F467812

General Info

Members Datasets Scaffolds Average Seq Length
598 270 1186 142

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0008745|Ga0495638_0008745_273_722
Length 149
Sequence LRFDVLVTETPDAETMKAFNKSIVDEFHANGGKVGGQFAGADLLLLTTTGAKSGEPRLAPLAYFTIDGKLIIIGSKAGADTNPDWVHNLRANPAAHVEIGTDAYDVAARELPQAERDELFDKVVAAAPGFGDYQSKTSRIIPLFELHRA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
261 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
262 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
270 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 1
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 0
Rhizoplane 8.36
Rhizosphere 77.26
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0008745 3300046460 Bacteria 7155
2 JGI24745J21846_1001025 3300002073 Bacteria 2624
3 JGI24745J21846_1002809 3300002073 Bacteria 1799
4 JGI24744J21845_10001556 3300002077 Bacteria 4577
5 JGI24744J21845_10077394 3300002077 Bacteria 608
6 rootL2_10338403 3300003322 Bacteria 1766
7 Ga0070683_100195330 3300005329 Bacteria 1921
8 Ga0070683_100564837 3300005329 Bacteria 1088
9 Ga0070683_100752890 3300005329 Bacteria 933
10 Ga0070690_100030736 3300005330 Bacteria 3341
11 Ga0070690_100808067 3300005330 Bacteria 728
12 Ga0070690_101364277 3300005330 Bacteria 569
13 Ga0068869_100012521 3300005334 Bacteria 5609
14 Ga0068869_100296847 3300005334 Bacteria 1303
15 Ga0068869_100326029 3300005334 Bacteria 1246
16 Ga0070666_10020187 3300005335 Bacteria 4306
17 Ga0070680_100823947 3300005336 Bacteria 800
18 Ga0070682_100031325 3300005337 Bacteria 3216
19 Ga0070682_100048051 3300005337 Bacteria 2656
20 Ga0068868_100003012 3300005338 Bacteria 11717
21 Ga0068868_100053209 3300005338 Bacteria 3189
22 Ga0068868_100095255 3300005338 Bacteria 2403
23 Ga0068868_100403507 3300005338 Bacteria 1180
24 Ga0070660_100173839 3300005339 Bacteria 1741
25 Ga0070689_100070803 3300005340 Bacteria 2723
26 Ga0070689_100597360 3300005340 Bacteria 956
27 Ga0070661_100049955 3300005344 Bacteria 3061
28 Ga0070692_10071776 3300005345 Bacteria 1846
29 Ga0070692_10737692 3300005345 Bacteria 666
30 Ga0070668_100000504 3300005347 Bacteria 25805
31 Ga0070668_100062792 3300005347 Bacteria 2879
32 Ga0070668_100161837 3300005347 Bacteria 1816
33 Ga0070668_100179828 3300005347 Bacteria 1727
34 Ga0070668_100382089 3300005347 Bacteria 1199
35 Ga0070668_101569142 3300005347 Bacteria 603
36 Ga0070669_100004332 3300005353 Bacteria 10252
37 Ga0070669_101638175 3300005353 Bacteria 560
38 Ga0070671_100001009 3300005355 Bacteria 20691
39 Ga0070671_100614505 3300005355 Bacteria 940
40 Ga0070674_100095114 3300005356 Bacteria 2159
41 Ga0070674_100476183 3300005356 Bacteria 1035
42 Ga0070673_100361700 3300005364 Bacteria 1290
43 Ga0070673_101123646 3300005364 Bacteria 734
44 Ga0070688_100714707 3300005365 Bacteria 777
45 Ga0070659_100038887 3300005366 Bacteria 3712
46 Ga0070659_100114687 3300005366 Bacteria 2177
47 Ga0070659_100772226 3300005366 Bacteria 834
48 Ga0070659_101455796 3300005366 Bacteria 610
49 Ga0070667_100000034 3300005367 Bacteria 173652
50 Ga0070667_100098734 3300005367 Bacteria 2520
51 Ga0070667_101124292 3300005367 Bacteria 734
52 Ga0070709_10065943 3300005434 Bacteria 2320
53 Ga0070714_100675168 3300005435 Bacteria 996
54 Ga0070713_100041536 3300005436 Bacteria 3748
55 Ga0070713_100235981 3300005436 Bacteria 1664
56 Ga0070710_10020203 3300005437 Bacteria 3452
57 Ga0070710_10323831 3300005437 Bacteria 1013
58 Ga0070710_10333566 3300005437 Bacteria 999
59 Ga0070701_10001026 3300005438 Bacteria 10175
60 Ga0070701_10106498 3300005438 Bacteria 1561
61 Ga0070711_100000671 3300005439 Bacteria 17916
62 Ga0070711_100001367 3300005439 Bacteria 13327
63 Ga0070711_100418096 3300005439 Bacteria 1092
64 Ga0070705_100093661 3300005440 Bacteria 1879
65 Ga0070700_100002061 3300005441 Bacteria 10212
66 Ga0070700_100111472 3300005441 Bacteria 1820
67 Ga0070700_100195068 3300005441 Bacteria 1418
68 Ga0070694_100010310 3300005444 Bacteria 5761
69 Ga0070663_100011393 3300005455 Bacteria 5580
70 Ga0070663_100029145 3300005455 Bacteria 3767
71 Ga0070663_100041922 3300005455 Bacteria 3214
72 Ga0070663_100466129 3300005455 Bacteria 1044
73 Ga0070663_100527967 3300005455 Bacteria 983
74 Ga0070663_101034578 3300005455 Bacteria 715
75 Ga0070678_100000064 3300005456 Bacteria 39363
76 Ga0070678_100360535 3300005456 Bacteria 1252
77 Ga0070678_100541750 3300005456 Bacteria 1032
78 Ga0070662_100098403 3300005457 Bacteria 2209
79 Ga0070662_100103675 3300005457 Bacteria 2157
80 Ga0070662_100363319 3300005457 Bacteria 1188
81 Ga0070662_100397378 3300005457 Bacteria 1137
82 Ga0070662_100710715 3300005457 Bacteria 851
83 Ga0070681_10724193 3300005458 Bacteria 911
84 Ga0070681_11594388 3300005458 Bacteria 578
85 Ga0068867_100001251 3300005459 Bacteria 17498
86 Ga0070685_10092613 3300005466 Bacteria 1832
87 Ga0070685_10256358 3300005466 Bacteria 1161
88 Ga0070685_10554329 3300005466 Bacteria 821
89 Ga0070679_100221512 3300005530 Bacteria 1853
90 Ga0070684_100671743 3300005535 Bacteria 965
91 Ga0070684_101017995 3300005535 Bacteria 777
92 Ga0070697_100698466 3300005536 Bacteria 895
93 Ga0068853_100001795 3300005539 Bacteria 15780
94 Ga0068853_100343697 3300005539 Bacteria 1387
95 Ga0068853_100981381 3300005539 Bacteria 813
96 Ga0068853_102008376 3300005539 Bacteria 561
97 Ga0070672_100145534 3300005543 Bacteria 1958
98 Ga0070686_100253186 3300005544 Bacteria 1287
99 Ga0070686_100307481 3300005544 Bacteria 1178
100 Ga0070695_100014495 3300005545 Bacteria 4752
101 Ga0070696_100002193 3300005546 Bacteria 12865
102 Ga0070696_100147795 3300005546 Bacteria 1722
103 Ga0070693_100058855 3300005547 Bacteria 2226
104 Ga0070693_100977441 3300005547 Bacteria 639
105 Ga0070665_100004867 3300005548 Bacteria 13951
106 Ga0070665_100029211 3300005548 Bacteria 5549
107 Ga0070665_100110683 3300005548 Bacteria 2749
108 Ga0070665_100208952 3300005548 Bacteria 1952
109 Ga0070665_100346568 3300005548 Bacteria 1490
110 Ga0070704_100000548 3300005549 Bacteria 17998
111 Ga0068855_101201274 3300005563 Bacteria 788
112 Ga0070664_100291028 3300005564 Bacteria 1475
113 Ga0070664_100387532 3300005564 Bacteria 1276
114 Ga0068857_100473139 3300005577 Bacteria 1173
115 Ga0068854_100000969 3300005578 Bacteria 17274
116 Ga0068854_100012397 3300005578 Bacteria 5581
117 Ga0068856_100638016 3300005614 Bacteria 1086
118 Ga0070702_100003523 3300005615 Bacteria 7013
119 Ga0070702_100557845 3300005615 Bacteria 851
120 Ga0068852_100136446 3300005616 Bacteria 2265
121 Ga0068852_100144593 3300005616 Bacteria 2204
122 Ga0068852_100847351 3300005616 Bacteria 930
123 Ga0068859_100003260 3300005617 Bacteria 16525
124 Ga0068859_100005128 3300005617 Bacteria 13305
125 Ga0068859_100133561 3300005617 Bacteria 2554
126 Ga0068859_100841735 3300005617 Bacteria 1004
127 Ga0068864_100317815 3300005618 Bacteria 1462
128 Ga0068864_100380203 3300005618 Bacteria 1338
129 Ga0068864_100492513 3300005618 Bacteria 1178
130 Ga0068864_101072854 3300005618 Bacteria 801
131 Ga0068866_10000114 3300005718 Bacteria 34929
132 Ga0068866_10440602 3300005718 Bacteria 849
133 Ga0068861_100049067 3300005719 Bacteria 3194
134 Ga0068861_100505345 3300005719 Bacteria 1093
135 Ga0068861_100652282 3300005719 Bacteria 972
136 Ga0068851_10027395 3300005834 Bacteria 2808
137 Ga0068870_10332072 3300005840 Bacteria 970
138 Ga0068863_100000993 3300005841 Bacteria 28490
139 Ga0068863_100012246 3300005841 Bacteria 8282
140 Ga0068863_100152566 3300005841 Bacteria 2211
141 Ga0068858_100044491 3300005842 Bacteria 4115
142 Ga0068858_100185535 3300005842 Bacteria 1965
143 Ga0068858_100190365 3300005842 Bacteria 1938
144 Ga0068858_100246419 3300005842 Bacteria 1696
145 Ga0068860_100000011 3300005843 Bacteria 328172
146 Ga0068860_100015022 3300005843 Bacteria 7567
147 Ga0068860_100178486 3300005843 Bacteria 2052
148 Ga0068860_100235566 3300005843 Bacteria 1779
149 Ga0068860_100545237 3300005843 Bacteria 1161
150 Ga0068862_100000139 3300005844 Bacteria 82475
151 Ga0068862_100001409 3300005844 Bacteria 22268
152 Ga0081455_10075665 3300005937 Bacteria 2776
153 Ga0081455_10095494 3300005937 Bacteria 2399
154 Ga0081538_10110141 3300005981 Bacteria 1354
155 Ga0070717_10175036 3300006028 Bacteria 1868
156 Ga0070717_10911830 3300006028 Bacteria 800
157 Ga0075365_10049773 3300006038 Bacteria 2761
158 Ga0075365_10080543 3300006038 Bacteria 2205
159 Ga0075365_10335315 3300006038 Bacteria 1065
160 Ga0075368_10098251 3300006042 Bacteria 1200
161 Ga0075363_100010843 3300006048 Bacteria 4346
162 Ga0075363_100011045 3300006048 Bacteria 4312
163 Ga0075363_100040989 3300006048 Bacteria 2442
164 Ga0075363_100049200 3300006048 Bacteria 2244
165 Ga0075363_100080112 3300006048 Bacteria 1785
166 Ga0075363_100481039 3300006048 Bacteria 736
167 Ga0075364_10004841 3300006051 Bacteria 7800
168 Ga0075364_10052485 3300006051 Bacteria 2664
169 Ga0075364_10260270 3300006051 Bacteria 1179
170 Ga0070715_10017175 3300006163 Bacteria 2735
171 Ga0070715_10075036 3300006163 Bacteria 1520
172 Ga0070716_100002208 3300006173 Bacteria 8965
173 Ga0070716_100064332 3300006173 Bacteria 2132
174 Ga0070716_100840593 3300006173 Bacteria 714
175 Ga0070712_100000315 3300006175 Bacteria 27318
176 Ga0070712_100189939 3300006175 Bacteria 1607
177 Ga0075362_10074235 3300006177 Bacteria 1558
178 Ga0075362_10106504 3300006177 Bacteria 1316
179 Ga0075362_10128607 3300006177 Bacteria 1203
180 Ga0075367_10037239 3300006178 Bacteria 2826
181 Ga0075367_10290079 3300006178 Bacteria 1029
182 Ga0075367_10531006 3300006178 Bacteria 747
183 Ga0075369_10027160 3300006186 Bacteria 2391
184 Ga0075369_10097907 3300006186 Bacteria 1314
185 Ga0097621_100028631 3300006237 Bacteria 4392
186 Ga0075370_10014168 3300006353 Bacteria 4248
187 Ga0075370_10019370 3300006353 Bacteria 3706
188 Ga0075370_10246314 3300006353 Bacteria 1059
189 Ga0075370_10435705 3300006353 Bacteria 788
190 Ga0068871_100161992 3300006358 Bacteria 1914
191 Ga0068865_100000939 3300006881 Bacteria 16557
192 Ga0068865_100091822 3300006881 Bacteria 2204
193 Ga0068865_100703709 3300006881 Bacteria 864
194 Ga0068865_101269611 3300006881 Bacteria 654
195 Ga0068865_101805190 3300006881 Bacteria 553
196 Ga0097620_100003260 3300006931 Bacteria 16525
197 Ga0097620_100005128 3300006931 Bacteria 13305
198 Ga0097620_100133562 3300006931 Bacteria 2554
199 Ga0097620_100841837 3300006931 Bacteria 1004
200 Ga0105250_10155843 3300009092 Bacteria 952
201 Ga0105245_10000356 3300009098 Bacteria 42681
202 Ga0105245_10081868 3300009098 Bacteria 2952
203 Ga0105245_10343519 3300009098 Bacteria 1477
204 Ga0105245_10508830 3300009098 Bacteria 1221
205 Ga0105245_10861763 3300009098 Bacteria 946
206 Ga0105245_11859108 3300009098 Bacteria 655
207 Ga0105247_10000067 3300009101 Bacteria 118585
208 Ga0105247_10000092 3300009101 Bacteria 97046
209 Ga0105247_10552367 3300009101 Bacteria 847
210 Ga0105247_10784643 3300009101 Bacteria 725
211 Ga0105243_10045910 3300009148 Bacteria 3435
212 Ga0105243_10359264 3300009148 Bacteria 1340
213 Ga0105243_11067350 3300009148 Bacteria 814
214 Ga0105243_11455725 3300009148 Bacteria 707
215 Ga0105241_10212917 3300009174 Bacteria 1620
216 Ga0105241_10789131 3300009174 Bacteria 874
217 Ga0105241_10792352 3300009174 Bacteria 872
218 Ga0105241_10822838 3300009174 Bacteria 857
219 Ga0105241_10902643 3300009174 Bacteria 821
220 Ga0105242_10000901 3300009176 Bacteria 23051
221 Ga0105242_10395358 3300009176 Bacteria 1288
222 Ga0105248_10000040 3300009177 Bacteria 172452
223 Ga0105248_10022232 3300009177 Bacteria 7032
224 Ga0105248_10668340 3300009177 Bacteria 1172
225 Ga0105248_10746328 3300009177 Bacteria 1104
226 Ga0105248_12668784 3300009177 Bacteria 570
227 Ga0105237_10089600 3300009545 Bacteria 3065
228 Ga0105237_10198063 3300009545 Bacteria 2008
229 Ga0105237_11773607 3300009545 Bacteria 625
230 Ga0105238_10176937 3300009551 Bacteria 2110
231 Ga0105238_10228546 3300009551 Bacteria 1837
232 Ga0105238_10324673 3300009551 Bacteria 1525
233 Ga0105249_10000001 3300009553 Bacteria 504948
234 Ga0105249_10000380 3300009553 Bacteria 44166
235 Ga0105249_10592020 3300009553 Bacteria 1163
236 Ga0105239_10003452 3300010375 Bacteria 19341
237 Ga0105239_10050722 3300010375 Bacteria 4550
238 Ga0105239_10071314 3300010375 Bacteria 3817
239 Ga0105239_10375667 3300010375 Bacteria 1607
240 Ga0105239_10412441 3300010375 Bacteria 1529
241 Ga0105239_10432762 3300010375 Bacteria 1491
242 Ga0105239_10463765 3300010375 Bacteria 1438
243 Ga0105246_10095983 3300011119 Bacteria 2148
244 Ga0105246_10183323 3300011119 Bacteria 1614
245 Ga0105246_11939390 3300011119 Bacteria 566
246 Ga0157371_10583981 3300013102 Bacteria 830
247 Ga0157369_11052218 3300013105 Bacteria 832
248 Ga0157369_11117270 3300013105 Bacteria 805
249 Ga0157378_10000785 3300013297 Bacteria 29494
250 Ga0163162_10002590 3300013306 Bacteria 17129
251 Ga0163162_10030485 3300013306 Bacteria 5344
252 Ga0163162_10041787 3300013306 Bacteria 4587
253 Ga0163162_10099750 3300013306 Bacteria 2995
254 Ga0163162_10299850 3300013306 Bacteria 1739
255 Ga0163162_10803822 3300013306 Bacteria 1058
256 Ga0163162_12526221 3300013306 Bacteria 591
257 Ga0157372_10001640 3300013307 Bacteria 24319
258 Ga0157372_10170917 3300013307 Bacteria 2515
259 Ga0157372_10660069 3300013307 Bacteria 1218
260 Ga0157372_10874026 3300013307 Bacteria 1043
261 Ga0157372_11245453 3300013307 Bacteria 859
262 Ga0157375_10018467 3300013308 Bacteria 6325
263 Ga0157375_10679705 3300013308 Bacteria 1184
264 Ga0157375_11336577 3300013308 Bacteria 843
265 Ga0157375_12125391 3300013308 Bacteria 668
266 Ga0157375_12774386 3300013308 Bacteria 586
267 Ga0163163_10092572 3300014325 Bacteria 3038
268 Ga0163163_10102613 3300014325 Bacteria 2884
269 Ga0163163_10164469 3300014325 Bacteria 2264
270 Ga0163163_10249589 3300014325 Bacteria 1825
271 Ga0163163_10251344 3300014325 Bacteria 1818
272 Ga0163163_10486374 3300014325 Bacteria 1296
273 Ga0157380_10049046 3300014326 Bacteria 3328
274 Ga0157380_10069133 3300014326 Bacteria 2849
275 Ga0182008_10109863 3300014497 Bacteria 1366
276 Ga0157377_10222098 3300014745 Bacteria 1210
277 Ga0157377_10588479 3300014745 Bacteria 792
278 Ga0157379_10249364 3300014968 Bacteria 1611
279 Ga0157379_10322341 3300014968 Bacteria 1411
280 Ga0157379_10373930 3300014968 Bacteria 1307
281 Ga0157376_10717383 3300014969 Bacteria 1006
282 Ga0163161_10014978 3300017792 Bacteria 5402
283 Ga0163161_10331075 3300017792 Bacteria 1206
284 Ga0163161_10590208 3300017792 Bacteria 915
285 Ga0206349_1977716 3300020075 Bacteria 535
286 Ga0206350_10343026 3300020080 Bacteria 529
287 Ga0206353_11286272 3300020082 Bacteria 770
288 Ga0213876_10064343 3300021384 Bacteria 1936
289 Ga0224712_10567969 3300022467 Unclassified 552
290 Ga0224712_10624524 3300022467 Bacteria 527
291 Ga0207656_10022548 3300025321 Bacteria 2527
292 Ga0207692_10931416 3300025898 Bacteria 572
293 Ga0207642_10081253 3300025899 Bacteria 1574
294 Ga0207642_10573800 3300025899 Bacteria 699
295 Ga0207710_10000094 3300025900 Bacteria 118590
296 Ga0207710_10008718 3300025900 Bacteria 4275
297 Ga0207688_10001153 3300025901 Bacteria 13630
298 Ga0207688_10017968 3300025901 Bacteria 3848
299 Ga0207680_10773394 3300025903 Bacteria 688
300 Ga0207647_10259098 3300025904 Bacteria 996
301 Ga0207685_10011967 3300025905 Bacteria 2632
302 Ga0207699_10992660 3300025906 Bacteria 621
303 Ga0207645_10016774 3300025907 Bacteria 4843
304 Ga0207645_10028471 3300025907 Bacteria 3606
305 Ga0207643_10021679 3300025908 Bacteria 3533
306 Ga0207705_10212325 3300025909 Bacteria 1468
307 Ga0207654_10238166 3300025911 Bacteria 1215
308 Ga0207654_10473498 3300025911 Bacteria 881
309 Ga0207654_10759492 3300025911 Bacteria 699
310 Ga0207671_10150297 3300025914 Bacteria 1799
311 Ga0207693_10000389 3300025915 Bacteria 40306
312 Ga0207693_10299583 3300025915 Bacteria 1259
313 Ga0207660_10758752 3300025917 Bacteria 792
314 Ga0207657_10067428 3300025919 Bacteria 3043
315 Ga0207657_10767952 3300025919 Bacteria 746
316 Ga0207649_11502350 3300025920 Bacteria 533
317 Ga0207652_10439334 3300025921 Bacteria 1176
318 Ga0207681_10013581 3300025923 Bacteria 5043
319 Ga0207681_10182171 3300025923 Bacteria 1601
320 Ga0207681_10399915 3300025923 Bacteria 1109
321 Ga0207694_10130476 3300025924 Bacteria 2014
322 Ga0207694_10396966 3300025924 Bacteria 1146
323 Ga0207694_10985961 3300025924 Bacteria 713
324 Ga0207650_10611240 3300025925 Bacteria 917
325 Ga0207659_10276095 3300025926 Bacteria 1372
326 Ga0207687_10013726 3300025927 Bacteria 5290
327 Ga0207687_10044026 3300025927 Bacteria 3078
328 Ga0207687_10115368 3300025927 Bacteria 2001
329 Ga0207687_10268619 3300025927 Bacteria 1363
330 Ga0207687_11041236 3300025927 Bacteria 702
331 Ga0207644_10546442 3300025931 Bacteria 958
332 Ga0207690_10084893 3300025932 Bacteria 2221
333 Ga0207690_10125143 3300025932 Bacteria 1873
334 Ga0207706_10165130 3300025933 Bacteria 1946
335 Ga0207706_10184708 3300025933 Bacteria 1831
336 Ga0207706_10354974 3300025933 Bacteria 1274
337 Ga0207706_10719414 3300025933 Bacteria 852
338 Ga0207686_10019112 3300025934 Bacteria 3891
339 Ga0207686_10849670 3300025934 Bacteria 734
340 Ga0207686_11042093 3300025934 Bacteria 665
341 Ga0207709_10093790 3300025935 Bacteria 1969
342 Ga0207709_10221207 3300025935 Bacteria 1366
343 Ga0207670_10049620 3300025936 Bacteria 2809
344 Ga0207670_10645584 3300025936 Bacteria 872
345 Ga0207669_10002338 3300025937 Bacteria 8068
346 Ga0207669_10143078 3300025937 Bacteria 1663
347 Ga0207669_10581352 3300025937 Bacteria 908
348 Ga0207704_10007953 3300025938 Bacteria 5041
349 Ga0207704_10212301 3300025938 Bacteria 1425
350 Ga0207704_10486461 3300025938 Bacteria 992
351 Ga0207704_10813128 3300025938 Bacteria 781
352 Ga0207704_11386176 3300025938 Bacteria 602
353 Ga0207665_10053891 3300025939 Bacteria 2711
354 Ga0207665_10079026 3300025939 Bacteria 2261
355 Ga0207691_10145563 3300025940 Bacteria 2086
356 Ga0207691_10465500 3300025940 Bacteria 1075
357 Ga0207691_10675539 3300025940 Bacteria 872
358 Ga0207711_10000126 3300025941 Bacteria 80235
359 Ga0207711_10219977 3300025941 Bacteria 1736
360 Ga0207711_10571953 3300025941 Bacteria 1054
361 Ga0207689_10011016 3300025942 Bacteria 7771
362 Ga0207689_10014551 3300025942 Bacteria 6691
363 Ga0207689_10042467 3300025942 Bacteria 3761
364 Ga0207661_10452181 3300025944 Bacteria 1170
365 Ga0207661_11317457 3300025944 Bacteria 663
366 Ga0207679_10265230 3300025945 Bacteria 1466
367 Ga0207679_11995763 3300025945 Bacteria 528
368 Ga0207667_10155432 3300025949 Bacteria 2353
369 Ga0207651_10078378 3300025960 Bacteria 2370
370 Ga0207651_11432747 3300025960 Bacteria 622
371 Ga0207712_10000006 3300025961 Bacteria 573204
372 Ga0207712_10006011 3300025961 Bacteria 7657
373 Ga0207712_10036898 3300025961 Bacteria 3331
374 Ga0207712_10049473 3300025961 Bacteria 2929
375 Ga0207668_10013447 3300025972 Bacteria 5040
376 Ga0207640_10003772 3300025981 Bacteria 8169
377 Ga0207640_10040778 3300025981 Bacteria 2948
378 Ga0207640_10563651 3300025981 Bacteria 959
379 Ga0207658_10000382 3300025986 Bacteria 43284
380 Ga0207658_10007737 3300025986 Bacteria 7323
381 Ga0207658_10709283 3300025986 Bacteria 909
382 Ga0207658_11244036 3300025986 Bacteria 681
383 Ga0207677_10077856 3300026023 Bacteria 2366
384 Ga0207677_10087896 3300026023 Bacteria 2252
385 Ga0207677_10781176 3300026023 Bacteria 853
386 Ga0207703_10050061 3300026035 Bacteria 3379
387 Ga0207703_10094973 3300026035 Bacteria 2514
388 Ga0207703_10154382 3300026035 Bacteria 2004
389 Ga0207703_10186682 3300026035 Bacteria 1833
390 Ga0207703_10827705 3300026035 Bacteria 885
391 Ga0207639_10008148 3300026041 Bacteria 7164
392 Ga0207639_10466414 3300026041 Bacteria 1149
393 Ga0207678_10033781 3300026067 Bacteria 4455
394 Ga0207678_10034602 3300026067 Bacteria 4400
395 Ga0207678_10508456 3300026067 Bacteria 1051
396 Ga0207678_10667138 3300026067 Bacteria 914
397 Ga0207708_10000728 3300026075 Bacteria 24746
398 Ga0207708_10028118 3300026075 Bacteria 4257
399 Ga0207708_10249006 3300026075 Bacteria 1431
400 Ga0207702_10157562 3300026078 Bacteria 2071
401 Ga0207702_10855215 3300026078 Bacteria 900
402 Ga0207641_10002753 3300026088 Bacteria 16043
403 Ga0207641_10176172 3300026088 Bacteria 1955
404 Ga0207641_10505694 3300026088 Bacteria 1174
405 Ga0207641_10584982 3300026088 Bacteria 1091
406 Ga0207648_10000908 3300026089 Bacteria 33336
407 Ga0207676_10226851 3300026095 Bacteria 1667
408 Ga0207676_10950334 3300026095 Bacteria 845
409 Ga0207676_11106222 3300026095 Bacteria 783
410 Ga0207675_100000578 3300026118 Bacteria 35812
411 Ga0207675_100010916 3300026118 Bacteria 8511
412 Ga0207675_101090167 3300026118 Bacteria 818
413 Ga0207683_10000404 3300026121 Bacteria 39718
414 Ga0207683_10321507 3300026121 Bacteria 1417
415 Ga0207683_10386605 3300026121 Bacteria 1287
416 Ga0207683_10582704 3300026121 Bacteria 1035
417 Ga0207698_10051740 3300026142 Bacteria 3142
418 Ga0209813_10221433 3300027866 Bacteria 708
419 Ga0268266_10007193 3300028379 Bacteria 10079
420 Ga0268266_10077830 3300028379 Bacteria 2884
421 Ga0268266_10107317 3300028379 Bacteria 2469
422 Ga0268266_10150774 3300028379 Bacteria 2095
423 Ga0268266_10257369 3300028379 Bacteria 1616
424 Ga0268265_10000032 3300028380 Bacteria 225953
425 Ga0268265_10159787 3300028380 Bacteria 1912
426 Ga0268265_10379954 3300028380 Bacteria 1299
427 Ga0268264_10000026 3300028381 Bacteria 459088
428 Ga0268264_10135863 3300028381 Bacteria 2186
429 Ga0268264_10598504 3300028381 Bacteria 1086
430 Ga0268264_11914932 3300028381 Bacteria 602
431 Ga0307407_10675516 3300031903 Bacteria 776
432 Ga0307409_100109276 3300031995 Bacteria 2315
433 Ga0307507_10010875 3300033179 Bacteria 11614
434 Ga0373949_0040231 3300035090 Bacteria 1147
435 Ga0373931_0068675 3300035691 Bacteria 1929
436 Ga0373937_0794497 3300036401 Bacteria 894
437 Ga0316584_0330307 3300036712 Bacteria 1098
438 Ga0436365_0325053 3300039437 Bacteria 5947
439 Ga0436363_0865385 3300039450 Unclassified 1283
440 Ga0439461_0015184 3300041410 Bacteria 1473
441 Ga0439466_0001952 3300041411 Bacteria 8086
442 Ga0439465_0006220 3300041413 Bacteria 3793
443 Ga0439465_0038731 3300041413 Bacteria 1536
444 Ga0451793_0098176 3300041452 Bacteria 863
445 Ga0451800_0410530 3300041459 Bacteria 783
446 Ga0451839_0917277 3300041496 Bacteria 685
447 Ga0439431_0019179 3300041997 Bacteria 1623
448 Ga0439442_006681 3300042002 Bacteria 2318
449 Ga0439434_0015039 3300042435 Bacteria 2305
450 Ga0439434_0035157 3300042435 Bacteria 1531
451 Ga0451577_0391480 3300042876 Unclassified 1261
452 Ga0466972_0026598 3300044658 Bacteria 2868
453 Ga0466972_0034813 3300044658 Bacteria 2466
454 Ga0466972_0035010 3300044658 Bacteria 2458
455 Ga0466972_0193117 3300044658 Bacteria 954
456 Ga0466965_0237365 3300044683 Bacteria 975
457 Ga0466966_0715725 3300044684 Bacteria 603
458 Ga0466961_0247740 3300044693 Bacteria 1094
459 Ga0466963_0103180 3300044694 Bacteria 1954
460 Ga0466964_0029485 3300044706 Bacteria 2167
461 Ga0466964_0892189 3300044706 Bacteria 508
462 Ga0453684_0297860 3300044712 Unclassified 1834
463 Ga0466968_0055099 3300044735 Bacteria 1706
464 Ga0466968_0203475 3300044735 Bacteria 928
465 Ga0466970_0276708 3300044765 Bacteria 943
466 Ga0466970_0293512 3300044765 Bacteria 916
467 Ga0466957_0015373 3300044842 Bacteria 4471
468 Ga0466957_0247589 3300044842 Bacteria 1184
469 Ga0466960_0467201 3300044901 Bacteria 735
470 Ga0466959_0036673 3300045049 Bacteria 3622
471 Ga0466967_0037456 3300045976 Bacteria 4151
472 Ga0466967_0219083 3300045976 Bacteria 1808
473 Ga0495603_0159476 3300046455 Bacteria 1309
474 Ga0495638_0009790 3300046460 Bacteria 6694
475 Ga0495638_0282845 3300046460 Bacteria 900
476 Ga0495641_0199664 3300046461 Bacteria 896
477 Ga0495580_0403997 3300046472 Bacteria 921
478 Ga0495606_0259145 3300046507 Bacteria 961
479 Ga0495608_0646799 3300046511 Bacteria 632
480 Ga0495586_0414080 3300046535 Bacteria 776
481 Ga0495588_0323742 3300046674 Bacteria 811
482 Ga0495658_0137473 3300046683 Bacteria 1492
483 Ga0495671_0605868 3300046692 Bacteria 521
484 Ga0495660_0451363 3300046810 Bacteria 556
485 Ga0495674_0181147 3300047319 Bacteria 1754
486 Ga0495676_0124712 3300047321 Bacteria 1868
487 Ga0495593_0054646 3300047673 Bacteria 2104
488 Ga0495614_0237125 3300048089 Bacteria 832
489 Ga0496100_0009668 3300048903 Bacteria 5423
490 Ga0496100_0183526 3300048903 Bacteria 1514
491 Ga0496101_0015995 3300048904 Bacteria 5063
492 Ga0496101_0323762 3300048904 Bacteria 1209
493 Ga0496101_0512020 3300048904 Bacteria 948
494 Ga0496101_1530477 3300048904 Bacteria 519
495 Ga0496102_0000427 3300048905 Bacteria 48669
496 Ga0496102_0015185 3300048905 Bacteria 6703
497 Ga0496102_0022823 3300048905 Bacteria 5548
498 Ga0496102_0113142 3300048905 Bacteria 2532
499 Ga0496102_0113415 3300048905 Bacteria 2529
500 Ga0496102_0338149 3300048905 Bacteria 1418
501 Ga0496102_1789904 3300048905 Bacteria 531
502 Ga0496103_0000277 3300048906 Bacteria 48396
503 Ga0496103_0001238 3300048906 Bacteria 17435
504 Ga0496104_0474294 3300048907 Bacteria 1163
505 Ga0496104_0639291 3300048907 Bacteria 973
506 Ga0496106_0001589 3300048909 Bacteria 17075
507 Ga0496106_0028997 3300048909 Bacteria 4124
508 Ga0496106_0332063 3300048909 Bacteria 1221
509 Ga0496107_0002369 3300048910 Bacteria 12198
510 Ga0496107_0031733 3300048910 Bacteria 3772
511 Ga0496107_0176154 3300048910 Bacteria 1588
512 Ga0496108_0003260 3300048911 Bacteria 13051
513 Ga0496108_0016446 3300048911 Bacteria 6034
514 Ga0496108_0168431 3300048911 Bacteria 1894
515 Ga0496108_0234699 3300048911 Bacteria 1595
516 Ga0496108_0648647 3300048911 Bacteria 918
517 Ga0496108_0672933 3300048911 Bacteria 899
518 Ga0496109_0001495 3300048912 Bacteria 19414
519 Ga0496109_0160631 3300048912 Bacteria 2105
520 Ga0496109_0166792 3300048912 Bacteria 2065
521 Ga0496109_0330642 3300048912 Bacteria 1439
522 Ga0496109_0889573 3300048912 Bacteria 828
523 Ga0496109_1955660 3300048912 Bacteria 519
524 Ga0496110_0303850 3300048913 Bacteria 1453
525 Ga0496110_0541997 3300048913 Bacteria 1058
526 Ga0496110_0708616 3300048913 Bacteria 908
527 Ga0496111_0115248 3300048914 Bacteria 1981
528 Ga0496111_0427594 3300048914 Bacteria 978
529 Ga0496112_0007750 3300048915 Bacteria 9555
530 Ga0496112_0096136 3300048915 Bacteria 2933
531 Ga0496112_0170267 3300048915 Bacteria 2143
532 Ga0496113_0033189 3300048916 Bacteria 3757
533 Ga0496113_0695179 3300048916 Bacteria 812
534 Ga0496114_0001563 3300048917 Bacteria 17380
535 Ga0496115_0002480 3300048918 Bacteria 13266
536 Ga0496115_0435368 3300048918 Bacteria 1061
537 Ga0496116_0053477 3300048919 Bacteria 2666
538 Ga0496117_0002725 3300048920 Bacteria 21693
539 Ga0496118_0000857 3300048921 Bacteria 48262
540 Ga0496119_0015080 3300048922 Bacteria 5982
541 Ga0496120_0084446 3300048923 Bacteria 1711
542 Ga0496121_0033341 3300048924 Bacteria 4661
543 Ga0496124_0004226 3300048927 Bacteria 16903
544 Ga0496125_0048958 3300048928 Bacteria 3517
545 Ga0496126_0035752 3300048929 Bacteria 4651
546 Ga0496126_0051263 3300048929 Bacteria 3757
547 Ga0496126_0146881 3300048929 Bacteria 2024
548 Ga0501034_0587949 3300049571 Unclassified 1020
549 nmdc:mga03n38_164197_c1 3300050490 Bacteria 1126
550 nmdc:mga03n38_224107_c1 3300050490 Bacteria 983
551 nmdc:mga03n38_314721_c1 3300050490 Bacteria 844
552 nmdc:mga03n38_3522_c1 3300050490 Bacteria 5047
553 nmdc:mga03n38_407038_c1 3300050490 Bacteria 750
554 nmdc:mga03n38_5108_c1 3300050490 Bacteria 4429
555 nmdc:mga03n38_63842_c1 3300050490 Bacteria 1684
556 nmdc:mga00v17_1218_c1 3300050491 Bacteria 13509
557 nmdc:mga00v17_37839_c1 3300050491 Bacteria 2883
558 nmdc:mga00v17_456080_c1 3300050491 Bacteria 830
559 nmdc:mga00v17_847210_c1 3300050491 Bacteria 581
560 nmdc:mga0yw44_1205623_c1 3300050492 Bacteria 511
561 nmdc:mga0yw44_850722_c1 3300050492 Bacteria 619
562 nmdc:mga06z11_224681_c1 3300050494 Bacteria 1098
563 nmdc:mga06z11_227275_c1 3300050494 Bacteria 1092
564 nmdc:mga06z11_655236_c1 3300050494 Bacteria 639
565 nmdc:mga06z11_892629_c1 3300050494 Unclassified 542
566 nmdc:mga04h51_252576_c1 3300050495 Bacteria 707
567 nmdc:mga07m45_235252_c1 3300050496 Bacteria 1066
568 nmdc:mga07m45_263664_c1 3300050496 Bacteria 1002
569 nmdc:mga07m45_2692_c1 3300050496 Bacteria 8370
570 nmdc:mga07m45_95064_c2 3300050496 Bacteria 1252
571 nmdc:mga08y16_571867_c1 3300050511 Bacteria 1142
572 nmdc:mga0sz30_10197_c1 3300050516 Bacteria 3595
573 nmdc:mga0sz30_321563_c1 3300050516 Bacteria 691
574 nmdc:mga0sz30_382639_c1 3300050516 Bacteria 630
575 Ga0495601_0187556 3300053077 Bacteria 1352
576 Ga0500635_0091074 3300053080 Bacteria 1109
577 Ga0495619_0061466 3300053085 Bacteria 2500
578 Ga0500643_006602 3300053087 Bacteria 4823
579 Ga0500650_0081883 3300053098 Bacteria 1510
580 Ga0500556_0014480 3300053104 Bacteria 2409
581 Ga0500607_234277 3300053121 Unclassified 749
582 Ga0500642_0144666 3300053130 Bacteria 1116
583 Ga0500652_000473 3300053131 Bacteria 14235
584 Ga0500652_075801 3300053131 Bacteria 1398
585 Ga0500559_0289439 3300053136 Bacteria 770
586 Ga0500568_0281505 3300053139 Bacteria 604
587 Ga0500577_0116976 3300053142 Bacteria 1106
588 Ga0500645_000388 3300053730 Bacteria 30774
589 Ga0500645_009461 3300053730 Bacteria 3272
590 Ga0587073_0113754 3300059492 Bacteria 721
591 Ga0466962_0140621 3300061719 Bacteria 1169
592 2902801236 2902799365 Bacteria 5419524
593 8047718766 8047710418 Bacteria 11023148
594 Ga0495638_0008745
595 JGI24745J21846_1001025
596 JGI24745J21846_1002809
597 JGI24744J21845_10001556
598 JGI24744J21845_10077394
599 rootL2_10338403
600 Ga0070683_100195330
601 Ga0070683_100564837
602 Ga0070683_100752890
603 Ga0070690_100030736
604 Ga0070690_100808067
605 Ga0070690_101364277
606 Ga0068869_100012521
607 Ga0068869_100296847
608 Ga0068869_100326029
609 Ga0070666_10020187
610 Ga0070680_100823947
611 Ga0070682_100031325
612 Ga0070682_100048051
613 Ga0068868_100003012
614 Ga0068868_100053209
615 Ga0068868_100095255
616 Ga0068868_100403507
617 Ga0070660_100173839
618 Ga0070689_100070803
619 Ga0070689_100597360
620 Ga0070661_100049955
621 Ga0070692_10071776
622 Ga0070692_10737692
623 Ga0070668_100000504
624 Ga0070668_100062792
625 Ga0070668_100161837
626 Ga0070668_100179828
627 Ga0070668_100382089
628 Ga0070668_101569142
629 Ga0070669_100004332
630 Ga0070669_101638175
631 Ga0070671_100001009
632 Ga0070671_100614505
633 Ga0070674_100095114
634 Ga0070674_100476183
635 Ga0070673_100361700
636 Ga0070673_101123646
637 Ga0070688_100714707
638 Ga0070659_100038887
639 Ga0070659_100114687
640 Ga0070659_100772226
641 Ga0070659_101455796
642 Ga0070667_100000034
643 Ga0070667_100098734
644 Ga0070667_101124292
645 Ga0070709_10065943
646 Ga0070714_100675168
647 Ga0070713_100041536
648 Ga0070713_100235981
649 Ga0070710_10020203
650 Ga0070710_10323831
651 Ga0070710_10333566
652 Ga0070701_10001026
653 Ga0070701_10106498
654 Ga0070711_100000671
655 Ga0070711_100001367
656 Ga0070711_100418096
657 Ga0070705_100093661
658 Ga0070700_100002061
659 Ga0070700_100111472
660 Ga0070700_100195068
661 Ga0070694_100010310
662 Ga0070663_100011393
663 Ga0070663_100029145
664 Ga0070663_100041922
665 Ga0070663_100466129
666 Ga0070663_100527967
667 Ga0070663_101034578
668 Ga0070678_100000064
669 Ga0070678_100360535
670 Ga0070678_100541750
671 Ga0070662_100098403
672 Ga0070662_100103675
673 Ga0070662_100363319
674 Ga0070662_100397378
675 Ga0070662_100710715
676 Ga0070681_10724193
677 Ga0070681_11594388
678 Ga0068867_100001251
679 Ga0070685_10092613
680 Ga0070685_10256358
681 Ga0070685_10554329
682 Ga0070679_100221512
683 Ga0070684_100671743
684 Ga0070684_101017995
685 Ga0070697_100698466
686 Ga0068853_100001795
687 Ga0068853_100343697
688 Ga0068853_100981381
689 Ga0068853_102008376
690 Ga0070672_100145534
691 Ga0070686_100253186
692 Ga0070686_100307481
693 Ga0070695_100014495
694 Ga0070696_100002193
695 Ga0070696_100147795
696 Ga0070693_100058855
697 Ga0070693_100977441
698 Ga0070665_100004867
699 Ga0070665_100029211
700 Ga0070665_100110683
701 Ga0070665_100208952
702 Ga0070665_100346568
703 Ga0070704_100000548
704 Ga0068855_101201274
705 Ga0070664_100291028
706 Ga0070664_100387532
707 Ga0068857_100473139
708 Ga0068854_100000969
709 Ga0068854_100012397
710 Ga0068856_100638016
711 Ga0070702_100003523
712 Ga0070702_100557845
713 Ga0068852_100136446
714 Ga0068852_100144593
715 Ga0068852_100847351
716 Ga0068859_100003260
717 Ga0068859_100005128
718 Ga0068859_100133561
719 Ga0068859_100841735
720 Ga0068864_100317815
721 Ga0068864_100380203
722 Ga0068864_100492513
723 Ga0068864_101072854
724 Ga0068866_10000114
725 Ga0068866_10440602
726 Ga0068861_100049067
727 Ga0068861_100505345
728 Ga0068861_100652282
729 Ga0068851_10027395
730 Ga0068870_10332072
731 Ga0068863_100000993
732 Ga0068863_100012246
733 Ga0068863_100152566
734 Ga0068858_100044491
735 Ga0068858_100185535
736 Ga0068858_100190365
737 Ga0068858_100246419
738 Ga0068860_100000011
739 Ga0068860_100015022
740 Ga0068860_100178486
741 Ga0068860_100235566
742 Ga0068860_100545237
743 Ga0068862_100000139
744 Ga0068862_100001409
745 Ga0081455_10075665
746 Ga0081455_10095494
747 Ga0081538_10110141
748 Ga0070717_10175036
749 Ga0070717_10911830
750 Ga0075365_10049773
751 Ga0075365_10080543
752 Ga0075365_10335315
753 Ga0075368_10098251
754 Ga0075363_100010843
755 Ga0075363_100011045
756 Ga0075363_100040989
757 Ga0075363_100049200
758 Ga0075363_100080112
759 Ga0075363_100481039
760 Ga0075364_10004841
761 Ga0075364_10052485
762 Ga0075364_10260270
763 Ga0070715_10017175
764 Ga0070715_10075036
765 Ga0070716_100002208
766 Ga0070716_100064332
767 Ga0070716_100840593
768 Ga0070712_100000315
769 Ga0070712_100189939
770 Ga0075362_10074235
771 Ga0075362_10106504
772 Ga0075362_10128607
773 Ga0075367_10037239
774 Ga0075367_10290079
775 Ga0075367_10531006
776 Ga0075369_10027160
777 Ga0075369_10097907
778 Ga0097621_100028631
779 Ga0075370_10014168
780 Ga0075370_10019370
781 Ga0075370_10246314
782 Ga0075370_10435705
783 Ga0068871_100161992
784 Ga0068865_100000939
785 Ga0068865_100091822
786 Ga0068865_100703709
787 Ga0068865_101269611
788 Ga0068865_101805190
789 Ga0097620_100003260
790 Ga0097620_100005128
791 Ga0097620_100133562
792 Ga0097620_100841837
793 Ga0105250_10155843
794 Ga0105245_10000356
795 Ga0105245_10081868
796 Ga0105245_10343519
797 Ga0105245_10508830
798 Ga0105245_10861763
799 Ga0105245_11859108
800 Ga0105247_10000067
801 Ga0105247_10000092
802 Ga0105247_10552367
803 Ga0105247_10784643
804 Ga0105243_10045910
805 Ga0105243_10359264
806 Ga0105243_11067350
807 Ga0105243_11455725
808 Ga0105241_10212917
809 Ga0105241_10789131
810 Ga0105241_10792352
811 Ga0105241_10822838
812 Ga0105241_10902643
813 Ga0105242_10000901
814 Ga0105242_10395358
815 Ga0105248_10000040
816 Ga0105248_10022232
817 Ga0105248_10668340
818 Ga0105248_10746328
819 Ga0105248_12668784
820 Ga0105237_10089600
821 Ga0105237_10198063
822 Ga0105237_11773607
823 Ga0105238_10176937
824 Ga0105238_10228546
825 Ga0105238_10324673
826 Ga0105249_10000001
827 Ga0105249_10000380
828 Ga0105249_10592020
829 Ga0105239_10003452
830 Ga0105239_10050722
831 Ga0105239_10071314
832 Ga0105239_10375667
833 Ga0105239_10412441
834 Ga0105239_10432762
835 Ga0105239_10463765
836 Ga0105246_10095983
837 Ga0105246_10183323
838 Ga0105246_11939390
839 Ga0157371_10583981
840 Ga0157369_11052218
841 Ga0157369_11117270
842 Ga0157378_10000785
843 Ga0163162_10002590
844 Ga0163162_10030485
845 Ga0163162_10041787
846 Ga0163162_10099750
847 Ga0163162_10299850
848 Ga0163162_10803822
849 Ga0163162_12526221
850 Ga0157372_10001640
851 Ga0157372_10170917
852 Ga0157372_10660069
853 Ga0157372_10874026
854 Ga0157372_11245453
855 Ga0157375_10018467
856 Ga0157375_10679705
857 Ga0157375_11336577
858 Ga0157375_12125391
859 Ga0157375_12774386
860 Ga0163163_10092572
861 Ga0163163_10102613
862 Ga0163163_10164469
863 Ga0163163_10249589
864 Ga0163163_10251344
865 Ga0163163_10486374
866 Ga0157380_10049046
867 Ga0157380_10069133
868 Ga0182008_10109863
869 Ga0157377_10222098
870 Ga0157377_10588479
871 Ga0157379_10249364
872 Ga0157379_10322341
873 Ga0157379_10373930
874 Ga0157376_10717383
875 Ga0163161_10014978
876 Ga0163161_10331075
877 Ga0163161_10590208
878 Ga0206349_1977716
879 Ga0206350_10343026
880 Ga0206353_11286272
881 Ga0213876_10064343
882 Ga0224712_10567969
883 Ga0224712_10624524
884 Ga0207656_10022548
885 Ga0207692_10931416
886 Ga0207642_10081253
887 Ga0207642_10573800
888 Ga0207710_10000094
889 Ga0207710_10008718
890 Ga0207688_10001153
891 Ga0207688_10017968
892 Ga0207680_10773394
893 Ga0207647_10259098
894 Ga0207685_10011967
895 Ga0207699_10992660
896 Ga0207645_10016774
897 Ga0207645_10028471
898 Ga0207643_10021679
899 Ga0207705_10212325
900 Ga0207654_10238166
901 Ga0207654_10473498
902 Ga0207654_10759492
903 Ga0207671_10150297
904 Ga0207693_10000389
905 Ga0207693_10299583
906 Ga0207660_10758752
907 Ga0207657_10067428
908 Ga0207657_10767952
909 Ga0207649_11502350
910 Ga0207652_10439334
911 Ga0207681_10013581
912 Ga0207681_10182171
913 Ga0207681_10399915
914 Ga0207694_10130476
915 Ga0207694_10396966
916 Ga0207694_10985961
917 Ga0207650_10611240
918 Ga0207659_10276095
919 Ga0207687_10013726
920 Ga0207687_10044026
921 Ga0207687_10115368
922 Ga0207687_10268619
923 Ga0207687_11041236
924 Ga0207644_10546442
925 Ga0207690_10084893
926 Ga0207690_10125143
927 Ga0207706_10165130
928 Ga0207706_10184708
929 Ga0207706_10354974
930 Ga0207706_10719414
931 Ga0207686_10019112
932 Ga0207686_10849670
933 Ga0207686_11042093
934 Ga0207709_10093790
935 Ga0207709_10221207
936 Ga0207670_10049620
937 Ga0207670_10645584
938 Ga0207669_10002338
939 Ga0207669_10143078
940 Ga0207669_10581352
941 Ga0207704_10007953
942 Ga0207704_10212301
943 Ga0207704_10486461
944 Ga0207704_10813128
945 Ga0207704_11386176
946 Ga0207665_10053891
947 Ga0207665_10079026
948 Ga0207691_10145563
949 Ga0207691_10465500
950 Ga0207691_10675539
951 Ga0207711_10000126
952 Ga0207711_10219977
953 Ga0207711_10571953
954 Ga0207689_10011016
955 Ga0207689_10014551
956 Ga0207689_10042467
957 Ga0207661_10452181
958 Ga0207661_11317457
959 Ga0207679_10265230
960 Ga0207679_11995763
961 Ga0207667_10155432
962 Ga0207651_10078378
963 Ga0207651_11432747
964 Ga0207712_10000006
965 Ga0207712_10006011
966 Ga0207712_10036898
967 Ga0207712_10049473
968 Ga0207668_10013447
969 Ga0207640_10003772
970 Ga0207640_10040778
971 Ga0207640_10563651
972 Ga0207658_10000382
973 Ga0207658_10007737
974 Ga0207658_10709283
975 Ga0207658_11244036
976 Ga0207677_10077856
977 Ga0207677_10087896
978 Ga0207677_10781176
979 Ga0207703_10050061
980 Ga0207703_10094973
981 Ga0207703_10154382
982 Ga0207703_10186682
983 Ga0207703_10827705
984 Ga0207639_10008148
985 Ga0207639_10466414
986 Ga0207678_10033781
987 Ga0207678_10034602
988 Ga0207678_10508456
989 Ga0207678_10667138
990 Ga0207708_10000728
991 Ga0207708_10028118
992 Ga0207708_10249006
993 Ga0207702_10157562
994 Ga0207702_10855215
995 Ga0207641_10002753
996 Ga0207641_10176172
997 Ga0207641_10505694
998 Ga0207641_10584982
999 Ga0207648_10000908
1000 Ga0207676_10226851
1001 Ga0207676_10950334
1002 Ga0207676_11106222
1003 Ga0207675_100000578
1004 Ga0207675_100010916
1005 Ga0207675_101090167
1006 Ga0207683_10000404
1007 Ga0207683_10321507
1008 Ga0207683_10386605
1009 Ga0207683_10582704
1010 Ga0207698_10051740
1011 Ga0209813_10221433
1012 Ga0268266_10007193
1013 Ga0268266_10077830
1014 Ga0268266_10107317
1015 Ga0268266_10150774
1016 Ga0268266_10257369
1017 Ga0268265_10000032
1018 Ga0268265_10159787
1019 Ga0268265_10379954
1020 Ga0268264_10000026
1021 Ga0268264_10135863
1022 Ga0268264_10598504
1023 Ga0268264_11914932
1024 Ga0307407_10675516
1025 Ga0307409_100109276
1026 Ga0307507_10010875
1027 Ga0373949_0040231
1028 Ga0373931_0068675
1029 Ga0373937_0794497
1030 Ga0316584_0330307
1031 Ga0436365_0325053
1032 Ga0436363_0865385
1033 Ga0439461_0015184
1034 Ga0439466_0001952
1035 Ga0439465_0006220
1036 Ga0439465_0038731
1037 Ga0451793_0098176
1038 Ga0451800_0410530
1039 Ga0451839_0917277
1040 Ga0439431_0019179
1041 Ga0439442_006681
1042 Ga0439434_0015039
1043 Ga0439434_0035157
1044 Ga0451577_0391480
1045 Ga0466972_0026598
1046 Ga0466972_0034813
1047 Ga0466972_0035010
1048 Ga0466972_0193117
1049 Ga0466965_0237365
1050 Ga0466966_0715725
1051 Ga0466961_0247740
1052 Ga0466963_0103180
1053 Ga0466964_0029485
1054 Ga0466964_0892189
1055 Ga0453684_0297860
1056 Ga0466968_0055099
1057 Ga0466968_0203475
1058 Ga0466970_0276708
1059 Ga0466970_0293512
1060 Ga0466957_0015373
1061 Ga0466957_0247589
1062 Ga0466960_0467201
1063 Ga0466959_0036673
1064 Ga0466967_0037456
1065 Ga0466967_0219083
1066 Ga0495603_0159476
1067 Ga0495638_0009790
1068 Ga0495638_0282845
1069 Ga0495641_0199664
1070 Ga0495580_0403997
1071 Ga0495606_0259145
1072 Ga0495608_0646799
1073 Ga0495586_0414080
1074 Ga0495588_0323742
1075 Ga0495658_0137473
1076 Ga0495671_0605868
1077 Ga0495660_0451363
1078 Ga0495674_0181147
1079 Ga0495676_0124712
1080 Ga0495593_0054646
1081 Ga0495614_0237125
1082 Ga0496100_0009668
1083 Ga0496100_0183526
1084 Ga0496101_0015995
1085 Ga0496101_0323762
1086 Ga0496101_0512020
1087 Ga0496101_1530477
1088 Ga0496102_0000427
1089 Ga0496102_0015185
1090 Ga0496102_0022823
1091 Ga0496102_0113142
1092 Ga0496102_0113415
1093 Ga0496102_0338149
1094 Ga0496102_1789904
1095 Ga0496103_0000277
1096 Ga0496103_0001238
1097 Ga0496104_0474294
1098 Ga0496104_0639291
1099 Ga0496106_0001589
1100 Ga0496106_0028997
1101 Ga0496106_0332063
1102 Ga0496107_0002369
1103 Ga0496107_0031733
1104 Ga0496107_0176154
1105 Ga0496108_0003260
1106 Ga0496108_0016446
1107 Ga0496108_0168431
1108 Ga0496108_0234699
1109 Ga0496108_0648647
1110 Ga0496108_0672933
1111 Ga0496109_0001495
1112 Ga0496109_0160631
1113 Ga0496109_0166792
1114 Ga0496109_0330642
1115 Ga0496109_0889573
1116 Ga0496109_1955660
1117 Ga0496110_0303850
1118 Ga0496110_0541997
1119 Ga0496110_0708616
1120 Ga0496111_0115248
1121 Ga0496111_0427594
1122 Ga0496112_0007750
1123 Ga0496112_0096136
1124 Ga0496112_0170267
1125 Ga0496113_0033189
1126 Ga0496113_0695179
1127 Ga0496114_0001563
1128 Ga0496115_0002480
1129 Ga0496115_0435368
1130 Ga0496116_0053477
1131 Ga0496117_0002725
1132 Ga0496118_0000857
1133 Ga0496119_0015080
1134 Ga0496120_0084446
1135 Ga0496121_0033341
1136 Ga0496124_0004226
1137 Ga0496125_0048958
1138 Ga0496126_0035752
1139 Ga0496126_0051263
1140 Ga0496126_0146881
1141 Ga0501034_0587949
1142 nmdc:mga03n38_164197_c1
1143 nmdc:mga03n38_224107_c1
1144 nmdc:mga03n38_314721_c1
1145 nmdc:mga03n38_3522_c1
1146 nmdc:mga03n38_407038_c1
1147 nmdc:mga03n38_5108_c1
1148 nmdc:mga03n38_63842_c1
1149 nmdc:mga00v17_1218_c1
1150 nmdc:mga00v17_37839_c1
1151 nmdc:mga00v17_456080_c1
1152 nmdc:mga00v17_847210_c1
1153 nmdc:mga0yw44_1205623_c1
1154 nmdc:mga0yw44_850722_c1
1155 nmdc:mga06z11_224681_c1
1156 nmdc:mga06z11_227275_c1
1157 nmdc:mga06z11_655236_c1
1158 nmdc:mga06z11_892629_c1
1159 nmdc:mga04h51_252576_c1
1160 nmdc:mga07m45_235252_c1
1161 nmdc:mga07m45_263664_c1
1162 nmdc:mga07m45_2692_c1
1163 nmdc:mga07m45_95064_c2
1164 nmdc:mga08y16_571867_c1
1165 nmdc:mga0sz30_10197_c1
1166 nmdc:mga0sz30_321563_c1
1167 nmdc:mga0sz30_382639_c1
1168 Ga0495601_0187556
1169 Ga0500635_0091074
1170 Ga0495619_0061466
1171 Ga0500643_006602
1172 Ga0500650_0081883
1173 Ga0500556_0014480
1174 Ga0500607_234277
1175 Ga0500642_0144666
1176 Ga0500652_000473
1177 Ga0500652_075801
1178 Ga0500559_0289439
1179 Ga0500568_0281505
1180 Ga0500577_0116976
1181 Ga0500645_000388
1182 Ga0500645_009461
1183 Ga0587073_0113754
1184 Ga0466962_0140621
1185 2902801236
1186 8047718766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

19

147

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h96-assembly2.cif.gz_B msmeg_3358 f420 reductase 0.972 8 139
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9542 30 138
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.9375 30 138
8d4w-assembly1.cif.gz_A-2 asymmetric ene-reduction of alpha,beta-unsaturated compounds using msmeg_2850 0.9323 5 139
3h96-assembly2.cif.gz_B msmeg_3358 f420 reductase 0.9306 8 139
ID Description Score Start End Superfamily
3h96B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9445 8 139 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9257 23 139 2.30.110.10
3h96B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.924 8 139 2.30.110.10
af_P9WP15_14_151_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9093 6 138 2.30.110.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.903 23 139 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A6J4QLH3-F1-model_v4 AclJ 0.9977 8 139 GO:0005886
GO:0016491
GO:0070967
AF-A0A6M6JP87-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9963 6 139 GO:0005886
GO:0016491
GO:0070967
AF-A0A852WMS6-F1-model_v4 Deazaflavin-dependent oxidoreductase (Nitroreductase family) 0.9951 8 140 GO:0005886
GO:0016491
GO:0070967
AF-A0A370BAJ9-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9911 8 139 GO:0005886
GO:0016491
GO:0070967
AF-A0A5N0VGX6-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9909 8 140 GO:0005886
GO:0016491
GO:0070967

Map