697_10113825 3300025315 Bacteria 1159
170 Ga0207710_10046991 3300025900 Bacteria 1928
171 Ga0207688_10034401 3300025901 Bacteria 2806
172 Ga0207680_10624714 3300025903 Bacteria 771
173 Ga0207647_10017373 3300025904 Bacteria 4890
174 Ga0207647_10818210 3300025904 Bacteria 500
175 Ga0207705_10310850 3300025909 Bacteria 1210
176 Ga0207654_10355727 3300025911 Bacteria 1009
177 Ga0207654_10538564 3300025911 Bacteria 828
178 Ga0207695_10000157 3300025913 Bacteria 204140
179 Ga0207695_10479550 3300025913 Bacteria 1126
180 Ga0207671_10019698 3300025914 Bacteria 5153
181 Ga0207671_10082854 3300025914 Bacteria 2408
182 Ga0207671_10560573 3300025914 Bacteria 911
183 Ga0207671_10743372 3300025914 Bacteria 779
184 Ga0207657_10429272 3300025919 Bacteria 1038
185 Ga0207681_10050677 3300025923 Bacteria 2810
186 Ga0207681_10777062 3300025923 Bacteria 799
187 Ga0207694_10105816 3300025924 Bacteria 2234
188 Ga0207694_10331961 3300025924 Bacteria 1256
189 Ga0207687_10358224 3300025927 Bacteria 1190
190 Ga0207700_10414400 3300025928 Bacteria 1182
191 Ga0207664_10149347 3300025929 Bacteria 1984
192 Ga0207644_10996024 3300025931 Bacteria 703
193 Ga0207706_10021004 3300025933 Bacteria 5865
194 Ga0207706_10412232 3300025933 Bacteria 1171
195 Ga0207709_11206178 3300025935 Bacteria 624
196 Ga0207711_11185663 3300025941 Bacteria 705
197 Ga0207679_10151736 3300025945 Bacteria 1887
198 Ga0207679_10397368 3300025945 Bacteria 1212
199 Ga0207651_10293247 3300025960 Bacteria 1350
200 Ga0207668_10066448 3300025972 Bacteria 2556
201 Ga0207658_10499100 3300025986 Bacteria 1084
202 Ga0207703_10243111 3300026035 Bacteria 1619
203 Ga0207639_10350534 3300026041 Bacteria 1318
204 Ga0207678_10012283 3300026067 Bacteria 7520
205 Ga0207678_10264682 3300026067 Bacteria 1474
206 Ga0207641_10254196 3300026088 Bacteria 1642
207 Ga0207648_10202056 3300026089 Bacteria 1762
208 Ga0207674_10179123 3300026116 Bacteria 2071
209 Ga0207675_100198384 3300026118 Bacteria 1927
210 Ga0207698_10789053 3300026142 Bacteria 951
211 Ga0209389_1000073 3300027296 Bacteria 94298
212 Ga0209389_1000160 3300027296 Bacteria 56126
213 Ga0209589_1000484 3300027357 Bacteria 56126
214 Ga0209489_100917 3300027361 Bacteria 58978
215 Ga0209489_100982 3300027361 Bacteria 57399
216 Ga0209700_100067 3300027363 Bacteria 144074
217 Ga0209813_10213747 3300027866 Bacteria 719
218 Ga0209813_10421929 3300027866 Bacteria 541
219 Ga0268266_10020435 3300028379 Bacteria 5644
220 Ga0268266_10645845 3300028379 Bacteria 1018
221 Ga0268264_10972846 3300028381 Bacteria 854
222 Ga0307408_100084723 3300031548 Bacteria 2378
223 Ga0307508_10144174 3300031616 Bacteria 1986
224 Ga0307406_10140924 3300031901 Bacteria 1707
225 Ga0307416_101033517 3300032002 Bacteria 925
226 Ga0307510_10003822 3300033180 Bacteria 17640
227 Ga0307510_10445903 3300033180 Bacteria 735
228 Ga0395900_0001197 3300037418 Bacteria 32092
229 Ga0395898_0021814 3300037466 Bacteria 6488
230 Ga0395905_0012364 3300037471 Bacteria 8219
231 Ga0395905_0198205 3300037471 Bacteria 1883
232 Ga0436364_0765141 3300037853 Bacteria 1054
233 Ga0395901_0313141 3300038443 Bacteria 1625
234 Ga0395901_1379257 3300038443 Bacteria 664
235 Ga0436365_1886166 3300039437 Bacteria 714
236 Ga0451791_0930378 3300041451 Bacteria 613
237 Ga0451800_0970108 3300041459 Bacteria 618
238 Ga0451802_2073304 3300041460 Unclassified 512
239 Ga0451833_1302643 3300041491 Bacteria 679
240 Ga0451837_1451563 3300041494 Bacteria 700
241 Ga0451839_0574709 3300041496 Bacteria 512
242 Ga0451845_0330887 3300041501 Bacteria 596
243 Ga0451843_0617396 3300041509 Bacteria 621
244 Ga0451853_3445968 3300041512 Bacteria 527
245 Ga0451853_3866649 3300041512 Bacteria 779
246 Ga0466972_0030064 3300044658 Bacteria 2674
247 Ga0466972_0091249 3300044658 Bacteria 1444
248 Ga0466972_0145279 3300044658 Bacteria 1116
249 Ga0466972_0484422 3300044658 Bacteria 582
250 Ga0466965_0042101 3300044683 Bacteria 2251
251 Ga0466966_0000763 3300044684 Bacteria 20420
252 Ga0466961_0000505 3300044693 Bacteria 24872
253 Ga0466960_0119874 3300044901 Bacteria 1377
254 Ga0466959_0001470 3300045049 Bacteria 14447
255 Ga0466959_0818601 3300045049 Bacteria 622
256 Ga0466958_0014418 3300045836 Bacteria 4514
257 Ga0495592_0295463 3300046454 Bacteria 1055
258 Ga0495603_0160755 3300046455 Bacteria 1303
259 Ga0495590_0039281 3300046457 Bacteria 1651
260 Ga0495629_0010214 3300046459 Bacteria 6840
261 Ga0495629_0238737 3300046459 Bacteria 1252
262 Ga0495638_0026478 3300046460 Bacteria 3758
263 Ga0495651_0139825 3300046462 Bacteria 1757
264 Ga0495650_0094294 3300046471 Bacteria 1133
265 Ga0495605_0021137 3300046474 Bacteria 3451
266 Ga0495605_0341644 3300046474 Bacteria 629
267 Ga0495664_0111577 3300046477 Bacteria 1650
268 Ga0495664_0201862 3300046477 Bacteria 1205
269 Ga0495583_0140220 3300046506 Bacteria 1007
270 Ga0495606_0189460 3300046507 Bacteria 1180
271 Ga0495628_0116695 3300046516 Bacteria 2050
272 Ga0495628_0122726 3300046516 Bacteria 1992
273 Ga0495630_0124025 3300046517 Bacteria 1960
274 Ga0495631_0084057 3300046518 Bacteria 1372
275 Ga0495631_0352848 3300046518 Bacteria 626
276 Ga0495632_0286372 3300046519 Bacteria 733
277 Ga0495643_0027375 3300046522 Bacteria 3205
278 Ga0495648_0118514 3300046524 Bacteria 1427
279 Ga0495648_0129194 3300046524 Bacteria 1346
280 Ga0495648_0448440 3300046524 Bacteria 565
281 Ga0495652_0036220 3300046529 Bacteria 4292
282 Ga0495652_0188747 3300046529 Bacteria 1575
283 Ga0495652_1132004 3300046529 Bacteria 507
284 Ga0495609_0125852 3300046538 Bacteria 1100
285 Ga0495597_0043981 3300046542 Bacteria 1987
286 Ga0495597_0110661 3300046542 Bacteria 1152
287 Ga0495622_0047727 3300046557 Bacteria 1990
288 Ga0495622_0106994 3300046557 Bacteria 1281
289 Ga0495668_0141188 3300046616 Bacteria 1318
290 Ga0495634_0044022 3300046642 Bacteria 3023
291 Ga0495611_0134738 3300046648 Bacteria 1153
292 Ga0495625_0625270 3300046660 Bacteria 644
293 Ga0495635_0078466 3300046663 Bacteria 2260
294 Ga0495588_0049166 3300046674 Bacteria 2168
295 Ga0495623_0732769 3300046679 Bacteria 504
296 Ga0495613_0018266 3300046689 Bacteria 5229
297 Ga0495624_0119314 3300046690 Bacteria 1620
298 Ga0495624_0153903 3300046690 Bacteria 1406
299 Ga0495671_0188631 3300046692 Bacteria 1001
300 Ga0495600_0082143 3300046809 Bacteria 2103
301 Ga0495581_0076024 3300047315 Bacteria 1943
302 Ga0495604_0099607 3300047317 Bacteria 2138
303 Ga0495604_0247657 3300047317 Bacteria 1216
304 Ga0495676_0136292 3300047321 Bacteria 1765
305 Ga0495683_0025138 3300047323 Bacteria 3054
306 Ga0495687_086298 3300047443 Bacteria 1214
307 Ga0495677_0133261 3300047445 Bacteria 952
308 Ga0495673_0096039 3300047469 Bacteria 1205
309 Ga0495673_0161932 3300047469 Bacteria 858
310 Ga0495686_0033621 3300047472 Bacteria 3309
311 Ga0495686_0084446 3300047472 Bacteria 1935
312 Ga0495602_0087737 3300048088 Bacteria 2592
313 Ga0496100_0529875 3300048903 Bacteria 910
314 Ga0496101_1342614 3300048904 Bacteria 558
315 Ga0496102_0016403 3300048905 Bacteria 6469
316 Ga0496102_1408734 3300048905 Bacteria 616
317 Ga0496103_0224625 3300048906 Bacteria 1207
318 Ga0496104_0072614 3300048907 Bacteria 3272
319 Ga0496104_0259904 3300048907 Bacteria 1649
320 Ga0496104_0452107 3300048907 Bacteria 1196
321 Ga0496104_0820988 3300048907 Bacteria 836
322 Ga0496105_0016524 3300048908 Bacteria 5893
323 Ga0496105_0065363 3300048908 Bacteria 3002
324 Ga0496105_0105238 3300048908 Bacteria 2329
325 Ga0496109_0063162 3300048912 Bacteria 3387
326 Ga0496109_0569694 3300048912 Bacteria 1068
327 Ga0496110_1777099 3300048913 Bacteria 527
328 Ga0496111_0211396 3300048914 Bacteria 1441
329 Ga0496112_0479147 3300048915 Bacteria 1181
330 Ga0496112_0554337 3300048915 Bacteria 1083
331 Ga0496113_0055283 3300048916 Bacteria 2975
332 Ga0496113_0089928 3300048916 Bacteria 2364
333 Ga0496113_0772422 3300048916 Bacteria 764
334 Ga0496115_0187283 3300048918 Bacteria 1710
335 Ga0496115_0432435 3300048918 Bacteria 1065
336 Ga0496116_0029305 3300048919 Bacteria 3971
337 Ga0496117_0262687 3300048920 Bacteria 935
338 Ga0496117_0348260 3300048920 Bacteria 766
339 Ga0496118_0040801 3300048921 Bacteria 3685
340 Ga0496118_0276709 3300048921 Bacteria 937
341 Ga0496118_0354775 3300048921 Bacteria 780
342 Ga0496119_0104854 3300048922 Bacteria 1580
343 Ga0496119_0116685 3300048922 Bacteria 1473
344 Ga0496119_0267104 3300048922 Bacteria 856
345 Ga0496119_0437236 3300048922 Bacteria 618
346 Ga0496121_0019242 3300048924 Bacteria 6838
347 Ga0496122_0129303 3300048925 Bacteria 1609
348 Ga0496124_0202815 3300048927 Bacteria 1507
349 Ga0496124_0222712 3300048927 Bacteria 1417
350 Ga0496125_0017068 3300048928 Bacteria 6936
351 Ga0496125_0257907 3300048928 Bacteria 1095
352 Ga0496125_0667378 3300048928 Bacteria 557
353 Ga0496126_0032039 3300048929 Bacteria 4958
354 Ga0496126_0036964 3300048929 Bacteria 4561
355 Ga0496126_0370478 3300048929 Bacteria 1168
356 Ga0496126_0411239 3300048929 Bacteria 1095
357 Ga0501081_1372400 3300049743 Bacteria 536
358 nmdc:mga03683_96289_c1 3300050489 Bacteria 1296
359 nmdc:mga03n38_362334_c1 3300050490 Bacteria 791
360 nmdc:mga03n38_432316_c1 3300050490 Bacteria 729
361 nmdc:mga00v17_10981_c1 3300050491 Bacteria 4964
362 nmdc:mga00v17_421492_c1 3300050491 Bacteria 867
363 nmdc:mga0yw44_25549_c2 3300050492 Bacteria 3006
364 nmdc:mga0yw44_33924_c1 3300050492 Bacteria 2986
365 nmdc:mga0yw44_979258_c1 3300050492 Bacteria 573
366 nmdc:mga0k408_34696_c1 3300050493 Bacteria 2889
367 nmdc:mga06z11_18296_c1 3300050494 Bacteria 3198
368 nmdc:mga06z11_391130_c1 3300050494 Bacteria 836
369 nmdc:mga07m45_197189_c1 3300050496 Bacteria 1171
370 nmdc:mga07m45_416338_c1 3300050496 Bacteria 780
371 nmdc:mga07m45_90892_c1 3300050496 Bacteria 1749
372 nmdc:mga0sz30_18214_c2 3300050516 Bacteria 1892
373 nmdc:mga0sz30_228529_c1 3300050516 Bacteria 828
374 nmdc:mga0sz30_43401_c1 3300050516 Bacteria 1893
375 Ga0495601_0172733 3300053077 Bacteria 1413
376 Ga0500610_0101309 3300053079 Bacteria 1490
377 Ga0500635_0314477 3300053080 Bacteria 619
378 Ga0495619_0061682 3300053085 Bacteria 2495
379 Ga0495619_0717447 3300053085 Bacteria 679
380 Ga0500578_0079398 3300053086 Bacteria 2088
381 Ga0500578_0254744 3300053086 Bacteria 1056
382 Ga0500578_0311959 3300053086 Bacteria 930
383 Ga0500643_002338 3300053087 Bacteria 9915
384 Ga0500643_137218 3300053087 Bacteria 657
385 Ga0500647_0055637 3300053091 Bacteria 1903
386 Ga0500583_0015567 3300053092 Bacteria 3012
387 Ga0500651_0199805 3300053093 Bacteria 1180
388 Ga0500566_0000057 3300053094 Bacteria 53723
389 Ga0500641_0011132 3300053096 Bacteria 3262
390 Ga0500650_0075578 3300053098 Bacteria 1575
391 Ga0500555_103875 3300053103 Bacteria 719
392 Ga0500556_0050560 3300053104 Bacteria 1502
393 Ga0500557_000106 3300053105 Bacteria 25501
394 Ga0500562_011057 3300053108 Bacteria 2290
395 Ga0500569_019729 3300053109 Bacteria 1758
396 Ga0500592_057249 3300053116 Bacteria 636
397 Ga0500595_008936 3300053119 Bacteria 4070
398 Ga0500595_105940 3300053119 Bacteria 803
399 Ga0500607_045561 3300053121 Bacteria 2353
400 Ga0500608_094152 3300053122 Bacteria 1396
401 Ga0500621_299290 3300053126 Bacteria 516
402 Ga0500642_0000068 3300053130 Bacteria 56277
403 Ga0500642_0295128 3300053130 Bacteria 733
404 Ga0500655_009544 3300053133 Bacteria 1751
405 Ga0500658_0045763 3300053134 Bacteria 1770
406 Ga0500559_0157842 3300053136 Bacteria 1065
407 Ga0500559_0464071 3300053136 Bacteria 584
408 Ga0500564_249059 3300053138 Bacteria 705
409 Ga0500568_0006872 3300053139 Bacteria 5661
410 Ga0500577_0392192 3300053142 Bacteria 607
411 Ga0500577_0423333 3300053142 Bacteria 582
412 Ga0500588_0027209 3300053146 Bacteria 1609
413 Ga0500588_0366722 3300053146 Bacteria 548
414 Ga0500590_064178 3300053148 Bacteria 1839
415 Ga0500590_167877 3300053148 Bacteria 969
416 Ga0500619_010990 3300053154 Bacteria 2312
417 Ga0500622_0186904 3300053156 Bacteria 952
418 Ga0500627_0039928 3300053158 Bacteria 2012
419 Ga0500638_109080 3300053162 Bacteria 1281
420 Ga0500636_0000059 3300053177 Bacteria 52601
421 Ga0500649_031233 3300053722 Bacteria 2230
422 Ga0500625_012566 3300053729 Bacteria 3873
423 Ga0500609_003163 3300053731 Bacteria 2329
424 Ga0500599_027934 3300053736 Bacteria 828
425 Ga0500601_000757 3300053737 Bacteria 4171
426 Ga0500661_019851 3300055283 Bacteria 1196
427 2507507113 2507262055 Bacteria 8048963
428 2508541164 2508501009 Bacteria 7784016
429 2508693500 2508501042 Bacteria 8719808
430 2511398533 2511231028 Bacteria 8046582
431 2513626327 2513237092 Bacteria 8341956
432 2513637276 2513237094 Bacteria 8789602
433 2513651661 2513237095 Bacteria 8976980
434 2513717373 2513237104 Bacteria 10034502
435 2513876824 2513237139 Bacteria 8737671
436 2514012138 2513237161 Bacteria 8871253
437 2515628858 2515154112 Bacteria 8294334
438 2517107417 2517093001 Bacteria 9002274
439 2524439506 2524023205 Bacteria 8918781
440 2528850968 2528768022 Bacteria 10457665
441 2617348069 2617270735 Bacteria 9163226
442 2617377700 2617270741 Bacteria 8201522
443 2745078217 2744054633 Bacteria 8678936
444 2793064388 2791355196 Bacteria 7323613
445 2805918804 2802429603 Bacteria 8777136
446 2818243195 2816332527 Bacteria 8933356
447 2824609070 2824600985 Bacteria 8488197
448 2824614780 2824609381 Bacteria 8672835
449 2824622655 2824617872 Bacteria 8814715
450 2824631818 2824626560 Bacteria 8813858
451 2824643004 2824635225 Bacteria 8785348
452 2824651134 2824644064 Bacteria 8743947
453 2824660998 2824653114 Bacteria 8493680
454 2824670491 2824661429 Bacteria 9877870
455 2824673964 2824671348 Bacteria 8369588
456 2824686834 2824679649 Bacteria 8248951
457 2824690588 2824687955 Bacteria 8360029
458 2824698109 2824696289 Bacteria 8335049
459 2824713742 2824704595 Bacteria 9667483
460 2824719928 2824714736 Bacteria 8717648
461 2824739394 2824732956 Bacteria 7810675
462 2824746383 2824746037 Bacteria 7911610
463 2824759292 2824753945 Bacteria 9787441
464 2824769600 2824763712 Bacteria 9792355
465 2824776180 2824773399 Bacteria 8360218
466 2838126961 2838122688 Bacteria 8803140
467 2841945558 2841941048 Bacteria 8688029
468 2841954775 2841949485 Bacteria 8680857
469 2841972441 2841966195 Bacteria 8673214
470 2841980525 2841974524 Bacteria 8931498
471 2841988696 2841983080 Bacteria 8395090
472 2842044985 2842038055 Bacteria 8002051
473 2842052829 2842045827 Bacteria 8006841
474 2847938116 2847930680 Bacteria 9342022
475 2847940033 2847939898 Bacteria 8606328
476 2849077770 2849076700 Bacteria 7039503
477 2857510944 2857509624 Bacteria 7472071
478 2874591506 2874590934 Bacteria 8299676
479 2874618992 2874612657 Bacteria 8252029
480 2874625903 2874620515 Bacteria 8290088
481 2874634245 2874628541 Bacteria 8630250
482 2874645869 2874645413 Bacteria 8214782
483 2876769153 2876761206 Bacteria 10111113
484 2876771646 2876771140 Bacteria 8287509
485 2876818958 2876818435 Bacteria 8274608
486 2879075466 2879074833 Bacteria 8279565
487 2879084338 2879083081 Bacteria 8587928
488 2879101121 2879099564 Bacteria 10442239
489 2879129651 2879127579 Bacteria 8294491
490 2879145597 2879142872 Bacteria 8267021
491 2881369363 2881364244 Bacteria 7710352
492 2881669660 2881665667 Bacteria 8175609
493 2885368511 2885366525 Bacteria 8326213
494 2885413282 2885409591 Bacteria 9235467
495 2888386065 2888378607 Bacteria 9652610
496 2888392222 2888388044 Bacteria 7304136
497 2888426184 2888419890 Bacteria 7857137
498 2903751366 2903748898 Bacteria 9972761
499 2904673737 2904666416 Bacteria 8226587
500 2904717555 2904711408 Bacteria 9771557
501 2906628044 2906626472 Bacteria 8826946
502 2906644037 2906643746 Bacteria 8722424
503 2908782257 2908775508 Bacteria 8092255
504 2922376398
505 2922399885 2922393267 Bacteria 8285685
506 2929624051 2929615660 Bacteria 9193770
507 2929633192 2929624759 Bacteria 9339455
508 2932792640 2932784394 Bacteria 9704911
509 2932797911 2932794094 Bacteria 7915132
510 2932806447 2932801729 Bacteria 7987968
511 2932815267 2932809354 Bacteria 9135765
512 2932824453 2932818245 Bacteria 9955613
513 2932832149 2932828146 Bacteria 9745859
514 2933585951 2933577622 Bacteria 9116884
515 2935610507 2935608549 Bacteria 8203142
516 2935622087 2935616580 Bacteria 9032984
517 2935643902 2935638405 Bacteria 10015038
518 2935654291 2935648319 Bacteria 8801166
519 2935663171 2935656913 Bacteria 8965014
520 2935669182 2935665750 Bacteria 9571747
521 2935692201 2935684952 Bacteria 9590419
522 2935700628 2935694250 Bacteria 9291695
523 2935708742 2935703347 Bacteria 10242284
524 2935720561 2935713505 Bacteria 9608509
525 2935729842 2935722832 Bacteria 9608746
526 2935739176 2935732158 Bacteria 9706831
527 2935748283 2935741537 Bacteria 9707219
528 2935758486 2935750917 Bacteria 9590372
529 2935766089 2935760218 Bacteria 9817913
530 2935770964 2935769743 Bacteria 7878163
531 2935781131 2935777560 Bacteria 8077691
532 2935786335 2935785616 Bacteria 7962367
533 2935793868 2935793552 Bacteria 8012592
534 2935805898 2935801545 Bacteria 9301974
535 2935815544 2935810662 Bacteria 9401221
536 2935823668 2935819856 Bacteria 8261050
537 2935833154 2935827899 Bacteria 10038562
538 2935843275 2935837841 Bacteria 9454360
539 2935849194 2935847175 Bacteria 8228321
540 2935860334 2935855204 Bacteria 9035059
541 2935867732 2935864058 Bacteria 9784707
542 2935878459 2935873716 Bacteria 9632195
543 2935888714 2935883170 Bacteria 7964738
544 2935912713 2935908558 Bacteria 8568796
545 2935922968 2935916978 Bacteria 9113783
546 2935930393 2935926038 Bacteria 8601059
547 2935939293 2935934488 Bacteria 8602579
548 2935946241 2935942939 Bacteria 8599779
549 2935955578 2935951376 Bacteria 8602333
550 2935966886 2935959822 Bacteria 7869783
551 2935972051 2935967501 Bacteria 8603075
552 2935975989 2935975950 Bacteria 8347125
553 2935986521 2935984226 Bacteria 8302647
554 2935998658 2935992306 Bacteria 9802711
555 2936006964 2936002035 Bacteria 9362176
556 2936017327 2936011229 Bacteria 8801034
557 2936025829 2936019824 Bacteria 8804134
558 2936034763 2936028420 Bacteria 8965941
559 2936040782 2936037263 Bacteria 9446081
560 2936052820 2936046547 Bacteria 8903709
561 2936060015 2936055302 Bacteria 8785755
562 2940564390 2940556831 Bacteria 9590747
563 2941531774 2941531003 Bacteria 7653939
564 2941544821 2941538514 Bacteria 9402094
565 3005488364 3005483717 Bacteria 7877331
566 3005593325 3005587118 Bacteria 7794411
567 3005716364 3005710791 Bacteria 7622528
568 8006930442 8006926726 Bacteria 6749210
569 8016520012 8016511872 Bacteria 9921665
570 8016527932 8016522445 Bacteria 8156687
571 8016533053 8016530956 Bacteria 8155261
572 8016546286 8016539877 Bacteria 8155419
573 8016555844 8016548790 Bacteria 8155074
574 8016564189 8016557553 Bacteria 8154380
575 8016571364 8016566248 Bacteria 8158151
576 8016583838 8016575299 Bacteria 8154085
577 8016595082 8016583857 Bacteria 10421953
578 8016601889 8016595262 Bacteria 8149947
579 8016608357 8016603502 Bacteria 8731218
580 8016616508 8016613128 Bacteria 8794220
581 8016624631 8016622563 Bacteria 7999408
582 8016638123 8016630954 Bacteria 9217207
583 8017065537 8017057580 Bacteria 10023680
584 8019532852 8019530166 Bacteria 8155624
585 8019546997 8019538911 Bacteria 7872763
586 8019551669 8019547302 Bacteria 7996444
587 8019584942 8019576017 Bacteria 10049540
588 8019592899 8019586578 Bacteria 10212056
589 8019598561 8019597564 Bacteria 10041141
590 8019609819 8019608314 Bacteria 10042931
591 8019620398 8019619141 Bacteria 9218857
592 8019632704 8019629233 Bacteria 8687553
593 8019647229 8019638758 Bacteria 9062356
594 8019655454 8019648815 Bacteria 10014479
595 8019660569 8019659431 Bacteria 8577854
596 8019669992 8019668869 Bacteria 8791617
597 8019686110 8019678201 Bacteria 8863603
598 8019692285 8019687851 Bacteria 8712826
599 8055744478 8055742211 Bacteria 9226248
600 Ga0307515_10237992
601 JGI24739J22299_10177455
602 JGI24735J21928_10130646
603 JGI25165J46597_1012461
604 JGI25153J46596_10000990
605 JGI25153J46596_10005836
606 JGI25153J46596_10022175
607 rootH1_10061168
608 rootH1_10056275
609 JGI25160J50197_1000785
610 JGI25160J50197_1018184
611 Ga0055526_1031983
612 Ga0055531_10072067
613 Ga0055543_1005393
614 Ga0065165_1001118
615 Ga0065165_1001953
616 Ga0065165_1006666
617 Ga0065165_1039596
618 Ga0065165_1078449
619 Ga0070658_10077807
620 Ga0070676_10350330
621 Ga0070682_100232423
622 Ga0070660_100460466
623 Ga0070669_100228739
624 Ga0070671_100947895
625 Ga0070673_101813631
626 Ga0070667_101005764
627 Ga0070714_100047143
628 Ga0070714_101792078
629 Ga0070713_100115258
630 Ga0070713_101316511
631 Ga0070663_100534859
632 Ga0070663_101087622
633 Ga0070663_101321764
634 Ga0070662_100025690
635 Ga0068867_100387877
636 Ga0068853_100485110
637 Ga0068853_101748530
638 Ga0068853_102362715
639 Ga0070665_100091620
640 Ga0070665_100398128
641 Ga0070665_100762459
642 Ga0068855_100611102
643 Ga0070664_101302768
644 Ga0070664_101863040
645 Ga0068857_102551489
646 Ga0068854_100287538
647 Ga0068856_100051719
648 Ga0068856_100943253
649 Ga0068852_100290720
650 Ga0068852_100772366
651 Ga0068852_101524980
652 Ga0068852_101762786
653 Ga0068859_100469697
654 Ga0068861_100083062
655 Ga0068863_100528198
656 Ga0068858_100355946
657 Ga0068858_100569888
658 Ga0068862_100463929
659 Ga0081540_1148724
660 Ga0075365_10205950
661 Ga0075365_10231447
662 Ga0075365_10860965
663 Ga0075365_10925602
664 Ga0075368_10012597
665 Ga0075368_10302632
666 Ga0075363_100359826
667 Ga0075363_100399511
668 Ga0075363_100579651
669 Ga0075364_10025542
670 Ga0075364_10027669
671 Ga0070716_100172515
672 Ga0075362_10084431
673 Ga0075367_10009217
674 Ga0075367_10164628
675 Ga0075369_10041095
676 Ga0075369_10289762
677 Ga0075366_10009640
678 Ga0075370_10083071
679 Ga0075370_10106100
680 Ga0075370_10114549
681 Ga0097620_100469725
682 Ga0099825_1029437
683 Ga0099824_1009235
684 Ga0099824_1069773
685 Ga0099822_1012535
686 Ga0099822_1109043
687 Ga0099823_1004520
688 Ga0105251_10463386
689 Ga0105240_10245735
690 Ga0105240_10283166
691 Ga0105240_10421185
692 Ga0105240_10927493
693 Ga0105245_10283442
694 Ga0105247_10006166
695 Ga0105243_11526621
696 Ga0105241_10260899
697 Ga0105241_10431708
698 Ga0105241_11199286
699 Ga0105248_10190665
700 Ga0105248_11119831
701 Ga0105237_10033263
702 Ga0105237_10189485
703 Ga0105237_10232630
704 Ga0105237_10365778
705 Ga0105237_10478147
706 Ga0105237_10832740
707 Ga0105237_11000389
708 Ga0105238_10076557
709 Ga0105238_10081164
710 Ga0105238_10310131
711 Ga0105238_10743304
712 Ga0105238_11068299
713 Ga0105239_10041315
714 Ga0105239_10090186
715 Ga0105239_10712196
716 Ga0105239_10963594
717 Ga0105239_11087730
718 Ga0157325_1030258
719 Ga0157314_1029200
720 Ga0157370_11274123
721 Ga0157369_10555496
722 Ga0157374_10165527
723 Ga0157378_10144017
724 Ga0163162_10361779
725 Ga0157375_12935804
726 Ga0163163_10015031
727 Ga0163163_10036772
728 Ga0163163_11320045
729 Ga0157380_12699323
730 Ga0157377_10232829
731 Ga0157379_10223994
732 Ga0157376_10534743
733 Ga0182006_1217741
734 Ga0182007_10270628
735 Ga0214544_1000053
736 Ga0214544_1033677
737 Ga0214542_1000058
738 Ga0214542_1035853
739 Ga0214542_1040406
740 Ga0214545_1000026
741 Ga0214545_1045082
742 Ga0214543_1002325
743 Ga0214543_1044773
744 Ga0209677_102085
745 Ga0209677_130488
746 Ga0209233_1004790
747 Ga0209233_1009079
748 Ga0209233_1010690
749 Ga0209673_1037066
750 Ga0209564_1003388
751 Ga0209758_1000940
752 Ga0209758_1001235
753 Ga0209758_1001336
754 Ga0209758_1035794
755 Ga0209758_1043145
756 Ga0209758_1084131
757 Ga0209256_1046720
758 Ga0209256_1079137
759 Ga0207426_1000505
760 Ga0207426_1000551
761 Ga0207426_1010417
762 Ga0207426_1033314
763 Ga0207426_1041285
764 Ga0207426_1112002
765 Ga0209051_1107868
766 Ga0209257_1010303
767 Ga0209257_1028282
768 Ga0207697_10113825
769 Ga0207710_10046991
770 Ga0207688_10034401
771 Ga0207680_10624714
772 Ga0207647_10017373
773 Ga0207647_10818210
774 Ga0207705_10310850
775 Ga0207654_10355727
776 Ga0207654_10538564
777 Ga0207695_10000157
778 Ga0207695_10479550
779 Ga0207671_10019698
780 Ga0207671_10082854
781 Ga0207671_10560573
782 Ga0207671_10743372
783 Ga0207657_10429272
784 Ga0207681_10050677
785 Ga0207681_10777062
786 Ga0207694_10105816
787 Ga0207694_10331961
788 Ga0207687_10358224
789 Ga0207700_10414400
790 Ga0207664_10149347
791 Ga0207644_10996024
792 Ga0207706_10021004
793 Ga0207706_10412232
794 Ga0207709_11206178
795 Ga0207711_11185663
796 Ga0207679_10151736
797 Ga0207679_10397368
798 Ga0207651_10293247
799 Ga0207668_10066448
800 Ga0207658_10499100
801 Ga0207703_10243111
802 Ga0207639_10350534
803 Ga0207678_10012283
804 Ga0207678_10264682
805 Ga0207641_10254196
806 Ga0207648_10202056
807 Ga0207674_10179123
808 Ga0207675_100198384
809 Ga0207698_10789053
810 Ga0209389_1000073
811 Ga0209389_1000160
812 Ga0209589_1000484
813 Ga0209489_100917
814 Ga0209489_100982
815 Ga0209700_100067
816 Ga0209813_10213747
817 Ga0209813_10421929
818 Ga0268266_10020435
819 Ga0268266_10645845
820 Ga0268264_10972846
821 Ga0307408_100084723
822 Ga0307508_10144174
823 Ga0307406_10140924
824 Ga0307416_101033517
825 Ga0307510_10003822
826 Ga0307510_10445903
827 Ga0395900_0001197
828 Ga0395898_0021814
829 Ga0395905_0012364
830 Ga0395905_0198205
831 Ga0436364_0765141
832 Ga0395901_0313141
833 Ga0395901_1379257
834 Ga0436365_1886166
835 Ga0451791_0930378
836 Ga0451800_0970108
837 Ga0451802_2073304
838 Ga0451833_1302643
839 Ga0451837_1451563
840 Ga0451839_0574709
841 Ga0451845_0330887
842 Ga0451843_0617396
843 Ga0451853_3445968
844 Ga0451853_3866649
845 Ga0466972_0030064
846 Ga0466972_0091249
847 Ga0466972_0145279
848 Ga0466972_0484422
849 Ga0466965_0042101
850 Ga0466966_0000763
851 Ga0466961_0000505
852 Ga0466960_0119874
853 Ga0466959_0001470
854 Ga0466959_0818601
855 Ga0466958_0014418
856 Ga0495592_0295463
857 Ga0495603_0160755
858 Ga0495590_0039281
859 Ga0495629_0010214
860 Ga0495629_0238737
861 Ga0495638_0026478
862 Ga0495651_0139825
863 Ga0495650_0094294
864 Ga0495605_0021137
865 Ga0495605_0341644
866 Ga0495664_0111577
867 Ga0495664_0201862
868 Ga0495583_0140220
869 Ga0495606_0189460
870 Ga0495628_0116695
871 Ga0495628_0122726
872 Ga0495630_0124025
873 Ga0495631_0084057
874 Ga0495631_0352848
875 Ga0495632_0286372
876 Ga0495643_0027375
877 Ga0495648_0118514
878 Ga0495648_0129194
879 Ga0495648_0448440
880 Ga0495652_0036220
881 Ga0495652_0188747
882 Ga0495652_1132004
883 Ga0495609_0125852
884 Ga0495597_0043981
885 Ga0495597_0110661
886 Ga0495622_0047727
887 Ga0495622_0106994
888 Ga0495668_0141188
889 Ga0495634_0044022
890 Ga0495611_0134738
891 Ga0495625_0625270
892 Ga0495635_0078466
893 Ga0495588_0049166
894 Ga0495623_0732769
895 Ga0495613_0018266
896 Ga0495624_0119314
897 Ga0495624_0153903
898 Ga0495671_0188631
899 Ga0495600_0082143
900 Ga0495581_0076024
901 Ga0495604_0099607
902 Ga0495604_0247657
903 Ga0495676_0136292
904 Ga0495683_0025138
905 Ga0495687_086298
906 Ga0495677_0133261
907 Ga0495673_0096039
908 Ga0495673_0161932
909 Ga0495686_0033621
910 Ga0495686_0084446
911 Ga0495602_0087737
912 Ga0496100_0529875
913 Ga0496101_1342614
914 Ga0496102_0016403
915 Ga0496102_1408734
916 Ga0496103_0224625
917 Ga0496104_0072614
918 Ga0496104_0259904
919 Ga0496104_0452107
920 Ga0496104_0820988
921 Ga0496105_0016524
922 Ga0496105_0065363
923 Ga0496105_0105238
924 Ga0496109_0063162
925 Ga0496109_0569694
926 Ga0496110_1777099
927 Ga0496111_0211396
928 Ga0496112_0479147
929 Ga0496112_0554337
930 Ga0496113_0055283
931 Ga0496113_0089928
932 Ga0496113_0772422
933 Ga0496115_0187283
934 Ga0496115_0432435
935 Ga0496116_0029305
936 Ga0496117_0262687
937 Ga0496117_0348260
938 Ga0496118_0040801
939 Ga0496118_0276709
940 Ga0496118_0354775
941 Ga0496119_0104854
942 Ga0496119_0116685
943 Ga0496119_0267104
944 Ga0496119_0437236
945 Ga0496121_0019242
946 Ga0496122_0129303
947 Ga0496124_0202815
948 Ga0496124_0222712
949 Ga0496125_0017068
950 Ga0496125_0257907
951 Ga0496125_0667378
952 Ga0496126_0032039
953 Ga0496126_0036964
954 Ga0496126_0370478
955 Ga0496126_0411239
956 Ga0501081_1372400
957 nmdc:mga03683_96289_c1
958 nmdc:mga03n38_362334_c1
959 nmdc:mga03n38_432316_c1
960 nmdc:mga00v17_10981_c1
961 nmdc:mga00v17_421492_c1
962 nmdc:mga0yw44_25549_c2
963 nmdc:mga0yw44_33924_c1
964 nmdc:mga0yw44_979258_c1
965 nmdc:mga0k408_34696_c1
966 nmdc:mga06z11_18296_c1
967 nmdc:mga06z11_391130_c1
968 nmdc:mga07m45_197189_c1
969 nmdc:mga07m45_416338_c1
970 nmdc:mga07m45_90892_c1
971 nmdc:mga0sz30_18214_c2
972 nmdc:mga0sz30_228529_c1
973 nmdc:mga0sz30_43401_c1
974 Ga0495601_0172733
975 Ga0500610_0101309
976 Ga0500635_0314477
977 Ga0495619_0061682
978 Ga0495619_0717447
979 Ga0500578_0079398
980 Ga0500578_0254744
981 Ga0500578_0311959
982 Ga0500643_002338
983 Ga0500643_137218
984 Ga0500647_0055637
985 Ga0500583_0015567
986 Ga0500651_0199805
987 Ga0500566_0000057
988 Ga0500641_0011132
989 Ga0500650_0075578
990 Ga0500555_103875
991 Ga0500556_0050560
992 Ga0500557_000106
993 Ga0500562_011057
994 Ga0500569_019729
995 Ga0500592_057249
996 Ga0500595_008936
997 Ga0500595_105940
998 Ga0500607_045561
999 Ga0500608_094152
1000 Ga0500621_299290
1001 Ga0500642_0000068
1002 Ga0500642_0295128
1003 Ga0500655_009544
1004 Ga0500658_0045763
1005 Ga0500559_0157842
1006 Ga0500559_0464071
1007 Ga0500564_249059
1008 Ga0500568_0006872
1009 Ga0500577_0392192
1010 Ga0500577_0423333
1011 Ga0500588_0027209
1012 Ga0500588_0366722
1013 Ga0500590_064178
1014 Ga0500590_167877
1015 Ga0500619_010990
1016 Ga0500622_0186904
1017 Ga0500627_0039928
1018 Ga0500638_109080
1019 Ga0500636_0000059
1020 Ga0500649_031233
1021 Ga0500625_012566
1022 Ga0500609_003163
1023 Ga0500599_027934
1024 Ga0500601_000757
1025 Ga0500661_019851
1026 2507507113
1027 2508541164
1028 2508693500
1029 2511398533
1030 2513626327
1031 2513637276
1032 2513651661
1033 2513717373
1034 2513876824
1035 2514012138
1036 2515628858
1037 2517107417
1038 2524439506
1039 2528850968
1040 2617348069
1041 2617377700
1042 2745078217
1043 2793064388
1044 2805918804
1045 2818243195
1046 2824609070
1047 2824614780
1048 2824622655
1049 2824631818
1050 2824643004
1051 2824651134
1052 2824660998
1053 2824670491
1054 2824673964
1055 2824686834
1056 2824690588
1057 2824698109
1058 2824713742
1059 2824719928
1060 2824739394
1061 2824746383
1062 2824759292
1063 2824769600
1064 2824776180
1065 2838126961
1066 2841945558
1067 2841954775
1068 2841972441
1069 2841980525
1070 2841988696
1071 2842044985
1072 2842052829
1073 2847938116
1074 2847940033
1075 2849077770
1076 2857510944
1077 2874591506
1078 2874618992
1079 2874625903
1080 2874634245
1081 2874645869
1082 2876769153
1083 2876771646
1084 2876818958
1085 2879075466
1086 2879084338
1087 2879101121
1088 2879129651
1089 2879145597
1090 2881369363
1091 2881669660
1092 2885368511
1093 2885413282
1094 2888386065
1095 2888392222
1096 2888426184
1097 2903751366
1098 2904673737
1099 2904717555
1100 2906628044
1101 2906644037
1102 2908782257
1103 2922376398
1104 2922399885
1105 2929624051
1106 2929633192
1107 2932792640
1108 2932797911
1109 2932806447
1110 2932815267
1111 2932824453
1112 2932832149
1113 2933585951
1114 2935610507
1115 2935622087
1116 2935643902
1117 2935654291
1118 2935663171
1119 2935669182
1120 2935692201
1121 2935700628
1122 2935708742
1123 2935720561
1124 2935729842
1125 2935739176
1126 2935748283
1127 2935758486
1128 2935766089
1129 2935770964
1130 2935781131
1131 2935786335
1132 2935793868
1133 2935805898
1134 2935815544
1135 2935823668
1136 2935833154
1137 2935843275
1138 2935849194
1139 2935860334
1140 2935867732
1141 2935878459
1142 2935888714
1143 2935912713
1144 2935922968
1145 2935930393
1146 2935939293
1147 2935946241
1148 2935955578
1149 2935966886
1150 2935972051
1151 2935975989
1152 2935986521
1153 2935998658
1154 2936006964
1155 2936017327
1156 2936025829
1157 2936034763
1158 2936040782
1159 2936052820
1160 2936060015
1161 2940564390
1162 2941531774
1163 2941544821
1164 3005488364
1165 3005593325
1166 3005716364
1167 8006930442
1168 8016520012
1169 8016527932
1170 8016533053
1171 8016546286
1172 8016555844
1173 8016564189
1174 8016571364
1175 8016583838
1176 8016595082
1177 8016601889
1178 8016608357
1179 8016616508
1180 8016624631
1181 8016638123
1182 8017065537
1183 8019532852
1184 8019546997
1185 8019551669
1186 8019584942
1187 8019592899
1188 8019598561
1189 8019609819
1190 8019620398
1191 8019632704
1192 8019647229
1193 8019655454
1194 8019660569
1195 8019669992
1196 8019686110
1197 8019692285
1198 8055744478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

7

105

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oho-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase y16f/d40n mutant complexed with equilenin 0.8802 4 115
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.873 5 115
1cqs-assembly1.cif.gz_B crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida 0.8703 4 115
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8684 5 118
6f53-assembly1.cif.gz_A crystal structure of ketosteroid isomerase quadruple variant v88i/l99v/d103s/v101a 0.8684 1 115
ID Description Score Start End Superfamily
af_Q54FT2_499_621_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9075 4 113 3.10.450.50
af_Q55DR3_11_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9007 4 113 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8959 5 119 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8856 5 113 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.87 5 113 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1Q5REQ6-F1-model_v4 Polyketide cyclase 1.002 1 121
AF-A0A7T7VC81-F1-model_v4 Nuclear transport factor 2 family protein 0.9996 1 101
AF-A0A0S6V242-F1-model_v4 SnoaL-like domain-containing protein 0.9975 1 121
AF-A0A2U3Q8B5-F1-model_v4 SnoaL-like domain-containing protein 0.9907 18 121
AF-J3DDU0-F1-model_v4 SnoaL-like domain-containing protein 0.9899 1 118

Map