F467792

General Info

Members Datasets Scaffolds Average Seq Length
598 212 1196 74

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_11041496|Ga0207700_110414962
Length 86
Sequence MAARQVEGVWGMRMMNEFEAQVLSDLSVLKTQMNGLTGDGNGGRFAELERRVESHEQNWQRAKGFMAAASVLYAVIEVALGAWFRR

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
151 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 4.68
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 23.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_11041496 3300025928 Unclassified 732
2 LJNas_1000445 3300000546 Bacteria 7265
3 JGI24735J21928_10221963 3300002067 Unclassified 549
4 rootH2_10014960 3300003320 Bacteria 2599
5 rootH2_10038031 3300003320 Bacteria 12803
6 rootH2_10189653 3300003320 Bacteria 1241
7 Ga0070658_10011404 3300005327 Bacteria 7127
8 Ga0070658_10068225 3300005327 Bacteria 2907
9 Ga0070658_10257861 3300005327 Bacteria 1480
10 Ga0070658_10699536 3300005327 Unclassified 880
11 Ga0070658_11079873 3300005327 Bacteria 698
12 Ga0070676_10097301 3300005328 Bacteria 1813
13 Ga0070683_100009113 3300005329 Bacteria 8472
14 Ga0070683_100057420 3300005329 Bacteria 3615
15 Ga0070683_100507523 3300005329 Unclassified 1152
16 Ga0070683_101055930 3300005329 Unclassified 780
17 Ga0070683_102411348 3300005329 Unclassified 504
18 Ga0070690_101743078 3300005330 Unclassified 507
19 Ga0070670_100791731 3300005331 Bacteria 856
20 Ga0070666_10211039 3300005335 Bacteria 1367
21 Ga0070680_100106861 3300005336 Bacteria 2327
22 Ga0070680_100196011 3300005336 Bacteria 1703
23 Ga0070680_100326827 3300005336 Bacteria 1302
24 Ga0070682_100875093 3300005337 Bacteria 736
25 Ga0068868_100009670 3300005338 Bacteria 6959
26 Ga0068868_100013118 3300005338 Bacteria 6069
27 Ga0068868_100545992 3300005338 Bacteria 1021
28 Ga0070660_100004954 3300005339 Bacteria 9209
29 Ga0070660_100118005 3300005339 Bacteria 2116
30 Ga0070660_100934264 3300005339 Bacteria 732
31 Ga0070691_10782907 3300005341 Unclassified 579
32 Ga0070661_100040639 3300005344 Bacteria 3394
33 Ga0070661_100056704 3300005344 Bacteria 2870
34 Ga0070661_100245228 3300005344 Bacteria 1381
35 Ga0070661_100763663 3300005344 Bacteria 791
36 Ga0070668_100698386 3300005347 Unclassified 895
37 Ga0070675_100998161 3300005354 Bacteria 768
38 Ga0070671_100059828 3300005355 Bacteria 3171
39 Ga0070671_100953273 3300005355 Bacteria 751
40 Ga0070671_101214909 3300005355 Bacteria 664
41 Ga0070673_101207679 3300005364 Unclassified 708
42 Ga0070667_100058072 3300005367 Bacteria 3271
43 Ga0070667_100136194 3300005367 Bacteria 2147
44 Ga0070709_10568833 3300005434 Bacteria 869
45 Ga0070709_10836405 3300005434 Unclassified 724
46 Ga0070714_100123067 3300005435 Unclassified 2309
47 Ga0070714_102291542 3300005435 Unclassified 525
48 Ga0070713_100083216 3300005436 Bacteria 2735
49 Ga0070713_100138767 3300005436 Bacteria 2151
50 Ga0070713_100379213 3300005436 Bacteria 1317
51 Ga0070713_100386324 3300005436 Bacteria 1305
52 Ga0070713_101190704 3300005436 Unclassified 737
53 Ga0070713_101605842 3300005436 Unclassified 631
54 Ga0070713_102014798 3300005436 Unclassified 560
55 Ga0070713_102328620 3300005436 Unclassified 518
56 Ga0070710_10386830 3300005437 Unclassified 934
57 Ga0070663_100012599 3300005455 Bacteria 5358
58 Ga0070663_101108156 3300005455 Unclassified 692
59 Ga0070663_101803477 3300005455 Bacteria 548
60 Ga0070678_100018680 3300005456 Bacteria 4498
61 Ga0070681_10001472 3300005458 Bacteria 20780
62 Ga0070681_10311786 3300005458 Bacteria 1483
63 Ga0070681_10312540 3300005458 Bacteria 1481
64 Ga0070681_10677141 3300005458 Bacteria 947
65 Ga0068867_101027353 3300005459 Bacteria 749
66 Ga0070679_100000871 3300005530 Bacteria 26220
67 Ga0070679_100185803 3300005530 Bacteria 2049
68 Ga0070679_101311760 3300005530 Bacteria 670
69 Ga0070684_100005878 3300005535 Bacteria 9449
70 Ga0070684_100006135 3300005535 Bacteria 9262
71 Ga0070684_100349925 3300005535 Unclassified 1359
72 Ga0070684_100394718 3300005535 Bacteria 1275
73 Ga0070684_100528971 3300005535 Bacteria 1093
74 Ga0070684_101187205 3300005535 Bacteria 718
75 Ga0068853_100000264 3300005539 Bacteria 36901
76 Ga0068853_100286693 3300005539 Unclassified 1519
77 Ga0068853_100814003 3300005539 Bacteria 895
78 Ga0068853_100916891 3300005539 Bacteria 842
79 Ga0068853_101391694 3300005539 Bacteria 678
80 Ga0070672_100023654 3300005543 Bacteria 4532
81 Ga0070693_100574649 3300005547 Unclassified 810
82 Ga0070665_100026489 3300005548 Bacteria 5837
83 Ga0070665_100042113 3300005548 Bacteria 4590
84 Ga0070665_100156339 3300005548 Bacteria 2282
85 Ga0070665_100611990 3300005548 Bacteria 1102
86 Ga0068855_100000216 3300005563 Bacteria 73411
87 Ga0068855_100002826 3300005563 Bacteria 21376
88 Ga0068855_100004763 3300005563 Bacteria 16574
89 Ga0068855_100017509 3300005563 Bacteria 8616
90 Ga0068855_100026837 3300005563 Bacteria 6891
91 Ga0068855_100191077 3300005563 Bacteria 2309
92 Ga0068855_100365513 3300005563 Unclassified 1587
93 Ga0070664_100059993 3300005564 Bacteria 3238
94 Ga0070664_100332484 3300005564 Bacteria 1379
95 Ga0070664_100472440 3300005564 Bacteria 1153
96 Ga0070664_100647025 3300005564 Bacteria 982
97 Ga0070664_100727388 3300005564 Bacteria 926
98 Ga0068857_100010004 3300005577 Bacteria 8234
99 Ga0068857_100040005 3300005577 Bacteria 4157
100 Ga0068854_100014526 3300005578 Bacteria 5194
101 Ga0068854_100047474 3300005578 Bacteria 3060
102 Ga0068856_100002530 3300005614 Bacteria 18841
103 Ga0068856_100007900 3300005614 Bacteria 10392
104 Ga0068856_100089891 3300005614 Bacteria 3054
105 Ga0068856_100104272 3300005614 Unclassified 2829
106 Ga0068856_100288021 3300005614 Bacteria 1659
107 Ga0068856_100358326 3300005614 Bacteria 1477
108 Ga0068856_100435896 3300005614 Bacteria 1331
109 Ga0068856_100894381 3300005614 Unclassified 907
110 Ga0068856_101483392 3300005614 Bacteria 692
111 Ga0068856_102647479 3300005614 Unclassified 507
112 Ga0068852_100000042 3300005616 Bacteria 91949
113 Ga0068852_100000046 3300005616 Bacteria 87937
114 Ga0068852_100077133 3300005616 Bacteria 2945
115 Ga0068852_100093066 3300005616 Bacteria 2701
116 Ga0068852_100428582 3300005616 Bacteria 1306
117 Ga0068852_102248032 3300005616 Unclassified 567
118 Ga0068859_100014606 3300005617 Bacteria 7888
119 Ga0068864_100000314 3300005618 Bacteria 42771
120 Ga0068866_10779922 3300005718 Unclassified 663
121 Ga0068861_100348137 3300005719 Bacteria 1299
122 Ga0068851_10040788 3300005834 Bacteria 2334
123 Ga0068851_10048812 3300005834 Bacteria 2146
124 Ga0068851_10228333 3300005834 Unclassified 1048
125 Ga0068863_100053677 3300005841 Bacteria 3820
126 Ga0068860_100364228 3300005843 Bacteria 1425
127 Ga0070717_10166908 3300006028 Bacteria 1912
128 Ga0070717_11121696 3300006028 Bacteria 716
129 Ga0070717_11321614 3300006028 Unclassified 655
130 Ga0070712_100290525 3300006175 Bacteria 1320
131 Ga0070712_100633963 3300006175 Bacteria 907
132 Ga0097621_100015955 3300006237 Bacteria 5665
133 Ga0097621_100120552 3300006237 Bacteria 2224
134 Ga0097621_100999406 3300006237 Unclassified 782
135 Ga0068871_100321915 3300006358 Unclassified 1362
136 Ga0068871_101272544 3300006358 Unclassified 691
137 Ga0068865_100045516 3300006881 Bacteria 3008
138 Ga0097620_100014606 3300006931 Bacteria 7888
139 Ga0105240_10000065 3300009093 Bacteria 213992
140 Ga0105240_10000125 3300009093 Bacteria 159027
141 Ga0105240_10001204 3300009093 Bacteria 45110
142 Ga0105240_10003478 3300009093 Bacteria 24431
143 Ga0105240_10004793 3300009093 Bacteria 20396
144 Ga0105240_10016356 3300009093 Bacteria 10045
145 Ga0105240_10017274 3300009093 Bacteria 9732
146 Ga0105240_10036646 3300009093 Bacteria 6307
147 Ga0105240_10070154 3300009093 Bacteria 4336
148 Ga0105240_10433385 3300009093 Bacteria 1474
149 Ga0105240_10739422 3300009093 Unclassified 1070
150 Ga0105240_10913965 3300009093 Bacteria 943
151 Ga0105240_11385705 3300009093 Bacteria 739
152 Ga0105240_11670761 3300009093 Unclassified 665
153 Ga0105240_11864785 3300009093 Unclassified 626
154 Ga0105245_10077922 3300009098 Bacteria 3023
155 Ga0105245_10195363 3300009098 Bacteria 1941
156 Ga0105245_10202238 3300009098 Bacteria 1908
157 Ga0105245_11855346 3300009098 Unclassified 656
158 Ga0105247_10002137 3300009101 Bacteria 13652
159 Ga0105247_10038903 3300009101 Bacteria 2904
160 Ga0105247_10497924 3300009101 Bacteria 887
161 Ga0105241_10000278 3300009174 Bacteria 38174
162 Ga0105241_10010290 3300009174 Bacteria 6868
163 Ga0105241_10015376 3300009174 Bacteria 5604
164 Ga0105241_10025272 3300009174 Bacteria 4413
165 Ga0105241_10201672 3300009174 Bacteria 1662
166 Ga0105241_10204293 3300009174 Bacteria 1652
167 Ga0105241_10756011 3300009174 Unclassified 892
168 Ga0105241_10870552 3300009174 Unclassified 835
169 Ga0105248_10000003 3300009177 Bacteria 1019601
170 Ga0105248_10131844 3300009177 Bacteria 2820
171 Ga0105248_10160659 3300009177 Bacteria 2535
172 Ga0105248_10415315 3300009177 Unclassified 1515
173 Ga0105248_10922055 3300009177 Unclassified 986
174 Ga0105248_12295768 3300009177 Unclassified 614
175 Ga0105237_10002432 3300009545 Bacteria 23119
176 Ga0105237_10043225 3300009545 Bacteria 4540
177 Ga0105237_10079473 3300009545 Bacteria 3269
178 Ga0105237_10182639 3300009545 Bacteria 2097
179 Ga0105237_10279978 3300009545 Bacteria 1670
180 Ga0105237_10389270 3300009545 Bacteria 1399
181 Ga0105237_10853094 3300009545 Bacteria 917
182 Ga0105238_10000530 3300009551 Bacteria 39934
183 Ga0105238_10000634 3300009551 Bacteria 37020
184 Ga0105238_10001450 3300009551 Bacteria 23799
185 Ga0105238_10002357 3300009551 Bacteria 18991
186 Ga0105238_10045189 3300009551 Bacteria 4449
187 Ga0105238_10078997 3300009551 Bacteria 3280
188 Ga0105238_10097829 3300009551 Bacteria 2919
189 Ga0105238_10252771 3300009551 Unclassified 1741
190 Ga0105238_10663823 3300009551 Bacteria 1053
191 Ga0105238_10882781 3300009551 Unclassified 912
192 Ga0105249_11079292 3300009553 Bacteria 873
193 Ga0105239_10001165 3300010375 Bacteria 36151
194 Ga0105239_10013119 3300010375 Bacteria 9208
195 Ga0105239_10082227 3300010375 Unclassified 3546
196 Ga0105239_10262625 3300010375 Bacteria 1941
197 Ga0105239_10342384 3300010375 Bacteria 1688
198 Ga0105239_10733985 3300010375 Bacteria 1130
199 Ga0105239_10864768 3300010375 Unclassified 1037
200 Ga0105246_10155996 3300011119 Bacteria 1734
201 Ga0105246_10246417 3300011119 Bacteria 1415
202 Ga0157373_10067345 3300013100 Bacteria 2532
203 Ga0157373_10095111 3300013100 Bacteria 2097
204 Ga0157373_10324688 3300013100 Bacteria 1095
205 Ga0157373_10563255 3300013100 Bacteria 827
206 Ga0157373_10843700 3300013100 Unclassified 677
207 Ga0157371_10046616 3300013102 Unclassified 3083
208 Ga0157371_10473776 3300013102 Bacteria 922
209 Ga0157371_10580800 3300013102 Unclassified 832
210 Ga0157371_11467176 3300013102 Unclassified 531
211 Ga0157370_10000009 3300013104 Bacteria 231270
212 Ga0157370_10003275 3300013104 Bacteria 19084
213 Ga0157370_10025772 3300013104 Bacteria 5818
214 Ga0157370_10174491 3300013104 Bacteria 1998
215 Ga0157370_10590872 3300013104 Unclassified 1017
216 Ga0157370_10981133 3300013104 Bacteria 765
217 Ga0157369_10000022 3300013105 Bacteria 233081
218 Ga0157369_10001128 3300013105 Bacteria 33404
219 Ga0157369_10010334 3300013105 Bacteria 10645
220 Ga0157369_10022298 3300013105 Bacteria 7069
221 Ga0157369_10029092 3300013105 Bacteria 6108
222 Ga0157369_10069089 3300013105 Bacteria 3795
223 Ga0157369_10136872 3300013105 Bacteria 2593
224 Ga0157369_11225479 3300013105 Unclassified 766
225 Ga0157369_11787340 3300013105 Unclassified 624
226 Ga0157369_11907509 3300013105 Unclassified 603
227 Ga0157374_10099850 3300013296 Bacteria 2781
228 Ga0157374_10107454 3300013296 Bacteria 2682
229 Ga0157374_10118929 3300013296 Bacteria 2548
230 Ga0157374_10133825 3300013296 Bacteria 2401
231 Ga0157374_10454884 3300013296 Bacteria 1282
232 Ga0157374_10487394 3300013296 Bacteria 1236
233 Ga0157374_10662575 3300013296 Unclassified 1056
234 Ga0157374_11022881 3300013296 Bacteria 846
235 Ga0157374_11975507 3300013296 Unclassified 609
236 Ga0157378_10078260 3300013297 Bacteria 2982
237 Ga0157378_10080444 3300013297 Bacteria 2944
238 Ga0157378_10124075 3300013297 Bacteria 2384
239 Ga0157378_10375182 3300013297 Bacteria 1395
240 Ga0157378_11451616 3300013297 Bacteria 730
241 Ga0163162_10198722 3300013306 Bacteria 2134
242 Ga0163162_10572649 3300013306 Bacteria 1256
243 Ga0163162_10632065 3300013306 Bacteria 1195
244 Ga0157372_10000192 3300013307 Bacteria 67358
245 Ga0157372_10028403 3300013307 Bacteria 6104
246 Ga0157372_10032565 3300013307 Bacteria 5717
247 Ga0157372_10038231 3300013307 Bacteria 5295
248 Ga0157372_10063835 3300013307 Bacteria 4131
249 Ga0157372_10132482 3300013307 Bacteria 2869
250 Ga0157372_10203571 3300013307 Bacteria 2293
251 Ga0157372_10286610 3300013307 Bacteria 1915
252 Ga0157372_10591757 3300013307 Bacteria 1293
253 Ga0157372_11147801 3300013307 Unclassified 898
254 Ga0157372_11682697 3300013307 Unclassified 730
255 Ga0157375_10003426 3300013308 Bacteria 13752
256 Ga0157375_10281316 3300013308 Bacteria 1827
257 Ga0157375_10647376 3300013308 Bacteria 1213
258 Ga0163163_10003576 3300014325 Bacteria 13195
259 Ga0163163_10260410 3300014325 Bacteria 1785
260 Ga0163163_10348741 3300014325 Bacteria 1536
261 Ga0157379_10021429 3300014968 Bacteria 5721
262 Ga0157379_10233072 3300014968 Bacteria 1669
263 Ga0157379_10287033 3300014968 Bacteria 1498
264 Ga0157379_10925677 3300014968 Bacteria 828
265 Ga0157379_11035077 3300014968 Bacteria 784
266 Ga0157376_10018818 3300014969 Bacteria 5307
267 Ga0157376_10044078 3300014969 Bacteria 3665
268 Ga0157376_10182515 3300014969 Bacteria 1919
269 Ga0157376_10326092 3300014969 Bacteria 1461
270 Ga0157376_10521752 3300014969 Bacteria 1171
271 Ga0157376_10888729 3300014969 Bacteria 908
272 Ga0157376_11187561 3300014969 Unclassified 791
273 Ga0157376_11433620 3300014969 Bacteria 723
274 Ga0163161_10552085 3300017792 Unclassified 944
275 Ga0228598_1105200 3300024227 Bacteria 570
276 Ga0207656_10050498 3300025321 Bacteria 1796
277 Ga0207656_10092686 3300025321 Unclassified 1373
278 Ga0207656_10280809 3300025321 Unclassified 821
279 Ga0207692_10146911 3300025898 Bacteria 1346
280 Ga0207692_10762779 3300025898 Unclassified 631
281 Ga0207642_11072535 3300025899 Unclassified 520
282 Ga0207710_10004710 3300025900 Bacteria 5916
283 Ga0207680_11295410 3300025903 Unclassified 518
284 Ga0207647_10623110 3300025904 Unclassified 593
285 Ga0207645_10067908 3300025907 Bacteria 2279
286 Ga0207705_10009516 3300025909 Bacteria 7071
287 Ga0207705_10049093 3300025909 Bacteria 3037
288 Ga0207705_10073186 3300025909 Bacteria 2486
289 Ga0207705_10094660 3300025909 Unclassified 2191
290 Ga0207705_10970470 3300025909 Unclassified 657
291 Ga0207654_10000563 3300025911 Bacteria 20968
292 Ga0207654_10029552 3300025911 Bacteria 3002
293 Ga0207654_10122794 3300025911 Bacteria 1633
294 Ga0207654_10256108 3300025911 Bacteria 1175
295 Ga0207654_10336472 3300025911 Bacteria 1036
296 Ga0207707_10002291 3300025912 Bacteria 17266
297 Ga0207707_10224743 3300025912 Bacteria 1634
298 Ga0207707_10472569 3300025912 Bacteria 1071
299 Ga0207707_10483341 3300025912 Bacteria 1058
300 Ga0207707_10514366 3300025912 Bacteria 1020
301 Ga0207695_10000052 3300025913 Bacteria 398089
302 Ga0207695_10000174 3300025913 Bacteria 189006
303 Ga0207695_10000332 3300025913 Bacteria 112161
304 Ga0207695_10006381 3300025913 Bacteria 15343
305 Ga0207695_10011385 3300025913 Bacteria 10781
306 Ga0207695_10015138 3300025913 Bacteria 9097
307 Ga0207695_10063173 3300025913 Bacteria 3818
308 Ga0207695_10125069 3300025913 Bacteria 2535
309 Ga0207695_10183148 3300025913 Bacteria 2015
310 Ga0207671_10000783 3300025914 Bacteria 40292
311 Ga0207671_10147386 3300025914 Bacteria 1816
312 Ga0207671_10167525 3300025914 Bacteria 1704
313 Ga0207671_10445048 3300025914 Bacteria 1032
314 Ga0207671_10772760 3300025914 Bacteria 762
315 Ga0207693_10117101 3300025915 Bacteria 2091
316 Ga0207693_10508903 3300025915 Bacteria 940
317 Ga0207693_11422472 3300025915 Bacteria 514
318 Ga0207663_11552164 3300025916 Unclassified 533
319 Ga0207660_10040883 3300025917 Bacteria 3248
320 Ga0207660_10192613 3300025917 Bacteria 1588
321 Ga0207660_10575017 3300025917 Unclassified 917
322 Ga0207657_10029590 3300025919 Bacteria 4983
323 Ga0207657_10136631 3300025919 Bacteria 2005
324 Ga0207657_11316589 3300025919 Bacteria 545
325 Ga0207649_10187327 3300025920 Bacteria 1453
326 Ga0207649_10327509 3300025920 Bacteria 1127
327 Ga0207652_10002129 3300025921 Bacteria 16986
328 Ga0207652_10227306 3300025921 Bacteria 1682
329 Ga0207652_10928663 3300025921 Bacteria 767
330 Ga0207694_10000362 3300025924 Bacteria 42697
331 Ga0207694_10001379 3300025924 Bacteria 20919
332 Ga0207694_10003690 3300025924 Bacteria 12126
333 Ga0207694_10053836 3300025924 Bacteria 3121
334 Ga0207694_10340889 3300025924 Bacteria 1239
335 Ga0207694_10859789 3300025924 Unclassified 767
336 Ga0207694_10902558 3300025924 Unclassified 747
337 Ga0207650_10406171 3300025925 Bacteria 1128
338 Ga0207659_11274533 3300025926 Unclassified 631
339 Ga0207687_10065760 3300025927 Bacteria 2575
340 Ga0207687_10070933 3300025927 Bacteria 2488
341 Ga0207687_11185768 3300025927 Unclassified 656
342 Ga0207687_11922510 3300025927 Unclassified 506
343 Ga0207700_10064931 3300025928 Bacteria 2783
344 Ga0207700_10386500 3300025928 Bacteria 1225
345 Ga0207700_10456250 3300025928 Bacteria 1127
346 Ga0207700_10917791 3300025928 Unclassified 784
347 Ga0207700_11952433 3300025928 Unclassified 513
348 Ga0207664_10335248 3300025929 Bacteria 1336
349 Ga0207664_11858395 3300025929 Unclassified 525
350 Ga0207644_10061135 3300025931 Bacteria 2727
351 Ga0207644_10065169 3300025931 Bacteria 2649
352 Ga0207644_10256407 3300025931 Bacteria 1397
353 Ga0207706_10092013 3300025933 Bacteria 2666
354 Ga0207704_10463243 3300025938 Bacteria 1014
355 Ga0207691_10035657 3300025940 Bacteria 4615
356 Ga0207711_10000013 3300025941 Bacteria 514850
357 Ga0207711_10353274 3300025941 Bacteria 1361
358 Ga0207711_10389332 3300025941 Unclassified 1294
359 Ga0207711_11031536 3300025941 Bacteria 762
360 Ga0207711_11244955 3300025941 Unclassified 686
361 Ga0207689_10848038 3300025942 Unclassified 771
362 Ga0207661_10003614 3300025944 Bacteria 10761
363 Ga0207661_10552003 3300025944 Unclassified 1055
364 Ga0207661_11012948 3300025944 Unclassified 765
365 Ga0207661_11678486 3300025944 Unclassified 580
366 Ga0207679_10266291 3300025945 Unclassified 1464
367 Ga0207679_10412987 3300025945 Bacteria 1190
368 Ga0207667_10000727 3300025949 Bacteria 42774
369 Ga0207667_10000878 3300025949 Bacteria 38401
370 Ga0207667_10001467 3300025949 Bacteria 29591
371 Ga0207667_10002600 3300025949 Bacteria 22399
372 Ga0207667_10023315 3300025949 Bacteria 6816
373 Ga0207667_10312233 3300025949 Bacteria 1606
374 Ga0207667_10319010 3300025949 Unclassified 1587
375 Ga0207651_10401698 3300025960 Bacteria 1166
376 Ga0207712_10537742 3300025961 Bacteria 1003
377 Ga0207668_10170316 3300025972 Bacteria 1707
378 Ga0207640_10029026 3300025981 Bacteria 3390
379 Ga0207640_10059029 3300025981 Unclassified 2530
380 Ga0207640_10401318 3300025981 Bacteria 1117
381 Ga0207658_10051840 3300025986 Bacteria 3025
382 Ga0207658_10092834 3300025986 Bacteria 2346
383 Ga0207677_10024216 3300026023 Bacteria 3767
384 Ga0207677_10287597 3300026023 Bacteria 1352
385 Ga0207703_10397474 3300026035 Bacteria 1278
386 Ga0207639_10000270 3300026041 Bacteria 37095
387 Ga0207639_10280346 3300026041 Bacteria 1465
388 Ga0207639_10565737 3300026041 Bacteria 1045
389 Ga0207639_10593544 3300026041 Bacteria 1021
390 Ga0207639_10646840 3300026041 Bacteria 978
391 Ga0207678_10004061 3300026067 Bacteria 13168
392 Ga0207678_10040748 3300026067 Bacteria 4027
393 Ga0207678_11707143 3300026067 Unclassified 553
394 Ga0207702_10002795 3300026078 Bacteria 16351
395 Ga0207702_10045435 3300026078 Bacteria 3694
396 Ga0207702_10117113 3300026078 Bacteria 2379
397 Ga0207702_10145907 3300026078 Unclassified 2147
398 Ga0207702_10230219 3300026078 Bacteria 1732
399 Ga0207702_10399891 3300026078 Bacteria 1325
400 Ga0207702_10745326 3300026078 Unclassified 967
401 Ga0207702_10782344 3300026078 Bacteria 943
402 Ga0207702_10814635 3300026078 Bacteria 923
403 Ga0207702_10943363 3300026078 Bacteria 855
404 Ga0207702_11110731 3300026078 Unclassified 785
405 Ga0207641_10935654 3300026088 Unclassified 862
406 Ga0207648_11675670 3300026089 Bacteria 597
407 Ga0207676_10002247 3300026095 Bacteria 13873
408 Ga0207674_10002362 3300026116 Bacteria 23858
409 Ga0207674_10018801 3300026116 Bacteria 7497
410 Ga0207674_10361614 3300026116 Bacteria 1403
411 Ga0207674_11179225 3300026116 Unclassified 735
412 Ga0207675_100485385 3300026118 Bacteria 1228
413 Ga0207683_10003608 3300026121 Bacteria 13486
414 Ga0207698_10000007 3300026142 Bacteria 289457
415 Ga0207698_10000055 3300026142 Bacteria 82550
416 Ga0207698_10018546 3300026142 Bacteria 4744
417 Ga0207698_10035922 3300026142 Bacteria 3630
418 Ga0207698_10123090 3300026142 Bacteria 2199
419 Ga0207698_10464381 3300026142 Bacteria 1225
420 Ga0268266_10015502 3300028379 Bacteria 6539
421 Ga0268266_10222418 3300028379 Bacteria 1736
422 Ga0268266_10660874 3300028379 Unclassified 1006
423 Ga0268266_11286779 3300028379 Unclassified 706
424 Ga0268264_10434430 3300028381 Bacteria 1268
425 Ga0265334_10057628 3300028573 Bacteria 1472
426 Ga0265318_10032004 3300028577 Bacteria 2037
427 Ga0265336_10011299 3300028666 Bacteria 3040
428 Ga0265338_10006350 3300028800 Bacteria 15101
429 Ga0265338_10011909 3300028800 Bacteria 9987
430 Ga0265338_10029760 3300028800 Bacteria 5404
431 Ga0265338_10386630 3300028800 Bacteria 1000
432 Ga0265338_10866915 3300028800 Bacteria 616
433 Ga0265324_10174141 3300029957 Bacteria 731
434 Ga0265770_1010964 3300030878 Bacteria 1323
435 Ga0265760_10136168 3300031090 Bacteria 797
436 Ga0265330_10000328 3300031235 Bacteria 34183
437 Ga0265330_10002917 3300031235 Bacteria 9121
438 Ga0265330_10066275 3300031235 Bacteria 1566
439 Ga0265330_10103082 3300031235 Bacteria 1220
440 Ga0265330_10113404 3300031235 Bacteria 1157
441 Ga0265330_10207616 3300031235 Unclassified 828
442 Ga0265330_10214063 3300031235 Bacteria 813
443 Ga0265332_10084380 3300031238 Bacteria 1346
444 Ga0265332_10498264 3300031238 Unclassified 505
445 Ga0265328_10001550 3300031239 Bacteria 10600
446 Ga0265328_10015905 3300031239 Bacteria 2938
447 Ga0265328_10097676 3300031239 Bacteria 1086
448 Ga0265328_10123329 3300031239 Bacteria 967
449 Ga0265320_10016865 3300031240 Bacteria 4076
450 Ga0265325_10002782 3300031241 Bacteria 11678
451 Ga0265325_10008384 3300031241 Bacteria 6101
452 Ga0265325_10022048 3300031241 Bacteria 3492
453 Ga0265325_10025406 3300031241 Unclassified 3217
454 Ga0265325_10038634 3300031241 Bacteria 2518
455 Ga0265325_10224490 3300031241 Bacteria 858
456 Ga0265329_10139251 3300031242 Unclassified 783
457 Ga0265340_10008939 3300031247 Bacteria 5398
458 Ga0265340_10040415 3300031247 Bacteria 2298
459 Ga0265340_10380954 3300031247 Unclassified 622
460 Ga0265339_10000100 3300031249 Bacteria 72186
461 Ga0265339_10000306 3300031249 Bacteria 40045
462 Ga0265339_10003597 3300031249 Bacteria 10821
463 Ga0265339_10005345 3300031249 Bacteria 8552
464 Ga0265339_10022223 3300031249 Bacteria 3677
465 Ga0265339_10070439 3300031249 Bacteria 1865
466 Ga0265339_10071193 3300031249 Unclassified 1853
467 Ga0265339_10186919 3300031249 Bacteria 1029
468 Ga0265331_10049223 3300031250 Bacteria 2025
469 Ga0265331_10305496 3300031250 Unclassified 713
470 Ga0265331_10488626 3300031250 Unclassified 554
471 Ga0265316_10001531 3300031344 Bacteria 24746
472 Ga0265316_10001888 3300031344 Bacteria 21998
473 Ga0265316_10003043 3300031344 Bacteria 17118
474 Ga0265316_10015735 3300031344 Bacteria 6601
475 Ga0265316_10045833 3300031344 Bacteria 3469
476 Ga0265316_10077477 3300031344 Bacteria 2553
477 Ga0265316_10151741 3300031344 Unclassified 1735
478 Ga0265316_10290639 3300031344 Unclassified 1192
479 Ga0265316_10346171 3300031344 Unclassified 1077
480 Ga0265316_10438970 3300031344 Bacteria 937
481 Ga0265316_10632466 3300031344 Bacteria 757
482 Ga0265316_10709696 3300031344 Bacteria 708
483 Ga0265316_11237460 3300031344 Unclassified 516
484 Ga0265313_10002703 3300031595 Bacteria 15019
485 Ga0265313_10034557 3300031595 Bacteria 2555
486 Ga0265313_10077140 3300031595 Bacteria 1521
487 Ga0265313_10109816 3300031595 Bacteria 1214
488 Ga0265313_10263379 3300031595 Unclassified 700
489 Ga0265313_10353069 3300031595 Unclassified 582
490 Ga0265313_10363996 3300031595 Unclassified 571
491 Ga0265314_10000139 3300031711 Bacteria 108861
492 Ga0265314_10023654 3300031711 Bacteria 4677
493 Ga0265314_10104484 3300031711 Bacteria 1814
494 Ga0265314_10116929 3300031711 Bacteria 1685
495 Ga0265314_10237030 3300031711 Bacteria 1055
496 Ga0265314_10567491 3300031711 Bacteria 588
497 Ga0265342_10001091 3300031712 Bacteria 26110
498 Ga0265342_10001191 3300031712 Bacteria 24705
499 Ga0265342_10004346 3300031712 Bacteria 11215
500 Ga0265342_10008139 3300031712 Bacteria 7568
501 Ga0265342_10016025 3300031712 Bacteria 4910
502 Ga0265342_10018775 3300031712 Bacteria 4469
503 Ga0265342_10024597 3300031712 Bacteria 3799
504 Ga0265342_10075760 3300031712 Bacteria 1951
505 Ga0265342_10464737 3300031712 Bacteria 648
506 Ga0265342_10685643 3300031712 Unclassified 513
507 Ga0316215_1015692 3300033544 Unclassified 761
508 Ga0316212_1049791 3300033547 Unclassified 596
509 Ga0373953_0121243 3300035117 Bacteria 1111
510 Ga0373954_0338353 3300035118 Bacteria 743
511 Ga0373957_0028952 3300035120 Bacteria 2021
512 Ga0373937_0005392 3300036401 Bacteria 10940
513 Ga0373937_0023235 3300036401 Bacteria 5582
514 Ga0373925_0470929 3300037068 Bacteria 1030
515 Ga0395899_0402223 3300037312 Unclassified 906
516 Ga0395898_0707806 3300037466 Unclassified 949
517 Ga0395901_0655503 3300038443 Bacteria 1052
518 Ga0436360_1105172 3300039438 Bacteria 630
519 Ga0466969_0247583 3300044656 Bacteria 808
520 Ga0466966_0535623 3300044684 Unclassified 705
521 Ga0466961_0103924 3300044693 Bacteria 1789
522 Ga0466961_0174083 3300044693 Bacteria 1338
523 Ga0466963_0393628 3300044694 Bacteria 977
524 Ga0466963_0557826 3300044694 Unclassified 809
525 Ga0466957_0437983 3300044842 Bacteria 899
526 Ga0466957_0731670 3300044842 Bacteria 700
527 Ga0466959_0160895 3300045049 Bacteria 1579
528 Ga0466958_0176711 3300045836 Bacteria 1354
529 Ga0466967_0069923 3300045976 Bacteria 3139
530 Ga0466967_1108298 3300045976 Unclassified 789
531 Ga0495629_0039608 3300046459 Bacteria 3316
532 Ga0495629_0048959 3300046459 Bacteria 2963
533 Ga0495629_0130906 3300046459 Bacteria 1747
534 Ga0495651_0353531 3300046462 Bacteria 970
535 Ga0495580_0058632 3300046472 Bacteria 2707
536 Ga0495580_0172301 3300046472 Bacteria 1496
537 Ga0495642_0368531 3300046528 Unclassified 632
538 Ga0495652_0750981 3300046529 Unclassified 653
539 Ga0495652_0924546 3300046529 Unclassified 574
540 Ga0495665_0066133 3300046531 Bacteria 1908
541 Ga0495665_0613691 3300046531 Bacteria 543
542 Ga0495640_0353959 3300046533 Bacteria 906
543 Ga0495586_0314280 3300046535 Bacteria 898
544 Ga0495587_0337415 3300046536 Bacteria 841
545 Ga0495587_0768073 3300046536 Unclassified 527
546 Ga0495645_0018793 3300046543 Bacteria 4971
547 Ga0495645_0222080 3300046543 Unclassified 1270
548 Ga0495667_0413312 3300046559 Bacteria 849
549 Ga0495634_0149511 3300046642 Bacteria 1478
550 Ga0495625_0521119 3300046660 Unclassified 724
551 Ga0495635_0338972 3300046663 Bacteria 1004
552 Ga0495599_0177493 3300046678 Bacteria 1313
553 Ga0495646_0401299 3300046680 Bacteria 713
554 Ga0495613_0041941 3300046689 Bacteria 3387
555 Ga0495613_0128563 3300046689 Unclassified 1815
556 Ga0495670_0618840 3300046691 Bacteria 590
557 Ga0495649_0549390 3300046694 Unclassified 572
558 Ga0495581_0897139 3300047315 Unclassified 506
559 Ga0495604_0154102 3300047317 Bacteria 1629
560 Ga0495675_0190043 3300047444 Bacteria 1254
561 Ga0495684_0080670 3300047471 Bacteria 2470
562 Ga0495684_0930409 3300047471 Unclassified 558
563 Ga0495602_0051546 3300048088 Bacteria 3664
564 Ga0495602_0170451 3300048088 Bacteria 1690
565 Ga0495602_0337083 3300048088 Bacteria 1092
566 Ga0496100_0041567 3300048903 Bacteria 2931
567 Ga0496100_0626232 3300048903 Unclassified 837
568 Ga0496101_0086034 3300048904 Bacteria 2331
569 Ga0496101_0854915 3300048904 Unclassified 717
570 Ga0496102_0135479 3300048905 Bacteria 2307
571 Ga0496103_0754299 3300048906 Unclassified 615
572 Ga0496104_0070264 3300048907 Bacteria 3328
573 Ga0496104_0128594 3300048907 Bacteria 2433
574 Ga0496104_0168210 3300048907 Bacteria 2102
575 Ga0496104_0556372 3300048907 Unclassified 1058
576 Ga0496104_0742728 3300048907 Unclassified 888
577 Ga0496105_0035145 3300048908 Bacteria 4124
578 Ga0496105_0433846 3300048908 Unclassified 1039
579 Ga0496105_1071539 3300048908 Unclassified 600
580 Ga0496106_0501757 3300048909 Unclassified 975
581 Ga0496107_0072964 3300048910 Bacteria 2496
582 Ga0496107_0208355 3300048910 Bacteria 1453
583 Ga0496108_0073896 3300048911 Bacteria 2878
584 Ga0496109_0337457 3300048912 Bacteria 1423
585 Ga0496110_1014375 3300048913 Bacteria 737
586 Ga0496112_0125694 3300048915 Bacteria 2535
587 Ga0496112_0384865 3300048915 Bacteria 1343
588 Ga0496113_0334549 3300048916 Unclassified 1214
589 Ga0496113_0891357 3300048916 Unclassified 704
590 Ga0496114_0026308 3300048917 Bacteria 4762
591 Ga0496115_0006877 3300048918 Bacteria 8352
592 Ga0496115_0235385 3300048918 Bacteria 1510
593 Ga0496115_0512320 3300048918 Bacteria 963
594 Ga0496126_0008629 3300048929 Bacteria 10959
595 Ga0495601_0394500 3300053077 Bacteria 898
596 Ga0495619_0044901 3300053085 Bacteria 2902
597 Ga0500644_0288226 3300053088 Unclassified 700
598 Ga0500595_023407 3300053119 Bacteria 2171
599 Ga0207700_11041496
600 LJNas_1000445
601 JGI24735J21928_10221963
602 rootH2_10014960
603 rootH2_10038031
604 rootH2_10189653
605 Ga0070658_10011404
606 Ga0070658_10068225
607 Ga0070658_10257861
608 Ga0070658_10699536
609 Ga0070658_11079873
610 Ga0070676_10097301
611 Ga0070683_100009113
612 Ga0070683_100057420
613 Ga0070683_100507523
614 Ga0070683_101055930
615 Ga0070683_102411348
616 Ga0070690_101743078
617 Ga0070670_100791731
618 Ga0070666_10211039
619 Ga0070680_100106861
620 Ga0070680_100196011
621 Ga0070680_100326827
622 Ga0070682_100875093
623 Ga0068868_100009670
624 Ga0068868_100013118
625 Ga0068868_100545992
626 Ga0070660_100004954
627 Ga0070660_100118005
628 Ga0070660_100934264
629 Ga0070691_10782907
630 Ga0070661_100040639
631 Ga0070661_100056704
632 Ga0070661_100245228
633 Ga0070661_100763663
634 Ga0070668_100698386
635 Ga0070675_100998161
636 Ga0070671_100059828
637 Ga0070671_100953273
638 Ga0070671_101214909
639 Ga0070673_101207679
640 Ga0070667_100058072
641 Ga0070667_100136194
642 Ga0070709_10568833
643 Ga0070709_10836405
644 Ga0070714_100123067
645 Ga0070714_102291542
646 Ga0070713_100083216
647 Ga0070713_100138767
648 Ga0070713_100379213
649 Ga0070713_100386324
650 Ga0070713_101190704
651 Ga0070713_101605842
652 Ga0070713_102014798
653 Ga0070713_102328620
654 Ga0070710_10386830
655 Ga0070663_100012599
656 Ga0070663_101108156
657 Ga0070663_101803477
658 Ga0070678_100018680
659 Ga0070681_10001472
660 Ga0070681_10311786
661 Ga0070681_10312540
662 Ga0070681_10677141
663 Ga0068867_101027353
664 Ga0070679_100000871
665 Ga0070679_100185803
666 Ga0070679_101311760
667 Ga0070684_100005878
668 Ga0070684_100006135
669 Ga0070684_100349925
670 Ga0070684_100394718
671 Ga0070684_100528971
672 Ga0070684_101187205
673 Ga0068853_100000264
674 Ga0068853_100286693
675 Ga0068853_100814003
676 Ga0068853_100916891
677 Ga0068853_101391694
678 Ga0070672_100023654
679 Ga0070693_100574649
680 Ga0070665_100026489
681 Ga0070665_100042113
682 Ga0070665_100156339
683 Ga0070665_100611990
684 Ga0068855_100000216
685 Ga0068855_100002826
686 Ga0068855_100004763
687 Ga0068855_100017509
688 Ga0068855_100026837
689 Ga0068855_100191077
690 Ga0068855_100365513
691 Ga0070664_100059993
692 Ga0070664_100332484
693 Ga0070664_100472440
694 Ga0070664_100647025
695 Ga0070664_100727388
696 Ga0068857_100010004
697 Ga0068857_100040005
698 Ga0068854_100014526
699 Ga0068854_100047474
700 Ga0068856_100002530
701 Ga0068856_100007900
702 Ga0068856_100089891
703 Ga0068856_100104272
704 Ga0068856_100288021
705 Ga0068856_100358326
706 Ga0068856_100435896
707 Ga0068856_100894381
708 Ga0068856_101483392
709 Ga0068856_102647479
710 Ga0068852_100000042
711 Ga0068852_100000046
712 Ga0068852_100077133
713 Ga0068852_100093066
714 Ga0068852_100428582
715 Ga0068852_102248032
716 Ga0068859_100014606
717 Ga0068864_100000314
718 Ga0068866_10779922
719 Ga0068861_100348137
720 Ga0068851_10040788
721 Ga0068851_10048812
722 Ga0068851_10228333
723 Ga0068863_100053677
724 Ga0068860_100364228
725 Ga0070717_10166908
726 Ga0070717_11121696
727 Ga0070717_11321614
728 Ga0070712_100290525
729 Ga0070712_100633963
730 Ga0097621_100015955
731 Ga0097621_100120552
732 Ga0097621_100999406
733 Ga0068871_100321915
734 Ga0068871_101272544
735 Ga0068865_100045516
736 Ga0097620_100014606
737 Ga0105240_10000065
738 Ga0105240_10000125
739 Ga0105240_10001204
740 Ga0105240_10003478
741 Ga0105240_10004793
742 Ga0105240_10016356
743 Ga0105240_10017274
744 Ga0105240_10036646
745 Ga0105240_10070154
746 Ga0105240_10433385
747 Ga0105240_10739422
748 Ga0105240_10913965
749 Ga0105240_11385705
750 Ga0105240_11670761
751 Ga0105240_11864785
752 Ga0105245_10077922
753 Ga0105245_10195363
754 Ga0105245_10202238
755 Ga0105245_11855346
756 Ga0105247_10002137
757 Ga0105247_10038903
758 Ga0105247_10497924
759 Ga0105241_10000278
760 Ga0105241_10010290
761 Ga0105241_10015376
762 Ga0105241_10025272
763 Ga0105241_10201672
764 Ga0105241_10204293
765 Ga0105241_10756011
766 Ga0105241_10870552
767 Ga0105248_10000003
768 Ga0105248_10131844
769 Ga0105248_10160659
770 Ga0105248_10415315
771 Ga0105248_10922055
772 Ga0105248_12295768
773 Ga0105237_10002432
774 Ga0105237_10043225
775 Ga0105237_10079473
776 Ga0105237_10182639
777 Ga0105237_10279978
778 Ga0105237_10389270
779 Ga0105237_10853094
780 Ga0105238_10000530
781 Ga0105238_10000634
782 Ga0105238_10001450
783 Ga0105238_10002357
784 Ga0105238_10045189
785 Ga0105238_10078997
786 Ga0105238_10097829
787 Ga0105238_10252771
788 Ga0105238_10663823
789 Ga0105238_10882781
790 Ga0105249_11079292
791 Ga0105239_10001165
792 Ga0105239_10013119
793 Ga0105239_10082227
794 Ga0105239_10262625
795 Ga0105239_10342384
796 Ga0105239_10733985
797 Ga0105239_10864768
798 Ga0105246_10155996
799 Ga0105246_10246417
800 Ga0157373_10067345
801 Ga0157373_10095111
802 Ga0157373_10324688
803 Ga0157373_10563255
804 Ga0157373_10843700
805 Ga0157371_10046616
806 Ga0157371_10473776
807 Ga0157371_10580800
808 Ga0157371_11467176
809 Ga0157370_10000009
810 Ga0157370_10003275
811 Ga0157370_10025772
812 Ga0157370_10174491
813 Ga0157370_10590872
814 Ga0157370_10981133
815 Ga0157369_10000022
816 Ga0157369_10001128
817 Ga0157369_10010334
818 Ga0157369_10022298
819 Ga0157369_10029092
820 Ga0157369_10069089
821 Ga0157369_10136872
822 Ga0157369_11225479
823 Ga0157369_11787340
824 Ga0157369_11907509
825 Ga0157374_10099850
826 Ga0157374_10107454
827 Ga0157374_10118929
828 Ga0157374_10133825
829 Ga0157374_10454884
830 Ga0157374_10487394
831 Ga0157374_10662575
832 Ga0157374_11022881
833 Ga0157374_11975507
834 Ga0157378_10078260
835 Ga0157378_10080444
836 Ga0157378_10124075
837 Ga0157378_10375182
838 Ga0157378_11451616
839 Ga0163162_10198722
840 Ga0163162_10572649
841 Ga0163162_10632065
842 Ga0157372_10000192
843 Ga0157372_10028403
844 Ga0157372_10032565
845 Ga0157372_10038231
846 Ga0157372_10063835
847 Ga0157372_10132482
848 Ga0157372_10203571
849 Ga0157372_10286610
850 Ga0157372_10591757
851 Ga0157372_11147801
852 Ga0157372_11682697
853 Ga0157375_10003426
854 Ga0157375_10281316
855 Ga0157375_10647376
856 Ga0163163_10003576
857 Ga0163163_10260410
858 Ga0163163_10348741
859 Ga0157379_10021429
860 Ga0157379_10233072
861 Ga0157379_10287033
862 Ga0157379_10925677
863 Ga0157379_11035077
864 Ga0157376_10018818
865 Ga0157376_10044078
866 Ga0157376_10182515
867 Ga0157376_10326092
868 Ga0157376_10521752
869 Ga0157376_10888729
870 Ga0157376_11187561
871 Ga0157376_11433620
872 Ga0163161_10552085
873 Ga0228598_1105200
874 Ga0207656_10050498
875 Ga0207656_10092686
876 Ga0207656_10280809
877 Ga0207692_10146911
878 Ga0207692_10762779
879 Ga0207642_11072535
880 Ga0207710_10004710
881 Ga0207680_11295410
882 Ga0207647_10623110
883 Ga0207645_10067908
884 Ga0207705_10009516
885 Ga0207705_10049093
886 Ga0207705_10073186
887 Ga0207705_10094660
888 Ga0207705_10970470
889 Ga0207654_10000563
890 Ga0207654_10029552
891 Ga0207654_10122794
892 Ga0207654_10256108
893 Ga0207654_10336472
894 Ga0207707_10002291
895 Ga0207707_10224743
896 Ga0207707_10472569
897 Ga0207707_10483341
898 Ga0207707_10514366
899 Ga0207695_10000052
900 Ga0207695_10000174
901 Ga0207695_10000332
902 Ga0207695_10006381
903 Ga0207695_10011385
904 Ga0207695_10015138
905 Ga0207695_10063173
906 Ga0207695_10125069
907 Ga0207695_10183148
908 Ga0207671_10000783
909 Ga0207671_10147386
910 Ga0207671_10167525
911 Ga0207671_10445048
912 Ga0207671_10772760
913 Ga0207693_10117101
914 Ga0207693_10508903
915 Ga0207693_11422472
916 Ga0207663_11552164
917 Ga0207660_10040883
918 Ga0207660_10192613
919 Ga0207660_10575017
920 Ga0207657_10029590
921 Ga0207657_10136631
922 Ga0207657_11316589
923 Ga0207649_10187327
924 Ga0207649_10327509
925 Ga0207652_10002129
926 Ga0207652_10227306
927 Ga0207652_10928663
928 Ga0207694_10000362
929 Ga0207694_10001379
930 Ga0207694_10003690
931 Ga0207694_10053836
932 Ga0207694_10340889
933 Ga0207694_10859789
934 Ga0207694_10902558
935 Ga0207650_10406171
936 Ga0207659_11274533
937 Ga0207687_10065760
938 Ga0207687_10070933
939 Ga0207687_11185768
940 Ga0207687_11922510
941 Ga0207700_10064931
942 Ga0207700_10386500
943 Ga0207700_10456250
944 Ga0207700_10917791
945 Ga0207700_11952433
946 Ga0207664_10335248
947 Ga0207664_11858395
948 Ga0207644_10061135
949 Ga0207644_10065169
950 Ga0207644_10256407
951 Ga0207706_10092013
952 Ga0207704_10463243
953 Ga0207691_10035657
954 Ga0207711_10000013
955 Ga0207711_10353274
956 Ga0207711_10389332
957 Ga0207711_11031536
958 Ga0207711_11244955
959 Ga0207689_10848038
960 Ga0207661_10003614
961 Ga0207661_10552003
962 Ga0207661_11012948
963 Ga0207661_11678486
964 Ga0207679_10266291
965 Ga0207679_10412987
966 Ga0207667_10000727
967 Ga0207667_10000878
968 Ga0207667_10001467
969 Ga0207667_10002600
970 Ga0207667_10023315
971 Ga0207667_10312233
972 Ga0207667_10319010
973 Ga0207651_10401698
974 Ga0207712_10537742
975 Ga0207668_10170316
976 Ga0207640_10029026
977 Ga0207640_10059029
978 Ga0207640_10401318
979 Ga0207658_10051840
980 Ga0207658_10092834
981 Ga0207677_10024216
982 Ga0207677_10287597
983 Ga0207703_10397474
984 Ga0207639_10000270
985 Ga0207639_10280346
986 Ga0207639_10565737
987 Ga0207639_10593544
988 Ga0207639_10646840
989 Ga0207678_10004061
990 Ga0207678_10040748
991 Ga0207678_11707143
992 Ga0207702_10002795
993 Ga0207702_10045435
994 Ga0207702_10117113
995 Ga0207702_10145907
996 Ga0207702_10230219
997 Ga0207702_10399891
998 Ga0207702_10745326
999 Ga0207702_10782344
1000 Ga0207702_10814635
1001 Ga0207702_10943363
1002 Ga0207702_11110731
1003 Ga0207641_10935654
1004 Ga0207648_11675670
1005 Ga0207676_10002247
1006 Ga0207674_10002362
1007 Ga0207674_10018801
1008 Ga0207674_10361614
1009 Ga0207674_11179225
1010 Ga0207675_100485385
1011 Ga0207683_10003608
1012 Ga0207698_10000007
1013 Ga0207698_10000055
1014 Ga0207698_10018546
1015 Ga0207698_10035922
1016 Ga0207698_10123090
1017 Ga0207698_10464381
1018 Ga0268266_10015502
1019 Ga0268266_10222418
1020 Ga0268266_10660874
1021 Ga0268266_11286779
1022 Ga0268264_10434430
1023 Ga0265334_10057628
1024 Ga0265318_10032004
1025 Ga0265336_10011299
1026 Ga0265338_10006350
1027 Ga0265338_10011909
1028 Ga0265338_10029760
1029 Ga0265338_10386630
1030 Ga0265338_10866915
1031 Ga0265324_10174141
1032 Ga0265770_1010964
1033 Ga0265760_10136168
1034 Ga0265330_10000328
1035 Ga0265330_10002917
1036 Ga0265330_10066275
1037 Ga0265330_10103082
1038 Ga0265330_10113404
1039 Ga0265330_10207616
1040 Ga0265330_10214063
1041 Ga0265332_10084380
1042 Ga0265332_10498264
1043 Ga0265328_10001550
1044 Ga0265328_10015905
1045 Ga0265328_10097676
1046 Ga0265328_10123329
1047 Ga0265320_10016865
1048 Ga0265325_10002782
1049 Ga0265325_10008384
1050 Ga0265325_10022048
1051 Ga0265325_10025406
1052 Ga0265325_10038634
1053 Ga0265325_10224490
1054 Ga0265329_10139251
1055 Ga0265340_10008939
1056 Ga0265340_10040415
1057 Ga0265340_10380954
1058 Ga0265339_10000100
1059 Ga0265339_10000306
1060 Ga0265339_10003597
1061 Ga0265339_10005345
1062 Ga0265339_10022223
1063 Ga0265339_10070439
1064 Ga0265339_10071193
1065 Ga0265339_10186919
1066 Ga0265331_10049223
1067 Ga0265331_10305496
1068 Ga0265331_10488626
1069 Ga0265316_10001531
1070 Ga0265316_10001888
1071 Ga0265316_10003043
1072 Ga0265316_10015735
1073 Ga0265316_10045833
1074 Ga0265316_10077477
1075 Ga0265316_10151741
1076 Ga0265316_10290639
1077 Ga0265316_10346171
1078 Ga0265316_10438970
1079 Ga0265316_10632466
1080 Ga0265316_10709696
1081 Ga0265316_11237460
1082 Ga0265313_10002703
1083 Ga0265313_10034557
1084 Ga0265313_10077140
1085 Ga0265313_10109816
1086 Ga0265313_10263379
1087 Ga0265313_10353069
1088 Ga0265313_10363996
1089 Ga0265314_10000139
1090 Ga0265314_10023654
1091 Ga0265314_10104484
1092 Ga0265314_10116929
1093 Ga0265314_10237030
1094 Ga0265314_10567491
1095 Ga0265342_10001091
1096 Ga0265342_10001191
1097 Ga0265342_10004346
1098 Ga0265342_10008139
1099 Ga0265342_10016025
1100 Ga0265342_10018775
1101 Ga0265342_10024597
1102 Ga0265342_10075760
1103 Ga0265342_10464737
1104 Ga0265342_10685643
1105 Ga0316215_1015692
1106 Ga0316212_1049791
1107 Ga0373953_0121243
1108 Ga0373954_0338353
1109 Ga0373957_0028952
1110 Ga0373937_0005392
1111 Ga0373937_0023235
1112 Ga0373925_0470929
1113 Ga0395899_0402223
1114 Ga0395898_0707806
1115 Ga0395901_0655503
1116 Ga0436360_1105172
1117 Ga0466969_0247583
1118 Ga0466966_0535623
1119 Ga0466961_0103924
1120 Ga0466961_0174083
1121 Ga0466963_0393628
1122 Ga0466963_0557826
1123 Ga0466957_0437983
1124 Ga0466957_0731670
1125 Ga0466959_0160895
1126 Ga0466958_0176711
1127 Ga0466967_0069923
1128 Ga0466967_1108298
1129 Ga0495629_0039608
1130 Ga0495629_0048959
1131 Ga0495629_0130906
1132 Ga0495651_0353531
1133 Ga0495580_0058632
1134 Ga0495580_0172301
1135 Ga0495642_0368531
1136 Ga0495652_0750981
1137 Ga0495652_0924546
1138 Ga0495665_0066133
1139 Ga0495665_0613691
1140 Ga0495640_0353959
1141 Ga0495586_0314280
1142 Ga0495587_0337415
1143 Ga0495587_0768073
1144 Ga0495645_0018793
1145 Ga0495645_0222080
1146 Ga0495667_0413312
1147 Ga0495634_0149511
1148 Ga0495625_0521119
1149 Ga0495635_0338972
1150 Ga0495599_0177493
1151 Ga0495646_0401299
1152 Ga0495613_0041941
1153 Ga0495613_0128563
1154 Ga0495670_0618840
1155 Ga0495649_0549390
1156 Ga0495581_0897139
1157 Ga0495604_0154102
1158 Ga0495675_0190043
1159 Ga0495684_0080670
1160 Ga0495684_0930409
1161 Ga0495602_0051546
1162 Ga0495602_0170451
1163 Ga0495602_0337083
1164 Ga0496100_0041567
1165 Ga0496100_0626232
1166 Ga0496101_0086034
1167 Ga0496101_0854915
1168 Ga0496102_0135479
1169 Ga0496103_0754299
1170 Ga0496104_0070264
1171 Ga0496104_0128594
1172 Ga0496104_0168210
1173 Ga0496104_0556372
1174 Ga0496104_0742728
1175 Ga0496105_0035145
1176 Ga0496105_0433846
1177 Ga0496105_1071539
1178 Ga0496106_0501757
1179 Ga0496107_0072964
1180 Ga0496107_0208355
1181 Ga0496108_0073896
1182 Ga0496109_0337457
1183 Ga0496110_1014375
1184 Ga0496112_0125694
1185 Ga0496112_0384865
1186 Ga0496113_0334549
1187 Ga0496113_0891357
1188 Ga0496114_0026308
1189 Ga0496115_0006877
1190 Ga0496115_0235385
1191 Ga0496115_0512320
1192 Ga0496126_0008629
1193 Ga0495601_0394500
1194 Ga0495619_0044901
1195 Ga0500644_0288226
1196 Ga0500595_023407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map