F467773

General Info

Members Datasets Scaffolds Average Seq Length
598 311 1196 256

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10011635|Ga0075433_100116353
Length 262
Sequence MTREYVQENQPPGVLPLPLTGERTLPDVPEENYWFRRHLAVYEWIGARVAGRQVVDMACGEGYGSDLLAGRAASVVGVDANPEAHEHARLRYVRPNLRFQRDLVESFAEPCDAVVFLQTIEHVRDPGAILDHFKSMLAGGSRGRGSGRGGVAYVSTPNLLTLAPAGAEKSDNPWHVKEYRAAEFRGLCEAHFDRVELLGLFHARKLRVHELAIKLGWDRVHKALRLTKPFYDRFTPAISASDFVLRGSDLDRALDFLAVCHA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
309 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 12.71
Rhizosphere 85.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10011635 3300006852 Bacteria 7087
2 JGI24746J21847_1000030 3300001977 Bacteria 13368
3 JGI24748J21848_1000299 3300002074 Bacteria 5810
4 JGI24034J26672_10000180 3300002239 Bacteria 8646
5 JGI24742J22300_10005526 3300002244 Bacteria 2079
6 Ga0070683_100013994 3300005329 Bacteria 7006
7 Ga0070683_100067019 3300005329 Bacteria 3343
8 Ga0070683_100124685 3300005329 Bacteria 2434
9 Ga0070683_100271904 3300005329 Bacteria 1612
10 Ga0070683_100608404 3300005329 Bacteria 1046
11 Ga0070670_100133785 3300005331 Bacteria 2142
12 Ga0070677_10000098 3300005333 Bacteria 28689
13 Ga0068869_100469357 3300005334 Bacteria 1046
14 Ga0070680_100004310 3300005336 Bacteria 10693
15 Ga0070680_100166226 3300005336 Bacteria 1855
16 Ga0070682_100000013 3300005337 Bacteria 254641
17 Ga0070682_100000421 3300005337 Bacteria 27464
18 Ga0070660_100023755 3300005339 Bacteria 4543
19 Ga0070660_100094268 3300005339 Bacteria 2365
20 Ga0070660_100170858 3300005339 Bacteria 1756
21 Ga0070691_10001700 3300005341 Bacteria 9535
22 Ga0070691_10002622 3300005341 Bacteria 8021
23 Ga0070692_10074104 3300005345 Bacteria 1820
24 Ga0070692_10115004 3300005345 Bacteria 1493
25 Ga0070668_100019675 3300005347 Bacteria 5083
26 Ga0070669_100004240 3300005353 Bacteria 10367
27 Ga0070675_100000053 3300005354 Bacteria 70601
28 Ga0070674_100000025 3300005356 Bacteria 78679
29 Ga0070673_100001851 3300005364 Bacteria 12652
30 Ga0070688_100000012 3300005365 Bacteria 79406
31 Ga0070688_100000269 3300005365 Bacteria 26936
32 Ga0070659_100000103 3300005366 Bacteria 62874
33 Ga0070659_100018141 3300005366 Bacteria 5308
34 Ga0070667_100001647 3300005367 Bacteria 19972
35 Ga0070667_100418795 3300005367 Bacteria 1221
36 Ga0070703_10077334 3300005406 Bacteria 1125
37 Ga0070714_100000738 3300005435 Bacteria 23174
38 Ga0070714_100021371 3300005435 Bacteria 5296
39 Ga0070714_100619941 3300005435 Bacteria 1040
40 Ga0070713_100000009 3300005436 Bacteria 153056
41 Ga0070713_100157073 3300005436 Bacteria 2028
42 Ga0070710_10000002 3300005437 Bacteria 290371
43 Ga0070711_100112746 3300005439 Bacteria 1999
44 Ga0070711_100153534 3300005439 Bacteria 1739
45 Ga0070705_100001055 3300005440 Bacteria 15390
46 Ga0070662_100000007 3300005457 Bacteria 168761
47 Ga0070662_100001448 3300005457 Bacteria 14632
48 Ga0070662_100563086 3300005457 Bacteria 956
49 Ga0070681_10019064 3300005458 Bacteria 6866
50 Ga0070685_10000018 3300005466 Bacteria 110132
51 Ga0070685_10000142 3300005466 Bacteria 46324
52 Ga0070679_100072889 3300005530 Bacteria 3426
53 Ga0070684_100065416 3300005535 Bacteria 3191
54 Ga0070684_100089568 3300005535 Bacteria 2734
55 Ga0070684_100128266 3300005535 Bacteria 2287
56 Ga0068853_100013727 3300005539 Bacteria 6618
57 Ga0070672_100000030 3300005543 Bacteria 62612
58 Ga0070686_100046315 3300005544 Bacteria 2744
59 Ga0070696_100444561 3300005546 Bacteria 1022
60 Ga0070693_100001370 3300005547 Bacteria 10977
61 Ga0070665_100000202 3300005548 Bacteria 104773
62 Ga0070665_100038403 3300005548 Bacteria 4813
63 Ga0070665_100049630 3300005548 Bacteria 4210
64 Ga0070665_100160205 3300005548 Bacteria 2252
65 Ga0070704_100251785 3300005549 Bacteria 1451
66 Ga0068855_100257713 3300005563 Bacteria 1944
67 Ga0070664_100022470 3300005564 Bacteria 5201
68 Ga0070664_100059602 3300005564 Bacteria 3248
69 Ga0068854_100000031 3300005578 Bacteria 107298
70 Ga0068854_100061697 3300005578 Bacteria 2716
71 Ga0068856_100002986 3300005614 Bacteria 17301
72 Ga0068856_100020573 3300005614 Bacteria 6411
73 Ga0068856_100046006 3300005614 Bacteria 4297
74 Ga0070702_100157581 3300005615 Bacteria 1464
75 Ga0068852_100000012 3300005616 Bacteria 140734
76 Ga0068852_100008123 3300005616 Bacteria 7704
77 Ga0068866_10000001 3300005718 Bacteria 519680
78 Ga0068866_10000224 3300005718 Bacteria 26642
79 Ga0068851_10003555 3300005834 Bacteria 6940
80 Ga0068863_100000021 3300005841 Bacteria 198088
81 Ga0068858_100001590 3300005842 Bacteria 23153
82 Ga0068858_100067551 3300005842 Bacteria 3312
83 Ga0068860_100012821 3300005843 Bacteria 8241
84 Ga0068860_100077993 3300005843 Bacteria 3151
85 Ga0068862_100003153 3300005844 Bacteria 14325
86 Ga0081455_10008355 3300005937 Bacteria 10779
87 Ga0081539_10001003 3300005985 Bacteria 52435
88 Ga0070717_10000006 3300006028 Bacteria 353403
89 Ga0075363_100149090 3300006048 Bacteria 1320
90 Ga0070715_10000001 3300006163 Bacteria 693690
91 Ga0075428_100012396 3300006844 Bacteria 9482
92 Ga0075428_100101799 3300006844 Bacteria 3132
93 Ga0075428_100140929 3300006844 Bacteria 2622
94 Ga0075430_100017855 3300006846 Bacteria 6039
95 Ga0075431_100014338 3300006847 Bacteria 8016
96 Ga0075431_100382976 3300006847 Bacteria 1410
97 Ga0075433_10000030 3300006852 Bacteria 55877
98 Ga0075429_100022367 3300006880 Bacteria 5484
99 Ga0075429_100026317 3300006880 Bacteria 5050
100 Ga0075429_100116966 3300006880 Bacteria 2330
101 Ga0068865_100000301 3300006881 Bacteria 27213
102 Ga0068865_100080222 3300006881 Bacteria 2340
103 Ga0075436_100035863 3300006914 Bacteria 3421
104 Ga0075435_100034629 3300007076 Bacteria 4002
105 Ga0105240_10047549 3300009093 Bacteria 5429
106 Ga0105240_10068103 3300009093 Bacteria 4410
107 Ga0105245_10003647 3300009098 Bacteria 13745
108 Ga0105245_10052954 3300009098 Bacteria 3642
109 Ga0105245_10242129 3300009098 Bacteria 1749
110 Ga0105247_10334605 3300009101 Bacteria 1060
111 Ga0114129_10003599 3300009147 Bacteria 21790
112 Ga0114129_10231134 3300009147 Bacteria 2491
113 Ga0114129_10241964 3300009147 Bacteria 2425
114 Ga0114129_10404345 3300009147 Bacteria 1799
115 Ga0105243_10086127 3300009148 Bacteria 2576
116 Ga0105241_10060194 3300009174 Bacteria 2921
117 Ga0105242_10031304 3300009176 Bacteria 4247
118 Ga0105248_10000032 3300009177 Bacteria 201114
119 Ga0105237_10007746 3300009545 Bacteria 11722
120 Ga0105238_10000201 3300009551 Bacteria 66092
121 Ga0105249_10000074 3300009553 Bacteria 145235
122 Ga0105249_10004193 3300009553 Bacteria 12452
123 Ga0105249_10010780 3300009553 Bacteria 8031
124 Ga0105249_10107703 3300009553 Bacteria 2630
125 Ga0105239_10203028 3300010375 Bacteria 2221
126 Ga0105239_10465686 3300010375 Bacteria 1435
127 Ga0105239_10572670 3300010375 Bacteria 1287
128 Ga0105246_10214888 3300011119 Bacteria 1503
129 Ga0105246_10355360 3300011119 Bacteria 1202
130 Ga0157371_10168410 3300013102 Bacteria 1565
131 Ga0157370_10003066 3300013104 Bacteria 19809
132 Ga0157370_10006781 3300013104 Bacteria 12561
133 Ga0157370_10048344 3300013104 Bacteria 4075
134 Ga0157369_10000142 3300013105 Bacteria 101760
135 Ga0157369_10323723 3300013105 Bacteria 1602
136 Ga0157374_10038330 3300013296 Bacteria 4405
137 Ga0157378_10065638 3300013297 Bacteria 3249
138 Ga0157378_10739381 3300013297 Bacteria 1006
139 Ga0163162_10051191 3300013306 Bacteria 4143
140 Ga0157372_10000308 3300013307 Bacteria 54161
141 Ga0157372_10010962 3300013307 Bacteria 9646
142 Ga0157372_10035332 3300013307 Bacteria 5501
143 Ga0157375_10004976 3300013308 Bacteria 11555
144 Ga0157375_10076409 3300013308 Bacteria 3376
145 Ga0157375_10450408 3300013308 Bacteria 1453
146 Ga0163163_10083809 3300014325 Bacteria 3193
147 Ga0163163_10366541 3300014325 Bacteria 1498
148 Ga0157380_10000158 3300014326 Bacteria 39132
149 Ga0157380_10036102 3300014326 Bacteria 3823
150 Ga0157377_10001154 3300014745 Bacteria 11209
151 Ga0157379_10004315 3300014968 Bacteria 12160
152 Ga0157379_10058052 3300014968 Bacteria 3459
153 Ga0157379_10182939 3300014968 Bacteria 1893
154 Ga0157376_10148273 3300014969 Bacteria 2113
155 Ga0163161_10010179 3300017792 Bacteria 6510
156 Ga0206356_10084136 3300020070 Bacteria 1630
157 Ga0206353_10428090 3300020082 Bacteria 1013
158 Ga0207656_10000321 3300025321 Bacteria 16492
159 Ga0207682_10000182 3300025893 Bacteria 28392
160 Ga0207692_10000005 3300025898 Bacteria 370169
161 Ga0207692_10274730 3300025898 Bacteria 1017
162 Ga0207642_10000006 3300025899 Bacteria 230268
163 Ga0207642_10000007 3300025899 Bacteria 226017
164 Ga0207642_10000201 3300025899 Bacteria 17517
165 Ga0207710_10039509 3300025900 Bacteria 2088
166 Ga0207685_10000011 3300025905 Bacteria 213430
167 Ga0207705_10044667 3300025909 Bacteria 3184
168 Ga0207707_10046765 3300025912 Bacteria 3769
169 Ga0207695_10107476 3300025913 Bacteria 2775
170 Ga0207695_10133922 3300025913 Bacteria 2433
171 Ga0207695_10553603 3300025913 Bacteria 1032
172 Ga0207693_10000009 3300025915 Bacteria 168990
173 Ga0207693_10074927 3300025915 Bacteria 2650
174 Ga0207663_10000683 3300025916 Bacteria 15043
175 Ga0207663_10153305 3300025916 Bacteria 1619
176 Ga0207663_10206106 3300025916 Bacteria 1422
177 Ga0207660_10073221 3300025917 Bacteria 2497
178 Ga0207660_10111494 3300025917 Bacteria 2059
179 Ga0207657_10234609 3300025919 Bacteria 1466
180 Ga0207649_10000076 3300025920 Bacteria 83824
181 Ga0207652_10007513 3300025921 Bacteria 8774
182 Ga0207681_10006988 3300025923 Bacteria 6927
183 Ga0207694_10000004 3300025924 Bacteria 967075
184 Ga0207650_10183198 3300025925 Bacteria 1670
185 Ga0207659_10000010 3300025926 Bacteria 286639
186 Ga0207687_10000007 3300025927 Bacteria 604185
187 Ga0207687_10002274 3300025927 Bacteria 13067
188 Ga0207687_10186310 3300025927 Bacteria 1611
189 Ga0207700_10000025 3300025928 Bacteria 147429
190 Ga0207664_10000559 3300025929 Bacteria 26103
191 Ga0207664_10114267 3300025929 Bacteria 2249
192 Ga0207664_10154109 3300025929 Bacteria 1955
193 Ga0207690_10011339 3300025932 Bacteria 5328
194 Ga0207690_10046695 3300025932 Bacteria 2870
195 Ga0207706_10000018 3300025933 Bacteria 168729
196 Ga0207706_10000452 3300025933 Bacteria 43893
197 Ga0207706_10462825 3300025933 Bacteria 1096
198 Ga0207706_10526743 3300025933 Bacteria 1019
199 Ga0207686_10000289 3300025934 Bacteria 37190
200 Ga0207669_10000004 3300025937 Bacteria 196828
201 Ga0207669_10000009 3300025937 Bacteria 168012
202 Ga0207704_10000720 3300025938 Bacteria 14555
203 Ga0207704_10060479 3300025938 Bacteria 2344
204 Ga0207665_10187607 3300025939 Bacteria 1501
205 Ga0207691_10000190 3300025940 Bacteria 58438
206 Ga0207711_10000020 3300025941 Bacteria 363325
207 Ga0207661_10000403 3300025944 Bacteria 27999
208 Ga0207661_10001894 3300025944 Bacteria 14344
209 Ga0207661_10002399 3300025944 Bacteria 12903
210 Ga0207661_10004642 3300025944 Bacteria 9622
211 Ga0207661_10029046 3300025944 Bacteria 4243
212 Ga0207661_10047048 3300025944 Bacteria 3423
213 Ga0207661_10165745 3300025944 Bacteria 1920
214 Ga0207679_10006967 3300025945 Bacteria 7164
215 Ga0207679_10211542 3300025945 Bacteria 1626
216 Ga0207679_10461175 3300025945 Bacteria 1128
217 Ga0207667_10273203 3300025949 Bacteria 1728
218 Ga0207651_10019744 3300025960 Bacteria 4048
219 Ga0207712_10000007 3300025961 Bacteria 539589
220 Ga0207712_10093538 3300025961 Bacteria 2219
221 Ga0207712_10409101 3300025961 Bacteria 1142
222 Ga0207668_10227529 3300025972 Bacteria 1501
223 Ga0207640_10000015 3300025981 Bacteria 215411
224 Ga0207640_10143637 3300025981 Bacteria 1743
225 Ga0207658_10001533 3300025986 Bacteria 17952
226 Ga0207677_10000392 3300026023 Bacteria 30151
227 Ga0207677_10000400 3300026023 Bacteria 29863
228 Ga0207703_10000040 3300026035 Bacteria 168191
229 Ga0207703_10001203 3300026035 Bacteria 24263
230 Ga0207703_10045075 3300026035 Bacteria 3546
231 Ga0207639_10011684 3300026041 Bacteria 6104
232 Ga0207639_10090793 3300026041 Bacteria 2444
233 Ga0207678_10093940 3300026067 Bacteria 2562
234 Ga0207678_10589786 3300026067 Bacteria 974
235 Ga0207708_10010453 3300026075 Bacteria 6891
236 Ga0207708_10060184 3300026075 Bacteria 2899
237 Ga0207708_10172863 3300026075 Bacteria 1712
238 Ga0207708_10248086 3300026075 Bacteria 1434
239 Ga0207702_10000016 3300026078 Bacteria 226633
240 Ga0207702_10196350 3300026078 Bacteria 1868
241 Ga0207702_10200759 3300026078 Bacteria 1848
242 Ga0207641_10000094 3300026088 Bacteria 124545
243 Ga0207648_10169543 3300026089 Bacteria 1929
244 Ga0207674_10088738 3300026116 Bacteria 3085
245 Ga0207675_100000799 3300026118 Bacteria 31265
246 Ga0207675_100113489 3300026118 Bacteria 2558
247 Ga0207683_10005039 3300026121 Bacteria 11343
248 Ga0207683_10165086 3300026121 Bacteria 2003
249 Ga0207698_10000012 3300026142 Bacteria 260061
250 Ga0207428_10022816 3300027907 Bacteria 5275
251 Ga0268266_10000020 3300028379 Bacteria 527065
252 Ga0268266_10000085 3300028379 Bacteria 201288
253 Ga0268266_10010633 3300028379 Bacteria 8017
254 Ga0268266_10012151 3300028379 Bacteria 7452
255 Ga0268265_10003291 3300028380 Bacteria 11710
256 Ga0268264_10128863 3300028381 Bacteria 2240
257 Ga0268264_10266830 3300028381 Bacteria 1598
258 Ga0265337_1000002 3300028556 Bacteria 139247
259 Ga0265326_10000007 3300028558 Bacteria 223057
260 Ga0265326_10000017 3300028558 Bacteria 152436
261 Ga0265319_1014513 3300028563 Bacteria 3088
262 Ga0265334_10000029 3300028573 Bacteria 114485
263 Ga0265318_10088772 3300028577 Bacteria 1139
264 Ga0265322_10000001 3300028654 Bacteria 543854
265 Ga0265322_10073069 3300028654 Bacteria 973
266 Ga0265336_10005097 3300028666 Bacteria 4887
267 Ga0265336_10083058 3300028666 Bacteria 955
268 Ga0265338_10000486 3300028800 Bacteria 70900
269 Ga0265338_10002711 3300028800 Bacteria 25983
270 Ga0265324_10000368 3300029957 Bacteria 32654
271 Ga0265324_10001099 3300029957 Bacteria 16252
272 Ga0307511_10136816 3300030521 Bacteria 1455
273 Ga0265332_10070391 3300031238 Bacteria 1490
274 Ga0265320_10000002 3300031240 Bacteria 542875
275 Ga0265325_10020607 3300031241 Bacteria 3633
276 Ga0265329_10009242 3300031242 Bacteria 3689
277 Ga0265331_10001462 3300031250 Bacteria 17370
278 Ga0265331_10025644 3300031250 Bacteria 2973
279 Ga0265327_10000011 3300031251 Bacteria 543807
280 Ga0265327_10010563 3300031251 Bacteria 6470
281 Ga0265327_10186291 3300031251 Bacteria 946
282 Ga0265316_10174365 3300031344 Bacteria 1603
283 Ga0265314_10000058 3300031711 Bacteria 167476
284 Ga0265342_10036501 3300031712 Bacteria 3002
285 Ga0307405_10402051 3300031731 Bacteria 1072
286 Ga0307406_10042161 3300031901 Bacteria 2848
287 Ga0307406_10286449 3300031901 Bacteria 1259
288 Ga0307406_10357911 3300031901 Bacteria 1143
289 Ga0307406_10621967 3300031901 Bacteria 893
290 Ga0307416_100280567 3300032002 Bacteria 1642
291 Ga0307414_10165686 3300032004 Bacteria 1761
292 Ga0307415_100028807 3300032126 Bacteria 3539
293 Ga0307415_100034398 3300032126 Bacteria 3299
294 Ga0307415_100062799 3300032126 Bacteria 2578
295 Ga0307415_100565436 3300032126 Bacteria 1006
296 Ga0316583_10113271 3300032133 Bacteria 945
297 Ga0373938_0048965 3300034957 Bacteria 960
298 Ga0373956_0218500 3300035119 Bacteria 905
299 Ga0373955_0119220 3300035172 Bacteria 1532
300 Ga0373942_0061772 3300035207 Bacteria 1075
301 Ga0373962_0022326 3300035242 Bacteria 1677
302 Ga0373937_0019568 3300036401 Bacteria 6059
303 Ga0373937_0036065 3300036401 Bacteria 4505
304 Ga0373937_0143403 3300036401 Bacteria 2235
305 Ga0466972_0070258 3300044658 Bacteria 1671
306 Ga0466972_0152893 3300044658 Bacteria 1085
307 Ga0466963_0000312 3300044694 Bacteria 21872
308 Ga0466963_0011252 3300044694 Bacteria 5445
309 Ga0466963_0228618 3300044694 Bacteria 1303
310 Ga0466957_0005251 3300044842 Bacteria 7252
311 Ga0466959_0222534 3300045049 Bacteria 1308
312 Ga0466958_0043401 3300045836 Bacteria 2708
313 Ga0466958_0116061 3300045836 Bacteria 1673
314 Ga0466958_0166688 3300045836 Bacteria 1394
315 Ga0466967_0000033 3300045976 Bacteria 54859
316 Ga0466967_0015672 3300045976 Bacteria 5951
317 Ga0466967_0040498 3300045976 Bacteria 4011
318 Ga0466967_0187078 3300045976 Bacteria 1956
319 Ga0466967_0426579 3300045976 Bacteria 1293
320 Ga0495592_0001746 3300046454 Bacteria 15268
321 Ga0495592_0268838 3300046454 Bacteria 1119
322 Ga0495603_0000436 3300046455 Bacteria 23083
323 Ga0495603_0000943 3300046455 Bacteria 16721
324 Ga0495603_0006298 3300046455 Bacteria 7097
325 Ga0495629_0002666 3300046459 Bacteria 13663
326 Ga0495629_0007203 3300046459 Bacteria 8190
327 Ga0495641_0000003 3300046461 Bacteria 242879
328 Ga0495641_0006893 3300046461 Bacteria 7252
329 Ga0495641_0030180 3300046461 Bacteria 2603
330 Ga0495641_0059297 3300046461 Bacteria 1730
331 Ga0495651_0146634 3300046462 Bacteria 1706
332 Ga0495651_0148680 3300046462 Bacteria 1691
333 Ga0495653_0000869 3300046463 Bacteria 23318
334 Ga0495653_0032153 3300046463 Bacteria 4169
335 Ga0495653_0117824 3300046463 Bacteria 1897
336 Ga0495653_0408753 3300046463 Bacteria 861
337 Ga0495582_0000027 3300046473 Bacteria 79970
338 Ga0495605_0048491 3300046474 Bacteria 2079
339 Ga0495605_0055445 3300046474 Bacteria 1915
340 Ga0495639_0005616 3300046475 Bacteria 5401
341 Ga0495662_0000749 3300046476 Bacteria 15587
342 Ga0495662_0007722 3300046476 Bacteria 5297
343 Ga0495664_0125191 3300046477 Bacteria 1555
344 Ga0495584_0233927 3300046491 Bacteria 934
345 Ga0495594_0000003 3300046499 Bacteria 199267
346 Ga0495596_0131621 3300046500 Bacteria 971
347 Ga0495606_0000221 3300046507 Bacteria 101157
348 Ga0495608_0000031 3300046511 Bacteria 145255
349 Ga0495608_0001401 3300046511 Bacteria 17150
350 Ga0495608_0008515 3300046511 Bacteria 7186
351 Ga0495608_0064774 3300046511 Bacteria 2395
352 Ga0495608_0119192 3300046511 Bacteria 1693
353 Ga0495620_0000246 3300046515 Bacteria 40444
354 Ga0495628_0000595 3300046516 Bacteria 33337
355 Ga0495628_0011721 3300046516 Bacteria 7403
356 Ga0495628_0015260 3300046516 Bacteria 6417
357 Ga0495628_0036612 3300046516 Bacteria 3937
358 Ga0495628_0265086 3300046516 Bacteria 1279
359 Ga0495630_0000018 3300046517 Bacteria 186064
360 Ga0495630_0255677 3300046517 Bacteria 1338
361 Ga0495644_0002924 3300046523 Bacteria 6785
362 Ga0495652_0007124 3300046529 Bacteria 10314
363 Ga0495652_0073576 3300046529 Bacteria 2845
364 Ga0495640_0308129 3300046533 Bacteria 982
365 Ga0495586_0002195 3300046535 Bacteria 10597
366 Ga0495587_0001523 3300046536 Bacteria 15407
367 Ga0495587_0233443 3300046536 Bacteria 1036
368 Ga0495645_0000076 3300046543 Bacteria 67987
369 Ga0495645_0028088 3300046543 Bacteria 4087
370 Ga0495645_0154632 3300046543 Bacteria 1590
371 Ga0495622_0000014 3300046557 Bacteria 182142
372 Ga0495633_0144232 3300046558 Bacteria 1100
373 Ga0495667_0000032 3300046559 Bacteria 143493
374 Ga0495667_0163159 3300046559 Bacteria 1433
375 Ga0495656_0000122 3300046615 Bacteria 29816
376 Ga0495668_0043438 3300046616 Bacteria 2500
377 Ga0495634_0000050 3300046642 Bacteria 94546
378 Ga0495634_0000556 3300046642 Bacteria 36540
379 Ga0495625_0000122 3300046660 Bacteria 121146
380 Ga0495635_0000770 3300046663 Bacteria 20877
381 Ga0495635_0017408 3300046663 Bacteria 5020
382 Ga0495588_0150807 3300046674 Bacteria 1229
383 Ga0495657_0000024 3300046675 Bacteria 145255
384 Ga0495599_0027842 3300046678 Bacteria 3540
385 Ga0495647_0000007 3300046681 Bacteria 103790
386 Ga0495647_0000228 3300046681 Bacteria 15271
387 Ga0495647_0231492 3300046681 Bacteria 818
388 Ga0495658_0000025 3300046683 Bacteria 79910
389 Ga0495658_0007635 3300046683 Bacteria 5361
390 Ga0495658_0282246 3300046683 Bacteria 1048
391 Ga0495669_0000126 3300046684 Bacteria 48798
392 Ga0495613_0000073 3300046689 Bacteria 98688
393 Ga0495613_0000715 3300046689 Bacteria 26019
394 Ga0495613_0043665 3300046689 Bacteria 3316
395 Ga0495613_0144374 3300046689 Bacteria 1699
396 Ga0495624_0000009 3300046690 Bacteria 145026
397 Ga0495624_0000037 3300046690 Bacteria 83796
398 Ga0495624_0013989 3300046690 Bacteria 5461
399 Ga0495670_0011330 3300046691 Bacteria 4384
400 Ga0495649_0004196 3300046694 Bacteria 9460
401 Ga0495589_0033453 3300046794 Bacteria 2582
402 Ga0495581_0373050 3300047315 Bacteria 833
403 Ga0495604_0000038 3300047317 Bacteria 123703
404 Ga0495604_0000073 3300047317 Bacteria 86844
405 Ga0495604_0060058 3300047317 Bacteria 2912
406 Ga0495674_0162313 3300047319 Bacteria 1869
407 Ga0495672_0014251 3300047320 Bacteria 5454
408 Ga0495672_0101617 3300047320 Bacteria 1558
409 Ga0495676_0001150 3300047321 Bacteria 22493
410 Ga0495676_0007125 3300047321 Bacteria 10265
411 Ga0495676_0058714 3300047321 Bacteria 3025
412 Ga0495676_0069410 3300047321 Bacteria 2719
413 Ga0495680_0000061 3300047322 Bacteria 90676
414 Ga0495680_0001537 3300047322 Bacteria 24709
415 Ga0495680_0017757 3300047322 Bacteria 6058
416 Ga0495680_0038446 3300047322 Bacteria 3824
417 Ga0495675_0000090 3300047444 Bacteria 63705
418 Ga0495675_0003673 3300047444 Bacteria 9275
419 Ga0495679_010378 3300047446 Bacteria 3659
420 Ga0495685_051364 3300047447 Bacteria 1398
421 Ga0495673_0033219 3300047469 Bacteria 2397
422 Ga0495593_0047682 3300047673 Bacteria 2278
423 Ga0495602_0000021 3300048088 Bacteria 168585
424 Ga0495602_0001155 3300048088 Bacteria 25844
425 Ga0495602_0272417 3300048088 Bacteria 1251
426 Ga0495614_0072241 3300048089 Bacteria 1488
427 Ga0496100_0000002 3300048903 Bacteria 489057
428 Ga0496100_0000038 3300048903 Bacteria 94110
429 Ga0496100_0001695 3300048903 Bacteria 10951
430 Ga0496100_0098331 3300048903 Bacteria 2011
431 Ga0496101_0000001 3300048904 Bacteria 489057
432 Ga0496101_0000153 3300048904 Bacteria 59317
433 Ga0496101_0011927 3300048904 Bacteria 5788
434 Ga0496101_0024929 3300048904 Bacteria 4146
435 Ga0496101_0378816 3300048904 Bacteria 1113
436 Ga0496102_0010828 3300048905 Bacteria 7851
437 Ga0496102_0013391 3300048905 Bacteria 7104
438 Ga0496102_0213119 3300048905 Bacteria 1821
439 Ga0496102_0424551 3300048905 Bacteria 1249
440 Ga0496102_0536373 3300048905 Bacteria 1093
441 Ga0496103_0231720 3300048906 Bacteria 1188
442 Ga0496104_0000004 3300048907 Bacteria 641830
443 Ga0496104_0000013 3300048907 Bacteria 397163
444 Ga0496104_0008158 3300048907 Bacteria 9296
445 Ga0496104_0034304 3300048907 Bacteria 4730
446 Ga0496105_0000001 3300048908 Bacteria 1328178
447 Ga0496105_0000006 3300048908 Bacteria 393578
448 Ga0496105_0022244 3300048908 Bacteria 5135
449 Ga0496106_0000018 3300048909 Bacteria 175028
450 Ga0496106_0000022 3300048909 Bacteria 166339
451 Ga0496106_0000138 3300048909 Bacteria 54275
452 Ga0496106_0024038 3300048909 Bacteria 4529
453 Ga0496107_0000006 3300048910 Bacteria 258746
454 Ga0496107_0000016 3300048910 Bacteria 172319
455 Ga0496107_0015817 3300048910 Bacteria 5292
456 Ga0496108_0000001 3300048911 Bacteria 919044
457 Ga0496108_0000107 3300048911 Bacteria 86395
458 Ga0496108_0000150 3300048911 Bacteria 67068
459 Ga0496108_0005419 3300048911 Bacteria 10313
460 Ga0496108_0021654 3300048911 Bacteria 5284
461 Ga0496108_0121521 3300048911 Bacteria 2240
462 Ga0496108_0334512 3300048911 Bacteria 1321
463 Ga0496109_0000003 3300048912 Bacteria 420862
464 Ga0496109_0000007 3300048912 Bacteria 247554
465 Ga0496109_0000028 3300048912 Bacteria 168138
466 Ga0496109_0000190 3300048912 Bacteria 61169
467 Ga0496109_0069966 3300048912 Bacteria 3220
468 Ga0496109_0121948 3300048912 Bacteria 2429
469 Ga0496109_0278022 3300048912 Bacteria 1578
470 Ga0496109_0312308 3300048912 Bacteria 1483
471 Ga0496110_0000105 3300048913 Bacteria 45468
472 Ga0496110_0001693 3300048913 Bacteria 16200
473 Ga0496110_0007645 3300048913 Bacteria 8648
474 Ga0496110_0011724 3300048913 Bacteria 7192
475 Ga0496110_0081579 3300048913 Bacteria 2883
476 Ga0496110_0104270 3300048913 Bacteria 2544
477 Ga0496110_0282571 3300048913 Bacteria 1511
478 Ga0496110_0608767 3300048913 Bacteria 991
479 Ga0496111_0000261 3300048914 Bacteria 25723
480 Ga0496111_0025205 3300048914 Bacteria 4195
481 Ga0496111_0029031 3300048914 Bacteria 3924
482 Ga0496111_0035564 3300048914 Bacteria 3561
483 Ga0496111_0043451 3300048914 Bacteria 3230
484 Ga0496112_0000003 3300048915 Bacteria 660147
485 Ga0496112_0000938 3300048915 Bacteria 21148
486 Ga0496112_0099520 3300048915 Bacteria 2877
487 Ga0496112_0121151 3300048915 Bacteria 2585
488 Ga0496112_0148936 3300048915 Bacteria 2308
489 Ga0496113_0000007 3300048916 Bacteria 95884
490 Ga0496113_0005537 3300048916 Bacteria 7886
491 Ga0496113_0011498 3300048916 Bacteria 5909
492 Ga0496113_0027826 3300048916 Bacteria 4058
493 Ga0496113_0076703 3300048916 Bacteria 2554
494 Ga0496113_0123269 3300048916 Bacteria 2028
495 Ga0496114_0000014 3300048917 Bacteria 297902
496 Ga0496114_0021444 3300048917 Bacteria 5258
497 Ga0496114_0129367 3300048917 Bacteria 2179
498 Ga0496114_0269490 3300048917 Bacteria 1500
499 Ga0496115_0000003 3300048918 Bacteria 354994
500 Ga0496115_0000316 3300048918 Bacteria 41025
501 Ga0496115_0004682 3300048918 Bacteria 9913
502 Ga0496115_0099274 3300048918 Bacteria 2386
503 Ga0496117_0001943 3300048920 Bacteria 27588
504 Ga0496118_0006681 3300048921 Bacteria 12575
505 Ga0496120_0003588 3300048923 Bacteria 13945
506 Ga0496121_0004930 3300048924 Bacteria 17505
507 Ga0496121_0058851 3300048924 Bacteria 3173
508 Ga0496124_0171011 3300048927 Bacteria 1683
509 Ga0496125_0051208 3300048928 Bacteria 3408
510 Ga0501031_0005468 3300049568 Bacteria 8265
511 Ga0501032_0005971 3300049569 Bacteria 8986
512 Ga0501033_0000303 3300049570 Bacteria 46665
513 Ga0501034_0005201 3300049571 Bacteria 14278
514 Ga0501034_0400519 3300049571 Bacteria 1295
515 Ga0501036_0001663 3300049572 Bacteria 17225
516 Ga0501036_0366429 3300049572 Bacteria 1203
517 Ga0501037_0000268 3300049573 Bacteria 44906
518 Ga0501038_0000245 3300049574 Bacteria 46017
519 Ga0501039_0022732 3300049575 Bacteria 4811
520 Ga0501040_0017656 3300049576 Bacteria 4736
521 Ga0501042_0006014 3300049578 Bacteria 7859
522 Ga0501042_0016714 3300049578 Bacteria 5044
523 Ga0501042_0027972 3300049578 Bacteria 3968
524 Ga0501042_0055644 3300049578 Bacteria 2824
525 Ga0501043_0002081 3300049579 Bacteria 17080
526 Ga0501043_0063927 3300049579 Bacteria 2890
527 Ga0501046_0000162 3300049580 Bacteria 69629
528 Ga0501046_0150576 3300049580 Bacteria 1755
529 Ga0501047_0000263 3300049581 Bacteria 61685
530 Ga0501047_0408912 3300049581 Bacteria 1189
531 Ga0501048_0000118 3300049582 Bacteria 45320
532 Ga0501048_0135663 3300049582 Bacteria 1739
533 Ga0501067_0080184 3300049583 Bacteria 1809
534 Ga0501068_0005576 3300049584 Bacteria 6895
535 Ga0501068_0180403 3300049584 Bacteria 1335
536 Ga0501069_0086339 3300049585 Bacteria 1771
537 Ga0501070_0001887 3300049586 Bacteria 18534
538 Ga0501070_0098829 3300049586 Bacteria 2414
539 Ga0501070_0166227 3300049586 Bacteria 1818
540 Ga0501071_0086748 3300049587 Bacteria 2296
541 Ga0501071_0445316 3300049587 Bacteria 991
542 Ga0501072_0188750 3300049588 Bacteria 1644
543 Ga0501072_0188845 3300049588 Bacteria 1643
544 Ga0501073_0002399 3300049589 Bacteria 14017
545 Ga0501074_0008502 3300049590 Bacteria 7438
546 Ga0501074_0025353 3300049590 Bacteria 4306
547 Ga0501075_0001131 3300049591 Bacteria 17202
548 Ga0501076_0121145 3300049592 Bacteria 2118
549 Ga0501079_0008388 3300049741 Bacteria 7830
550 Ga0501079_0110229 3300049741 Bacteria 2138
551 Ga0501080_0021195 3300049742 Bacteria 6014
552 Ga0501080_0144702 3300049742 Bacteria 2197
553 Ga0501083_0000642 3300049744 Bacteria 22617
554 Ga0501083_0111467 3300049744 Bacteria 1798
555 Ga0501035_0000391 3300049822 Bacteria 50329
556 Ga0501044_0003076 3300049823 Bacteria 18881
557 Ga0501044_0118120 3300049823 Bacteria 2655
558 Ga0501045_0009652 3300049824 Bacteria 6753
559 Ga0501045_0403659 3300049824 Bacteria 1017
560 nmdc:mga0yw44_164172_c1 3300050492 Bacteria 1455
561 nmdc:mga05p37_414171_c1 3300050507 Bacteria 1570
562 nmdc:mga05p37_9111_c1 3300050507 Bacteria 11730
563 nmdc:mga09592_244718_c1 3300050508 Bacteria 1554
564 nmdc:mga09592_390930_c1 3300050508 Bacteria 1202
565 nmdc:mga09592_5535_c1 3300050508 Bacteria 10282
566 nmdc:mga09592_78803_c1 3300050508 Bacteria 2804
567 nmdc:mga0qj67_218211_c1 3300050509 Bacteria 1548
568 nmdc:mga0qj67_443137_c1 3300050509 Bacteria 1046
569 nmdc:mga06r32_98370_c1 3300050510 Bacteria 2868
570 nmdc:mga08y16_182432_c1 3300050511 Bacteria 2179
571 nmdc:mga08y16_37454_c1 3300050511 Bacteria 5093
572 nmdc:mga08y16_486345_c1 3300050511 Bacteria 1255
573 nmdc:mga0n895_231944_c1 3300050512 Bacteria 1873
574 nmdc:mga0n895_328145_c1 3300050512 Bacteria 1550
575 nmdc:mga08x19_24966_c1 3300050514 Bacteria 3720
576 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
577 nmdc:mga0a205_3884_c1 3300050515 Bacteria 13377
578 Ga0495601_0000039 3300053077 Bacteria 79594
579 Ga0495601_0000126 3300053077 Bacteria 42871
580 Ga0495601_0013506 3300053077 Bacteria 4913
581 Ga0495601_0027905 3300053077 Bacteria 3493
582 Ga0495612_0000195 3300053078 Bacteria 25890
583 Ga0495612_0018908 3300053078 Bacteria 2758
584 Ga0495655_0022713 3300053083 Bacteria 1437
585 Ga0495595_0000014 3300053084 Bacteria 145255
586 Ga0495595_0000151 3300053084 Bacteria 27542
587 Ga0495619_0000114 3300053085 Bacteria 59624
588 Ga0495619_0000135 3300053085 Bacteria 54848
589 Ga0495619_0000243 3300053085 Bacteria 39638
590 Ga0495619_0002645 3300053085 Bacteria 11706
591 Ga0495619_0006342 3300053085 Bacteria 7497
592 Ga0495619_0066017 3300053085 Bacteria 2415
593 Ga0495619_0127959 3300053085 Bacteria 1744
594 Ga0495619_0384440 3300053085 Bacteria 970
595 Ga0500641_0016841 3300053096 Bacteria 2724
596 Ga0500614_000984 3300053123 Bacteria 7071
597 Ga0501084_0177037 3300054114 Bacteria 1800
598 Ga0501082_0010537 3300060353 Bacteria 7954
599 Ga0075433_10011635
600 JGI24746J21847_1000030
601 JGI24748J21848_1000299
602 JGI24034J26672_10000180
603 JGI24742J22300_10005526
604 Ga0070683_100013994
605 Ga0070683_100067019
606 Ga0070683_100124685
607 Ga0070683_100271904
608 Ga0070683_100608404
609 Ga0070670_100133785
610 Ga0070677_10000098
611 Ga0068869_100469357
612 Ga0070680_100004310
613 Ga0070680_100166226
614 Ga0070682_100000013
615 Ga0070682_100000421
616 Ga0070660_100023755
617 Ga0070660_100094268
618 Ga0070660_100170858
619 Ga0070691_10001700
620 Ga0070691_10002622
621 Ga0070692_10074104
622 Ga0070692_10115004
623 Ga0070668_100019675
624 Ga0070669_100004240
625 Ga0070675_100000053
626 Ga0070674_100000025
627 Ga0070673_100001851
628 Ga0070688_100000012
629 Ga0070688_100000269
630 Ga0070659_100000103
631 Ga0070659_100018141
632 Ga0070667_100001647
633 Ga0070667_100418795
634 Ga0070703_10077334
635 Ga0070714_100000738
636 Ga0070714_100021371
637 Ga0070714_100619941
638 Ga0070713_100000009
639 Ga0070713_100157073
640 Ga0070710_10000002
641 Ga0070711_100112746
642 Ga0070711_100153534
643 Ga0070705_100001055
644 Ga0070662_100000007
645 Ga0070662_100001448
646 Ga0070662_100563086
647 Ga0070681_10019064
648 Ga0070685_10000018
649 Ga0070685_10000142
650 Ga0070679_100072889
651 Ga0070684_100065416
652 Ga0070684_100089568
653 Ga0070684_100128266
654 Ga0068853_100013727
655 Ga0070672_100000030
656 Ga0070686_100046315
657 Ga0070696_100444561
658 Ga0070693_100001370
659 Ga0070665_100000202
660 Ga0070665_100038403
661 Ga0070665_100049630
662 Ga0070665_100160205
663 Ga0070704_100251785
664 Ga0068855_100257713
665 Ga0070664_100022470
666 Ga0070664_100059602
667 Ga0068854_100000031
668 Ga0068854_100061697
669 Ga0068856_100002986
670 Ga0068856_100020573
671 Ga0068856_100046006
672 Ga0070702_100157581
673 Ga0068852_100000012
674 Ga0068852_100008123
675 Ga0068866_10000001
676 Ga0068866_10000224
677 Ga0068851_10003555
678 Ga0068863_100000021
679 Ga0068858_100001590
680 Ga0068858_100067551
681 Ga0068860_100012821
682 Ga0068860_100077993
683 Ga0068862_100003153
684 Ga0081455_10008355
685 Ga0081539_10001003
686 Ga0070717_10000006
687 Ga0075363_100149090
688 Ga0070715_10000001
689 Ga0075428_100012396
690 Ga0075428_100101799
691 Ga0075428_100140929
692 Ga0075430_100017855
693 Ga0075431_100014338
694 Ga0075431_100382976
695 Ga0075433_10000030
696 Ga0075429_100022367
697 Ga0075429_100026317
698 Ga0075429_100116966
699 Ga0068865_100000301
700 Ga0068865_100080222
701 Ga0075436_100035863
702 Ga0075435_100034629
703 Ga0105240_10047549
704 Ga0105240_10068103
705 Ga0105245_10003647
706 Ga0105245_10052954
707 Ga0105245_10242129
708 Ga0105247_10334605
709 Ga0114129_10003599
710 Ga0114129_10231134
711 Ga0114129_10241964
712 Ga0114129_10404345
713 Ga0105243_10086127
714 Ga0105241_10060194
715 Ga0105242_10031304
716 Ga0105248_10000032
717 Ga0105237_10007746
718 Ga0105238_10000201
719 Ga0105249_10000074
720 Ga0105249_10004193
721 Ga0105249_10010780
722 Ga0105249_10107703
723 Ga0105239_10203028
724 Ga0105239_10465686
725 Ga0105239_10572670
726 Ga0105246_10214888
727 Ga0105246_10355360
728 Ga0157371_10168410
729 Ga0157370_10003066
730 Ga0157370_10006781
731 Ga0157370_10048344
732 Ga0157369_10000142
733 Ga0157369_10323723
734 Ga0157374_10038330
735 Ga0157378_10065638
736 Ga0157378_10739381
737 Ga0163162_10051191
738 Ga0157372_10000308
739 Ga0157372_10010962
740 Ga0157372_10035332
741 Ga0157375_10004976
742 Ga0157375_10076409
743 Ga0157375_10450408
744 Ga0163163_10083809
745 Ga0163163_10366541
746 Ga0157380_10000158
747 Ga0157380_10036102
748 Ga0157377_10001154
749 Ga0157379_10004315
750 Ga0157379_10058052
751 Ga0157379_10182939
752 Ga0157376_10148273
753 Ga0163161_10010179
754 Ga0206356_10084136
755 Ga0206353_10428090
756 Ga0207656_10000321
757 Ga0207682_10000182
758 Ga0207692_10000005
759 Ga0207692_10274730
760 Ga0207642_10000006
761 Ga0207642_10000007
762 Ga0207642_10000201
763 Ga0207710_10039509
764 Ga0207685_10000011
765 Ga0207705_10044667
766 Ga0207707_10046765
767 Ga0207695_10107476
768 Ga0207695_10133922
769 Ga0207695_10553603
770 Ga0207693_10000009
771 Ga0207693_10074927
772 Ga0207663_10000683
773 Ga0207663_10153305
774 Ga0207663_10206106
775 Ga0207660_10073221
776 Ga0207660_10111494
777 Ga0207657_10234609
778 Ga0207649_10000076
779 Ga0207652_10007513
780 Ga0207681_10006988
781 Ga0207694_10000004
782 Ga0207650_10183198
783 Ga0207659_10000010
784 Ga0207687_10000007
785 Ga0207687_10002274
786 Ga0207687_10186310
787 Ga0207700_10000025
788 Ga0207664_10000559
789 Ga0207664_10114267
790 Ga0207664_10154109
791 Ga0207690_10011339
792 Ga0207690_10046695
793 Ga0207706_10000018
794 Ga0207706_10000452
795 Ga0207706_10462825
796 Ga0207706_10526743
797 Ga0207686_10000289
798 Ga0207669_10000004
799 Ga0207669_10000009
800 Ga0207704_10000720
801 Ga0207704_10060479
802 Ga0207665_10187607
803 Ga0207691_10000190
804 Ga0207711_10000020
805 Ga0207661_10000403
806 Ga0207661_10001894
807 Ga0207661_10002399
808 Ga0207661_10004642
809 Ga0207661_10029046
810 Ga0207661_10047048
811 Ga0207661_10165745
812 Ga0207679_10006967
813 Ga0207679_10211542
814 Ga0207679_10461175
815 Ga0207667_10273203
816 Ga0207651_10019744
817 Ga0207712_10000007
818 Ga0207712_10093538
819 Ga0207712_10409101
820 Ga0207668_10227529
821 Ga0207640_10000015
822 Ga0207640_10143637
823 Ga0207658_10001533
824 Ga0207677_10000392
825 Ga0207677_10000400
826 Ga0207703_10000040
827 Ga0207703_10001203
828 Ga0207703_10045075
829 Ga0207639_10011684
830 Ga0207639_10090793
831 Ga0207678_10093940
832 Ga0207678_10589786
833 Ga0207708_10010453
834 Ga0207708_10060184
835 Ga0207708_10172863
836 Ga0207708_10248086
837 Ga0207702_10000016
838 Ga0207702_10196350
839 Ga0207702_10200759
840 Ga0207641_10000094
841 Ga0207648_10169543
842 Ga0207674_10088738
843 Ga0207675_100000799
844 Ga0207675_100113489
845 Ga0207683_10005039
846 Ga0207683_10165086
847 Ga0207698_10000012
848 Ga0207428_10022816
849 Ga0268266_10000020
850 Ga0268266_10000085
851 Ga0268266_10010633
852 Ga0268266_10012151
853 Ga0268265_10003291
854 Ga0268264_10128863
855 Ga0268264_10266830
856 Ga0265337_1000002
857 Ga0265326_10000007
858 Ga0265326_10000017
859 Ga0265319_1014513
860 Ga0265334_10000029
861 Ga0265318_10088772
862 Ga0265322_10000001
863 Ga0265322_10073069
864 Ga0265336_10005097
865 Ga0265336_10083058
866 Ga0265338_10000486
867 Ga0265338_10002711
868 Ga0265324_10000368
869 Ga0265324_10001099
870 Ga0307511_10136816
871 Ga0265332_10070391
872 Ga0265320_10000002
873 Ga0265325_10020607
874 Ga0265329_10009242
875 Ga0265331_10001462
876 Ga0265331_10025644
877 Ga0265327_10000011
878 Ga0265327_10010563
879 Ga0265327_10186291
880 Ga0265316_10174365
881 Ga0265314_10000058
882 Ga0265342_10036501
883 Ga0307405_10402051
884 Ga0307406_10042161
885 Ga0307406_10286449
886 Ga0307406_10357911
887 Ga0307406_10621967
888 Ga0307416_100280567
889 Ga0307414_10165686
890 Ga0307415_100028807
891 Ga0307415_100034398
892 Ga0307415_100062799
893 Ga0307415_100565436
894 Ga0316583_10113271
895 Ga0373938_0048965
896 Ga0373956_0218500
897 Ga0373955_0119220
898 Ga0373942_0061772
899 Ga0373962_0022326
900 Ga0373937_0019568
901 Ga0373937_0036065
902 Ga0373937_0143403
903 Ga0466972_0070258
904 Ga0466972_0152893
905 Ga0466963_0000312
906 Ga0466963_0011252
907 Ga0466963_0228618
908 Ga0466957_0005251
909 Ga0466959_0222534
910 Ga0466958_0043401
911 Ga0466958_0116061
912 Ga0466958_0166688
913 Ga0466967_0000033
914 Ga0466967_0015672
915 Ga0466967_0040498
916 Ga0466967_0187078
917 Ga0466967_0426579
918 Ga0495592_0001746
919 Ga0495592_0268838
920 Ga0495603_0000436
921 Ga0495603_0000943
922 Ga0495603_0006298
923 Ga0495629_0002666
924 Ga0495629_0007203
925 Ga0495641_0000003
926 Ga0495641_0006893
927 Ga0495641_0030180
928 Ga0495641_0059297
929 Ga0495651_0146634
930 Ga0495651_0148680
931 Ga0495653_0000869
932 Ga0495653_0032153
933 Ga0495653_0117824
934 Ga0495653_0408753
935 Ga0495582_0000027
936 Ga0495605_0048491
937 Ga0495605_0055445
938 Ga0495639_0005616
939 Ga0495662_0000749
940 Ga0495662_0007722
941 Ga0495664_0125191
942 Ga0495584_0233927
943 Ga0495594_0000003
944 Ga0495596_0131621
945 Ga0495606_0000221
946 Ga0495608_0000031
947 Ga0495608_0001401
948 Ga0495608_0008515
949 Ga0495608_0064774
950 Ga0495608_0119192
951 Ga0495620_0000246
952 Ga0495628_0000595
953 Ga0495628_0011721
954 Ga0495628_0015260
955 Ga0495628_0036612
956 Ga0495628_0265086
957 Ga0495630_0000018
958 Ga0495630_0255677
959 Ga0495644_0002924
960 Ga0495652_0007124
961 Ga0495652_0073576
962 Ga0495640_0308129
963 Ga0495586_0002195
964 Ga0495587_0001523
965 Ga0495587_0233443
966 Ga0495645_0000076
967 Ga0495645_0028088
968 Ga0495645_0154632
969 Ga0495622_0000014
970 Ga0495633_0144232
971 Ga0495667_0000032
972 Ga0495667_0163159
973 Ga0495656_0000122
974 Ga0495668_0043438
975 Ga0495634_0000050
976 Ga0495634_0000556
977 Ga0495625_0000122
978 Ga0495635_0000770
979 Ga0495635_0017408
980 Ga0495588_0150807
981 Ga0495657_0000024
982 Ga0495599_0027842
983 Ga0495647_0000007
984 Ga0495647_0000228
985 Ga0495647_0231492
986 Ga0495658_0000025
987 Ga0495658_0007635
988 Ga0495658_0282246
989 Ga0495669_0000126
990 Ga0495613_0000073
991 Ga0495613_0000715
992 Ga0495613_0043665
993 Ga0495613_0144374
994 Ga0495624_0000009
995 Ga0495624_0000037
996 Ga0495624_0013989
997 Ga0495670_0011330
998 Ga0495649_0004196
999 Ga0495589_0033453
1000 Ga0495581_0373050
1001 Ga0495604_0000038
1002 Ga0495604_0000073
1003 Ga0495604_0060058
1004 Ga0495674_0162313
1005 Ga0495672_0014251
1006 Ga0495672_0101617
1007 Ga0495676_0001150
1008 Ga0495676_0007125
1009 Ga0495676_0058714
1010 Ga0495676_0069410
1011 Ga0495680_0000061
1012 Ga0495680_0001537
1013 Ga0495680_0017757
1014 Ga0495680_0038446
1015 Ga0495675_0000090
1016 Ga0495675_0003673
1017 Ga0495679_010378
1018 Ga0495685_051364
1019 Ga0495673_0033219
1020 Ga0495593_0047682
1021 Ga0495602_0000021
1022 Ga0495602_0001155
1023 Ga0495602_0272417
1024 Ga0495614_0072241
1025 Ga0496100_0000002
1026 Ga0496100_0000038
1027 Ga0496100_0001695
1028 Ga0496100_0098331
1029 Ga0496101_0000001
1030 Ga0496101_0000153
1031 Ga0496101_0011927
1032 Ga0496101_0024929
1033 Ga0496101_0378816
1034 Ga0496102_0010828
1035 Ga0496102_0013391
1036 Ga0496102_0213119
1037 Ga0496102_0424551
1038 Ga0496102_0536373
1039 Ga0496103_0231720
1040 Ga0496104_0000004
1041 Ga0496104_0000013
1042 Ga0496104_0008158
1043 Ga0496104_0034304
1044 Ga0496105_0000001
1045 Ga0496105_0000006
1046 Ga0496105_0022244
1047 Ga0496106_0000018
1048 Ga0496106_0000022
1049 Ga0496106_0000138
1050 Ga0496106_0024038
1051 Ga0496107_0000006
1052 Ga0496107_0000016
1053 Ga0496107_0015817
1054 Ga0496108_0000001
1055 Ga0496108_0000107
1056 Ga0496108_0000150
1057 Ga0496108_0005419
1058 Ga0496108_0021654
1059 Ga0496108_0121521
1060 Ga0496108_0334512
1061 Ga0496109_0000003
1062 Ga0496109_0000007
1063 Ga0496109_0000028
1064 Ga0496109_0000190
1065 Ga0496109_0069966
1066 Ga0496109_0121948
1067 Ga0496109_0278022
1068 Ga0496109_0312308
1069 Ga0496110_0000105
1070 Ga0496110_0001693
1071 Ga0496110_0007645
1072 Ga0496110_0011724
1073 Ga0496110_0081579
1074 Ga0496110_0104270
1075 Ga0496110_0282571
1076 Ga0496110_0608767
1077 Ga0496111_0000261
1078 Ga0496111_0025205
1079 Ga0496111_0029031
1080 Ga0496111_0035564
1081 Ga0496111_0043451
1082 Ga0496112_0000003
1083 Ga0496112_0000938
1084 Ga0496112_0099520
1085 Ga0496112_0121151
1086 Ga0496112_0148936
1087 Ga0496113_0000007
1088 Ga0496113_0005537
1089 Ga0496113_0011498
1090 Ga0496113_0027826
1091 Ga0496113_0076703
1092 Ga0496113_0123269
1093 Ga0496114_0000014
1094 Ga0496114_0021444
1095 Ga0496114_0129367
1096 Ga0496114_0269490
1097 Ga0496115_0000003
1098 Ga0496115_0000316
1099 Ga0496115_0004682
1100 Ga0496115_0099274
1101 Ga0496117_0001943
1102 Ga0496118_0006681
1103 Ga0496120_0003588
1104 Ga0496121_0004930
1105 Ga0496121_0058851
1106 Ga0496124_0171011
1107 Ga0496125_0051208
1108 Ga0501031_0005468
1109 Ga0501032_0005971
1110 Ga0501033_0000303
1111 Ga0501034_0005201
1112 Ga0501034_0400519
1113 Ga0501036_0001663
1114 Ga0501036_0366429
1115 Ga0501037_0000268
1116 Ga0501038_0000245
1117 Ga0501039_0022732
1118 Ga0501040_0017656
1119 Ga0501042_0006014
1120 Ga0501042_0016714
1121 Ga0501042_0027972
1122 Ga0501042_0055644
1123 Ga0501043_0002081
1124 Ga0501043_0063927
1125 Ga0501046_0000162
1126 Ga0501046_0150576
1127 Ga0501047_0000263
1128 Ga0501047_0408912
1129 Ga0501048_0000118
1130 Ga0501048_0135663
1131 Ga0501067_0080184
1132 Ga0501068_0005576
1133 Ga0501068_0180403
1134 Ga0501069_0086339
1135 Ga0501070_0001887
1136 Ga0501070_0098829
1137 Ga0501070_0166227
1138 Ga0501071_0086748
1139 Ga0501071_0445316
1140 Ga0501072_0188750
1141 Ga0501072_0188845
1142 Ga0501073_0002399
1143 Ga0501074_0008502
1144 Ga0501074_0025353
1145 Ga0501075_0001131
1146 Ga0501076_0121145
1147 Ga0501079_0008388
1148 Ga0501079_0110229
1149 Ga0501080_0021195
1150 Ga0501080_0144702
1151 Ga0501083_0000642
1152 Ga0501083_0111467
1153 Ga0501035_0000391
1154 Ga0501044_0003076
1155 Ga0501044_0118120
1156 Ga0501045_0009652
1157 Ga0501045_0403659
1158 nmdc:mga0yw44_164172_c1
1159 nmdc:mga05p37_414171_c1
1160 nmdc:mga05p37_9111_c1
1161 nmdc:mga09592_244718_c1
1162 nmdc:mga09592_390930_c1
1163 nmdc:mga09592_5535_c1
1164 nmdc:mga09592_78803_c1
1165 nmdc:mga0qj67_218211_c1
1166 nmdc:mga0qj67_443137_c1
1167 nmdc:mga06r32_98370_c1
1168 nmdc:mga08y16_182432_c1
1169 nmdc:mga08y16_37454_c1
1170 nmdc:mga08y16_486345_c1
1171 nmdc:mga0n895_231944_c1
1172 nmdc:mga0n895_328145_c1
1173 nmdc:mga08x19_24966_c1
1174 nmdc:mga0a205_11_c1
1175 nmdc:mga0a205_3884_c1
1176 Ga0495601_0000039
1177 Ga0495601_0000126
1178 Ga0495601_0013506
1179 Ga0495601_0027905
1180 Ga0495612_0000195
1181 Ga0495612_0018908
1182 Ga0495655_0022713
1183 Ga0495595_0000014
1184 Ga0495595_0000151
1185 Ga0495619_0000114
1186 Ga0495619_0000135
1187 Ga0495619_0000243
1188 Ga0495619_0002645
1189 Ga0495619_0006342
1190 Ga0495619_0066017
1191 Ga0495619_0127959
1192 Ga0495619_0384440
1193 Ga0500641_0016841
1194 Ga0500614_000984
1195 Ga0501084_0177037
1196 Ga0501082_0010537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

55

142

0.92

PF13649

Methyltransf_25

Methyltransferase domain

54

140

0.9

PF13847

Methyltransf_31

Methyltransferase domain

49

144

0.87

PF08242

Methyltransf_12

Methyltransferase domain

55

142

0.84

PF13489

Methyltransf_23

Methyltransferase domain

32

211

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8698 52 151
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8682 52 151
6uk5-assembly1.cif.gz_B structure of sam bound cals10, an amino pentose methyltransferase from micromonospora echinaspora involved in calicheamicin biosynthesis 0.8335 32 145
1ve3-assembly2.cif.gz_B-2 crystal structure of ph0226 protein from pyrococcus horikoshii ot3 0.8284 31 150
2nxc-assembly1.cif.gz_A apo-form of t. thermophilus ribosomal protein l11 methyltransferase (prma) 0.8102 42 146
ID Description Score Start End Superfamily
af_P9WJZ1_37_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9247 26 182 3.40.50.150
af_Q54LN8_1_115_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8871 108 145 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8869 53 105 3.40.50.150
af_A4I5Q9_225_346_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8854 38 114 3.40.50.150
af_P9WJZ1_37_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8715 26 182 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H6FHR3-F1-model_v4 Methyltransferase domain-containing protein 0.9939 7 251 GO:0008168
GO:0032259
AF-A0A1H6FHR3-F1-model_v4 Methyltransferase domain-containing protein 0.9819 7 251 GO:0008168
GO:0032259
AF-A0A847ID86-F1-model_v4 Class I SAM-dependent methyltransferase 0.9292 17 149 GO:0008757
GO:0032259
AF-R4MHU8-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9269 17 202 GO:0008757
AF-A0A7V4X8U6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9112 17 253 GO:0008168
GO:0032259

Map