F467772
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 285 | 1196 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100092670|Ga0075430_1000926705 |
| Length | 123 |
| Sequence | MTADPAVPAGDPFGALGDAHRRQIVTLIADGPRSVRELADELPISRPAVSRHLRLLKEAGLVGEEPEGTRRIYRLRREGVEAMQAYLQQVWGDAAARFRLVAENTTPDPAGSDTESDSTELQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 169 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 170 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 171 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 172 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 173 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 174 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 175 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 176 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 177 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 178 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 266 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 279 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 280 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 283 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.01 |
| Nodule | 0 |
| Rhizoplane | 3.01 |
| Rhizosphere | 92.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075430_100092670 | 3300006846 | Bacteria | 2526 |
| 2 | JGI24735J21928_10090167 | 3300002067 | Bacteria | 879 |
| 3 | rootL2_10164362 | 3300003322 | Bacteria | 1300 |
| 4 | JGI25407J50210_10040800 | 3300003373 | Bacteria | 1189 |
| 5 | JGI25407J50210_10084073 | 3300003373 | Bacteria | 790 |
| 6 | Ga0070676_10752843 | 3300005328 | Bacteria | 715 |
| 7 | Ga0070683_101735145 | 3300005329 | Bacteria | 600 |
| 8 | Ga0070683_102242672 | 3300005329 | Bacteria | 524 |
| 9 | Ga0070670_100066237 | 3300005331 | Bacteria | 3099 |
| 10 | Ga0068869_100320902 | 3300005334 | Bacteria | 1256 |
| 11 | Ga0070682_100341999 | 3300005337 | Bacteria | 1112 |
| 12 | Ga0068868_100017489 | 3300005338 | Bacteria | 5344 |
| 13 | Ga0068868_101130132 | 3300005338 | Unclassified | 722 |
| 14 | Ga0070660_100020138 | 3300005339 | Bacteria | 4899 |
| 15 | Ga0070691_10099270 | 3300005341 | Bacteria | 1444 |
| 16 | Ga0070691_10395433 | 3300005341 | Bacteria | 778 |
| 17 | Ga0070687_100554469 | 3300005343 | Unclassified | 782 |
| 18 | Ga0070661_100098332 | 3300005344 | Bacteria | 2174 |
| 19 | Ga0070692_10313260 | 3300005345 | Bacteria | 962 |
| 20 | Ga0070669_100123282 | 3300005353 | Bacteria | 1980 |
| 21 | Ga0070675_100005116 | 3300005354 | Bacteria | 10005 |
| 22 | Ga0070671_101656798 | 3300005355 | Bacteria | 567 |
| 23 | Ga0070674_100958503 | 3300005356 | Bacteria | 748 |
| 24 | Ga0070659_100511797 | 3300005366 | Bacteria | 1024 |
| 25 | Ga0070709_10020516 | 3300005434 | Bacteria | 3834 |
| 26 | Ga0070714_100132747 | 3300005435 | Bacteria | 2226 |
| 27 | Ga0070714_100192175 | 3300005435 | Bacteria | 1863 |
| 28 | Ga0070714_101715151 | 3300005435 | Unclassified | 613 |
| 29 | Ga0070713_100206298 | 3300005436 | Bacteria | 1777 |
| 30 | Ga0070713_100498536 | 3300005436 | Bacteria | 1149 |
| 31 | Ga0070713_100528998 | 3300005436 | Bacteria | 1115 |
| 32 | Ga0070713_100699513 | 3300005436 | Bacteria | 967 |
| 33 | Ga0070710_10036380 | 3300005437 | Bacteria | 2691 |
| 34 | Ga0070710_10082703 | 3300005437 | Bacteria | 1877 |
| 35 | Ga0070710_10378870 | 3300005437 | Bacteria | 943 |
| 36 | Ga0070701_11246566 | 3300005438 | Bacteria | 529 |
| 37 | Ga0070711_100024566 | 3300005439 | Bacteria | 3932 |
| 38 | Ga0070711_100066219 | 3300005439 | Bacteria | 2530 |
| 39 | Ga0070694_101701957 | 3300005444 | Unclassified | 536 |
| 40 | Ga0070708_100523421 | 3300005445 | Bacteria | 1118 |
| 41 | Ga0070708_101066913 | 3300005445 | Bacteria | 757 |
| 42 | Ga0070663_100053682 | 3300005455 | Bacteria | 2878 |
| 43 | Ga0070678_100139955 | 3300005456 | Bacteria | 1935 |
| 44 | Ga0070678_101054797 | 3300005456 | Bacteria | 749 |
| 45 | Ga0070662_100010177 | 3300005457 | Bacteria | 6165 |
| 46 | Ga0070681_11384176 | 3300005458 | Bacteria | 627 |
| 47 | Ga0070706_100634704 | 3300005467 | Bacteria | 992 |
| 48 | Ga0070707_100032907 | 3300005468 | Bacteria | 4940 |
| 49 | Ga0070707_100333865 | 3300005468 | Bacteria | 1473 |
| 50 | Ga0070698_100560557 | 3300005471 | Bacteria | 1082 |
| 51 | Ga0070699_100004196 | 3300005518 | Bacteria | 12751 |
| 52 | Ga0070684_100035795 | 3300005535 | Bacteria | 4251 |
| 53 | Ga0070684_100539304 | 3300005535 | Bacteria | 1082 |
| 54 | Ga0070684_101679122 | 3300005535 | Bacteria | 599 |
| 55 | Ga0070686_100947256 | 3300005544 | Bacteria | 703 |
| 56 | Ga0070696_100320146 | 3300005546 | Bacteria | 1193 |
| 57 | Ga0070693_101415244 | 3300005547 | Unclassified | 541 |
| 58 | Ga0070665_101184584 | 3300005548 | Bacteria | 775 |
| 59 | Ga0070665_101224374 | 3300005548 | Unclassified | 761 |
| 60 | Ga0070665_102352295 | 3300005548 | Unclassified | 535 |
| 61 | Ga0068855_101779795 | 3300005563 | Bacteria | 626 |
| 62 | Ga0070664_100003607 | 3300005564 | Bacteria | 12469 |
| 63 | Ga0070664_100659162 | 3300005564 | Bacteria | 973 |
| 64 | Ga0070664_101146553 | 3300005564 | Bacteria | 733 |
| 65 | Ga0068857_100010543 | 3300005577 | Bacteria | 8034 |
| 66 | Ga0068854_100303156 | 3300005578 | Bacteria | 1293 |
| 67 | Ga0068856_100283314 | 3300005614 | Bacteria | 1674 |
| 68 | Ga0070702_100037710 | 3300005615 | Bacteria | 2685 |
| 69 | Ga0070702_100985149 | 3300005615 | Bacteria | 666 |
| 70 | Ga0068852_100892224 | 3300005616 | Bacteria | 906 |
| 71 | Ga0068852_101158270 | 3300005616 | Bacteria | 794 |
| 72 | Ga0068859_100434232 | 3300005617 | Bacteria | 1409 |
| 73 | Ga0068864_100206979 | 3300005618 | Bacteria | 1805 |
| 74 | Ga0068861_100604567 | 3300005719 | Bacteria | 1007 |
| 75 | Ga0068863_100228185 | 3300005841 | Bacteria | 1795 |
| 76 | Ga0068863_102581873 | 3300005841 | Bacteria | 517 |
| 77 | Ga0068858_100021295 | 3300005842 | Bacteria | 6055 |
| 78 | Ga0068858_100078913 | 3300005842 | Bacteria | 3059 |
| 79 | Ga0068860_100471504 | 3300005843 | Bacteria | 1250 |
| 80 | Ga0068862_101143294 | 3300005844 | Bacteria | 775 |
| 81 | Ga0081455_10112024 | 3300005937 | Bacteria | 2167 |
| 82 | Ga0081455_10343453 | 3300005937 | Bacteria | 1055 |
| 83 | Ga0081455_10408656 | 3300005937 | Bacteria | 940 |
| 84 | Ga0081538_10022862 | 3300005981 | Bacteria | 4513 |
| 85 | Ga0081538_10024593 | 3300005981 | Bacteria | 4286 |
| 86 | Ga0081538_10025060 | 3300005981 | Bacteria | 4224 |
| 87 | Ga0081538_10039732 | 3300005981 | Bacteria | 3012 |
| 88 | Ga0081540_1004915 | 3300005983 | Bacteria | 10063 |
| 89 | Ga0081539_10002046 | 3300005985 | Bacteria | 30317 |
| 90 | Ga0070717_10121118 | 3300006028 | Bacteria | 2241 |
| 91 | Ga0070717_10281719 | 3300006028 | Bacteria | 1474 |
| 92 | Ga0070717_10336878 | 3300006028 | Bacteria | 1346 |
| 93 | Ga0075365_10268486 | 3300006038 | Unclassified | 1200 |
| 94 | Ga0075364_10413783 | 3300006051 | Bacteria | 920 |
| 95 | Ga0070715_10071700 | 3300006163 | Bacteria | 1549 |
| 96 | Ga0070715_10085499 | 3300006163 | Bacteria | 1441 |
| 97 | Ga0070715_10375693 | 3300006163 | Unclassified | 783 |
| 98 | Ga0070716_100026965 | 3300006173 | Bacteria | 3081 |
| 99 | Ga0070716_100134183 | 3300006173 | Bacteria | 1569 |
| 100 | Ga0070712_100790910 | 3300006175 | Unclassified | 813 |
| 101 | Ga0075367_10493257 | 3300006178 | Bacteria | 777 |
| 102 | Ga0097621_100535019 | 3300006237 | Bacteria | 1065 |
| 103 | Ga0097621_100573390 | 3300006237 | Unclassified | 1029 |
| 104 | Ga0068871_100498986 | 3300006358 | Bacteria | 1097 |
| 105 | Ga0075430_100219032 | 3300006846 | Bacteria | 1579 |
| 106 | Ga0075431_100351972 | 3300006847 | Bacteria | 1481 |
| 107 | Ga0075431_100555623 | 3300006847 | Bacteria | 1135 |
| 108 | Ga0075433_10746401 | 3300006852 | Bacteria | 856 |
| 109 | Ga0075434_102323502 | 3300006871 | Unclassified | 539 |
| 110 | Ga0075429_100517588 | 3300006880 | Bacteria | 1045 |
| 111 | Ga0068865_100146168 | 3300006881 | Bacteria | 1788 |
| 112 | Ga0068865_100485791 | 3300006881 | Bacteria | 1027 |
| 113 | Ga0075436_100606396 | 3300006914 | Bacteria | 807 |
| 114 | Ga0097620_100434247 | 3300006931 | Bacteria | 1409 |
| 115 | Ga0075435_100188385 | 3300007076 | Bacteria | 1745 |
| 116 | Ga0105240_11403776 | 3300009093 | Bacteria | 734 |
| 117 | Ga0111539_10034656 | 3300009094 | Bacteria | 6117 |
| 118 | Ga0111539_10126683 | 3300009094 | Bacteria | 2991 |
| 119 | Ga0105245_10006478 | 3300009098 | Bacteria | 10294 |
| 120 | Ga0105245_10203894 | 3300009098 | Bacteria | 1901 |
| 121 | Ga0114129_10373616 | 3300009147 | Bacteria | 1884 |
| 122 | Ga0105243_10255226 | 3300009148 | Bacteria | 1567 |
| 123 | Ga0105248_13452838 | 3300009177 | Bacteria | 502 |
| 124 | Ga0105237_10360579 | 3300009545 | Bacteria | 1458 |
| 125 | Ga0105238_10129984 | 3300009551 | Bacteria | 2496 |
| 126 | Ga0105238_10484555 | 3300009551 | Bacteria | 1236 |
| 127 | Ga0105249_10069890 | 3300009553 | Bacteria | 3241 |
| 128 | Ga0105249_10343465 | 3300009553 | Bacteria | 1510 |
| 129 | Ga0105249_11547899 | 3300009553 | Bacteria | 735 |
| 130 | Ga0105239_10060179 | 3300010375 | Bacteria | 4168 |
| 131 | Ga0105239_10377299 | 3300010375 | Bacteria | 1603 |
| 132 | Ga0105239_11777320 | 3300010375 | Bacteria | 714 |
| 133 | Ga0105246_10085742 | 3300011119 | Bacteria | 2256 |
| 134 | Ga0157370_10029499 | 3300013104 | Bacteria | 5381 |
| 135 | Ga0157374_10112243 | 3300013296 | Bacteria | 2623 |
| 136 | Ga0163162_10074199 | 3300013306 | Bacteria | 3460 |
| 137 | Ga0157375_10144301 | 3300013308 | Bacteria | 2510 |
| 138 | Ga0157375_12921787 | 3300013308 | Bacteria | 571 |
| 139 | Ga0163163_10017651 | 3300014325 | Bacteria | 6662 |
| 140 | Ga0157380_12664761 | 3300014326 | Bacteria | 566 |
| 141 | Ga0157377_10001627 | 3300014745 | Bacteria | 9785 |
| 142 | Ga0157377_10464181 | 3300014745 | Bacteria | 877 |
| 143 | Ga0157379_10015275 | 3300014968 | Bacteria | 6734 |
| 144 | Ga0157376_10115726 | 3300014969 | Bacteria | 2368 |
| 145 | Ga0213874_10005600 | 3300021377 | Unclassified | 2936 |
| 146 | Ga0213876_10027510 | 3300021384 | Unclassified | 3000 |
| 147 | Ga0213876_10330606 | 3300021384 | Unclassified | 810 |
| 148 | Ga0213876_10437375 | 3300021384 | Unclassified | 696 |
| 149 | Ga0224712_10069960 | 3300022467 | Bacteria | 1422 |
| 150 | Ga0207692_10045864 | 3300025898 | Bacteria | 2189 |
| 151 | Ga0207692_10102159 | 3300025898 | Bacteria | 1576 |
| 152 | Ga0207688_10076834 | 3300025901 | Bacteria | 1902 |
| 153 | Ga0207685_10263936 | 3300025905 | Unclassified | 838 |
| 154 | Ga0207685_10285870 | 3300025905 | Bacteria | 811 |
| 155 | Ga0207699_10106384 | 3300025906 | Bacteria | 1790 |
| 156 | Ga0207699_11282480 | 3300025906 | Bacteria | 542 |
| 157 | Ga0207645_10659250 | 3300025907 | Bacteria | 711 |
| 158 | Ga0207671_10136797 | 3300025914 | Bacteria | 1884 |
| 159 | Ga0207671_10545329 | 3300025914 | Bacteria | 924 |
| 160 | Ga0207693_10002068 | 3300025915 | Bacteria | 17538 |
| 161 | Ga0207693_10060050 | 3300025915 | Bacteria | 2979 |
| 162 | Ga0207663_10024634 | 3300025916 | Bacteria | 3467 |
| 163 | Ga0207663_10098461 | 3300025916 | Bacteria | 1958 |
| 164 | Ga0207663_10245863 | 3300025916 | Bacteria | 1314 |
| 165 | Ga0207662_10873254 | 3300025918 | Unclassified | 636 |
| 166 | Ga0207657_10026044 | 3300025919 | Bacteria | 5382 |
| 167 | Ga0207657_11252035 | 3300025919 | Bacteria | 562 |
| 168 | Ga0207649_10007609 | 3300025920 | Bacteria | 5891 |
| 169 | Ga0207646_10077418 | 3300025922 | Bacteria | 2972 |
| 170 | Ga0207646_10492988 | 3300025922 | Bacteria | 1104 |
| 171 | Ga0207681_10584115 | 3300025923 | Bacteria | 922 |
| 172 | Ga0207694_10057901 | 3300025924 | Bacteria | 3014 |
| 173 | Ga0207694_10328122 | 3300025924 | Bacteria | 1264 |
| 174 | Ga0207650_10131987 | 3300025925 | Bacteria | 1955 |
| 175 | Ga0207659_10020891 | 3300025926 | Bacteria | 4336 |
| 176 | Ga0207687_10098744 | 3300025927 | Bacteria | 2144 |
| 177 | Ga0207700_10021782 | 3300025928 | Bacteria | 4383 |
| 178 | Ga0207700_10106097 | 3300025928 | Bacteria | 2251 |
| 179 | Ga0207700_10126339 | 3300025928 | Bacteria | 2081 |
| 180 | Ga0207700_11529506 | 3300025928 | Bacteria | 592 |
| 181 | Ga0207664_10006223 | 3300025929 | Bacteria | 8197 |
| 182 | Ga0207664_10298697 | 3300025929 | Bacteria | 1416 |
| 183 | Ga0207664_10336201 | 3300025929 | Unclassified | 1335 |
| 184 | Ga0207664_11665116 | 3300025929 | Bacteria | 560 |
| 185 | Ga0207690_10473745 | 3300025932 | Bacteria | 1010 |
| 186 | Ga0207690_10498776 | 3300025932 | Bacteria | 984 |
| 187 | Ga0207706_10019591 | 3300025933 | Bacteria | 6086 |
| 188 | Ga0207709_10460083 | 3300025935 | Unclassified | 985 |
| 189 | Ga0207704_10238742 | 3300025938 | Bacteria | 1356 |
| 190 | Ga0207704_10611595 | 3300025938 | Bacteria | 893 |
| 191 | Ga0207665_10026207 | 3300025939 | Bacteria | 3848 |
| 192 | Ga0207665_10069811 | 3300025939 | Bacteria | 2396 |
| 193 | Ga0207665_10185519 | 3300025939 | Bacteria | 1509 |
| 194 | Ga0207689_10668574 | 3300025942 | Bacteria | 875 |
| 195 | Ga0207661_10197315 | 3300025944 | Bacteria | 1768 |
| 196 | Ga0207661_11644476 | 3300025944 | Bacteria | 587 |
| 197 | Ga0207679_10060279 | 3300025945 | Bacteria | 2819 |
| 198 | Ga0207667_11626659 | 3300025949 | Bacteria | 614 |
| 199 | Ga0207712_11836282 | 3300025961 | Unclassified | 543 |
| 200 | Ga0207668_10049614 | 3300025972 | Bacteria | 2887 |
| 201 | Ga0207677_10026802 | 3300026023 | Bacteria | 3620 |
| 202 | Ga0207677_10101520 | 3300026023 | Bacteria | 2118 |
| 203 | Ga0207703_10062117 | 3300026035 | Bacteria | 3060 |
| 204 | Ga0207703_10462015 | 3300026035 | Bacteria | 1187 |
| 205 | Ga0207678_10044634 | 3300026067 | Bacteria | 3833 |
| 206 | Ga0207708_10057409 | 3300026075 | Bacteria | 2969 |
| 207 | Ga0207702_10049082 | 3300026078 | Bacteria | 3561 |
| 208 | Ga0207702_10409792 | 3300026078 | Bacteria | 1309 |
| 209 | Ga0207702_11273100 | 3300026078 | Unclassified | 729 |
| 210 | Ga0207641_10166501 | 3300026088 | Bacteria | 2008 |
| 211 | Ga0207641_11140480 | 3300026088 | Bacteria | 779 |
| 212 | Ga0207674_10009169 | 3300026116 | Bacteria | 11347 |
| 213 | Ga0207674_10111927 | 3300026116 | Bacteria | 2704 |
| 214 | Ga0207675_100319889 | 3300026118 | Bacteria | 1514 |
| 215 | Ga0207675_101307656 | 3300026118 | Bacteria | 745 |
| 216 | Ga0207683_10149481 | 3300026121 | Bacteria | 2107 |
| 217 | Ga0207683_10729758 | 3300026121 | Bacteria | 919 |
| 218 | Ga0207698_10589919 | 3300026142 | Bacteria | 1094 |
| 219 | Ga0207698_12075444 | 3300026142 | Bacteria | 582 |
| 220 | Ga0207428_10063899 | 3300027907 | Bacteria | 2907 |
| 221 | Ga0268265_10087568 | 3300028380 | Bacteria | 2478 |
| 222 | Ga0268264_10628758 | 3300028381 | Bacteria | 1060 |
| 223 | Ga0265318_10180995 | 3300028577 | Bacteria | 772 |
| 224 | Ga0307515_10135846 | 3300028794 | Bacteria | 2675 |
| 225 | Ga0265327_10006202 | 3300031251 | Bacteria | 9642 |
| 226 | Ga0307408_100095274 | 3300031548 | Bacteria | 2256 |
| 227 | Ga0307405_10048483 | 3300031731 | Bacteria | 2620 |
| 228 | Ga0307405_10166497 | 3300031731 | Bacteria | 1567 |
| 229 | Ga0307410_10034701 | 3300031852 | Bacteria | 3270 |
| 230 | Ga0307410_11292616 | 3300031852 | Bacteria | 638 |
| 231 | Ga0307406_10122542 | 3300031901 | Bacteria | 1810 |
| 232 | Ga0307407_10939337 | 3300031903 | Bacteria | 665 |
| 233 | Ga0307409_100158432 | 3300031995 | Bacteria | 1976 |
| 234 | Ga0307409_100384587 | 3300031995 | Bacteria | 1335 |
| 235 | Ga0307409_100618935 | 3300031995 | Bacteria | 1072 |
| 236 | Ga0307409_100850976 | 3300031995 | Bacteria | 923 |
| 237 | Ga0307409_101692776 | 3300031995 | Bacteria | 661 |
| 238 | Ga0307416_100038565 | 3300032002 | Bacteria | 3687 |
| 239 | Ga0307416_100788219 | 3300032002 | Bacteria | 1045 |
| 240 | Ga0307414_10432291 | 3300032004 | Bacteria | 1150 |
| 241 | Ga0307411_10020850 | 3300032005 | Bacteria | 3822 |
| 242 | Ga0307415_100496992 | 3300032126 | Bacteria | 1065 |
| 243 | Ga0373923_0112104 | 3300035111 | Unclassified | 1212 |
| 244 | Ga0373953_0047555 | 3300035117 | Bacteria | 1726 |
| 245 | Ga0373953_0093788 | 3300035117 | Unclassified | 1258 |
| 246 | Ga0373954_0036556 | 3300035118 | Bacteria | 2280 |
| 247 | Ga0373954_0056334 | 3300035118 | Bacteria | 1850 |
| 248 | Ga0373956_0104246 | 3300035119 | Unclassified | 1318 |
| 249 | Ga0373956_0545988 | 3300035119 | Bacteria | 553 |
| 250 | Ga0373957_0106122 | 3300035120 | Bacteria | 1128 |
| 251 | Ga0373955_0149872 | 3300035172 | Bacteria | 1372 |
| 252 | Ga0373955_0847975 | 3300035172 | Unclassified | 562 |
| 253 | Ga0373935_0179913 | 3300035692 | Bacteria | 1451 |
| 254 | Ga0373947_0141289 | 3300035725 | Bacteria | 1544 |
| 255 | Ga0373947_0464252 | 3300035725 | Bacteria | 858 |
| 256 | Ga0373937_0230207 | 3300036401 | Bacteria | 1745 |
| 257 | Ga0373937_0236767 | 3300036401 | Unclassified | 1719 |
| 258 | Ga0373925_0122767 | 3300037068 | Bacteria | 2018 |
| 259 | Ga0373925_0297920 | 3300037068 | Bacteria | 1301 |
| 260 | Ga0373925_0686366 | 3300037068 | Bacteria | 844 |
| 261 | Ga0436364_0642729 | 3300037853 | Bacteria | 2333 |
| 262 | Ga0436365_0095687 | 3300039437 | Unclassified | 1601 |
| 263 | Ga0436365_0452435 | 3300039437 | Unclassified | 844 |
| 264 | Ga0436365_0959978 | 3300039437 | Unclassified | 800 |
| 265 | Ga0436365_1086149 | 3300039437 | Bacteria | 5415 |
| 266 | Ga0436365_1417417 | 3300039437 | Bacteria | 5482 |
| 267 | Ga0436365_1816999 | 3300039437 | Bacteria | 3024 |
| 268 | Ga0436363_0964834 | 3300039450 | Bacteria | 907 |
| 269 | Ga0436363_1313035 | 3300039450 | Bacteria | 882 |
| 270 | Ga0436363_1674390 | 3300039450 | Bacteria | 51173 |
| 271 | Ga0436362_0727121 | 3300039453 | Bacteria | 651 |
| 272 | Ga0436362_1159380 | 3300039453 | Unclassified | 642 |
| 273 | Ga0436362_1185108 | 3300039453 | Bacteria | 1079 |
| 274 | Ga0439465_0180920 | 3300041413 | Bacteria | 763 |
| 275 | Ga0451839_0858136 | 3300041496 | Bacteria | 527 |
| 276 | Ga0439448_0023130 | 3300042005 | Bacteria | 1936 |
| 277 | Ga0439448_0055511 | 3300042005 | Bacteria | 1303 |
| 278 | Ga0439455_0043765 | 3300042012 | Bacteria | 1154 |
| 279 | Ga0439463_035966 | 3300042016 | Bacteria | 1254 |
| 280 | Ga0439463_123789 | 3300042016 | Bacteria | 668 |
| 281 | Ga0450888_020187 | 3300042126 | Bacteria | 845 |
| 282 | Ga0439444_0006932 | 3300042437 | Bacteria | 1726 |
| 283 | Ga0439460_0033417 | 3300042461 | Bacteria | 1477 |
| 284 | Ga0439440_0008226 | 3300042993 | Bacteria | 2137 |
| 285 | Ga0466970_0551777 | 3300044765 | Unclassified | 666 |
| 286 | Ga0466967_0062726 | 3300045976 | Bacteria | 3300 |
| 287 | Ga0466967_0729842 | 3300045976 | Bacteria | 982 |
| 288 | Ga0466967_2484235 | 3300045976 | Bacteria | 513 |
| 289 | Ga0495592_0557013 | 3300046454 | Unclassified | 704 |
| 290 | Ga0495603_0178511 | 3300046455 | Bacteria | 1229 |
| 291 | Ga0495629_0253656 | 3300046459 | Bacteria | 1210 |
| 292 | Ga0495641_0112324 | 3300046461 | Bacteria | 1216 |
| 293 | Ga0495641_0233590 | 3300046461 | Bacteria | 825 |
| 294 | Ga0495651_0002129 | 3300046462 | Bacteria | 15315 |
| 295 | Ga0495651_0010390 | 3300046462 | Bacteria | 7152 |
| 296 | Ga0495580_1052638 | 3300046472 | Archaea | 517 |
| 297 | Ga0495639_0219952 | 3300046475 | Bacteria | 933 |
| 298 | Ga0495662_0276850 | 3300046476 | Unclassified | 826 |
| 299 | Ga0495664_0099518 | 3300046477 | Bacteria | 1751 |
| 300 | Ga0495608_0001555 | 3300046511 | Bacteria | 16384 |
| 301 | Ga0495608_0048233 | 3300046511 | Bacteria | 2830 |
| 302 | Ga0495608_0778478 | 3300046511 | Bacteria | 566 |
| 303 | Ga0495618_0003152 | 3300046514 | Bacteria | 10359 |
| 304 | Ga0495618_0007832 | 3300046514 | Bacteria | 6466 |
| 305 | Ga0495628_0197228 | 3300046516 | Unclassified | 1518 |
| 306 | Ga0495628_0200255 | 3300046516 | Archaea | 1505 |
| 307 | Ga0495628_0434178 | 3300046516 | Bacteria | 955 |
| 308 | Ga0495630_0077414 | 3300046517 | Bacteria | 2507 |
| 309 | Ga0495652_0036115 | 3300046529 | Bacteria | 4298 |
| 310 | Ga0495640_0035323 | 3300046533 | Bacteria | 3538 |
| 311 | Ga0495640_0189374 | 3300046533 | Bacteria | 1308 |
| 312 | Ga0495586_0383882 | 3300046535 | Bacteria | 808 |
| 313 | Ga0495587_0002344 | 3300046536 | Bacteria | 12656 |
| 314 | Ga0495587_0051259 | 3300046536 | Bacteria | 2440 |
| 315 | Ga0495587_0366596 | 3300046536 | Bacteria | 802 |
| 316 | Ga0495645_0097350 | 3300046543 | Bacteria | 2095 |
| 317 | Ga0495645_0136440 | 3300046543 | Bacteria | 1716 |
| 318 | Ga0495667_0001230 | 3300046559 | Bacteria | 16761 |
| 319 | Ga0495667_0001423 | 3300046559 | Bacteria | 15747 |
| 320 | Ga0495634_0015412 | 3300046642 | Bacteria | 5494 |
| 321 | Ga0495634_0059596 | 3300046642 | Bacteria | 2542 |
| 322 | Ga0495625_0398161 | 3300046660 | Bacteria | 861 |
| 323 | Ga0495635_0015542 | 3300046663 | Bacteria | 5320 |
| 324 | Ga0495635_0023911 | 3300046663 | Bacteria | 4258 |
| 325 | Ga0495635_0193851 | 3300046663 | Archaea | 1379 |
| 326 | Ga0495635_0719132 | 3300046663 | Bacteria | 647 |
| 327 | Ga0495657_0034713 | 3300046675 | Bacteria | 3500 |
| 328 | Ga0495599_0004753 | 3300046678 | Bacteria | 8072 |
| 329 | Ga0495599_0092400 | 3300046678 | Unclassified | 1888 |
| 330 | Ga0495599_0869982 | 3300046678 | Bacteria | 512 |
| 331 | Ga0495623_0037709 | 3300046679 | Bacteria | 3091 |
| 332 | Ga0495623_0038888 | 3300046679 | Bacteria | 3041 |
| 333 | Ga0495646_0010659 | 3300046680 | Bacteria | 5839 |
| 334 | Ga0495646_0120901 | 3300046680 | Unclassified | 1482 |
| 335 | Ga0495658_0184369 | 3300046683 | Bacteria | 1296 |
| 336 | Ga0495658_0403387 | 3300046683 | Unclassified | 872 |
| 337 | Ga0495613_0062666 | 3300046689 | Bacteria | 2721 |
| 338 | Ga0495613_0148447 | 3300046689 | Bacteria | 1673 |
| 339 | Ga0495624_0167468 | 3300046690 | Bacteria | 1341 |
| 340 | Ga0495600_0008914 | 3300046809 | Bacteria | 6180 |
| 341 | Ga0495600_0018758 | 3300046809 | Bacteria | 4412 |
| 342 | Ga0495581_0101199 | 3300047315 | Bacteria | 1674 |
| 343 | Ga0495581_0416765 | 3300047315 | Unclassified | 783 |
| 344 | Ga0495604_0003214 | 3300047317 | Bacteria | 13057 |
| 345 | Ga0495604_0005796 | 3300047317 | Bacteria | 9801 |
| 346 | Ga0495604_0399077 | 3300047317 | Bacteria | 906 |
| 347 | Ga0495674_0007842 | 3300047319 | Bacteria | 10196 |
| 348 | Ga0495680_0011793 | 3300047322 | Bacteria | 7720 |
| 349 | Ga0495680_0012785 | 3300047322 | Bacteria | 7361 |
| 350 | Ga0495680_0224420 | 3300047322 | Archaea | 1340 |
| 351 | Ga0495680_0283696 | 3300047322 | Bacteria | 1166 |
| 352 | Ga0495675_0122064 | 3300047444 | Bacteria | 1622 |
| 353 | Ga0495684_0000775 | 3300047471 | Bacteria | 25881 |
| 354 | Ga0495684_0006759 | 3300047471 | Bacteria | 8906 |
| 355 | Ga0495593_0038916 | 3300047673 | Bacteria | 2567 |
| 356 | Ga0495602_0015688 | 3300048088 | Bacteria | 7637 |
| 357 | Ga0495602_0028686 | 3300048088 | Bacteria | 5320 |
| 358 | Ga0495602_0432802 | 3300048088 | Unclassified | 932 |
| 359 | Ga0496100_0611843 | 3300048903 | Bacteria | 847 |
| 360 | Ga0496101_1466981 | 3300048904 | Bacteria | 531 |
| 361 | Ga0496102_0788931 | 3300048905 | Unclassified | 872 |
| 362 | Ga0496104_0229730 | 3300048907 | Bacteria | 1767 |
| 363 | Ga0496104_0244691 | 3300048907 | Bacteria | 1706 |
| 364 | Ga0496105_0179036 | 3300048908 | Bacteria | 1736 |
| 365 | Ga0496108_0035032 | 3300048911 | Bacteria | 4171 |
| 366 | Ga0496108_0448898 | 3300048911 | Bacteria | 1127 |
| 367 | Ga0496108_1160613 | 3300048911 | Bacteria | 654 |
| 368 | Ga0496109_0035009 | 3300048912 | Bacteria | 4527 |
| 369 | Ga0496109_1300686 | 3300048912 | Bacteria | 663 |
| 370 | Ga0496110_0501017 | 3300048913 | Bacteria | 1106 |
| 371 | Ga0496111_0081061 | 3300048914 | Bacteria | 2369 |
| 372 | Ga0496111_0561298 | 3300048914 | Bacteria | 838 |
| 373 | Ga0496112_0639463 | 3300048915 | Bacteria | 994 |
| 374 | Ga0496113_0199847 | 3300048916 | Bacteria | 1589 |
| 375 | Ga0496114_1100443 | 3300048917 | Bacteria | 679 |
| 376 | Ga0496115_0524171 | 3300048918 | Bacteria | 950 |
| 377 | Ga0501031_0002316 | 3300049568 | Bacteria | 12062 |
| 378 | Ga0501031_0048750 | 3300049568 | Bacteria | 2760 |
| 379 | Ga0501031_0060399 | 3300049568 | Bacteria | 2470 |
| 380 | Ga0501031_0133206 | 3300049568 | Bacteria | 1624 |
| 381 | Ga0501032_0013911 | 3300049569 | Bacteria | 5709 |
| 382 | Ga0501032_0042115 | 3300049569 | Bacteria | 3099 |
| 383 | Ga0501032_0056020 | 3300049569 | Unclassified | 2651 |
| 384 | Ga0501032_0142678 | 3300049569 | Bacteria | 1577 |
| 385 | Ga0501032_0355172 | 3300049569 | Bacteria | 944 |
| 386 | Ga0501033_0044435 | 3300049570 | Bacteria | 3307 |
| 387 | Ga0501033_0057873 | 3300049570 | Bacteria | 2864 |
| 388 | Ga0501034_0189738 | 3300049571 | Bacteria | 2018 |
| 389 | Ga0501034_0454846 | 3300049571 | Bacteria | 1198 |
| 390 | Ga0501036_0001001 | 3300049572 | Bacteria | 21361 |
| 391 | Ga0501036_0007003 | 3300049572 | Bacteria | 9178 |
| 392 | Ga0501036_0007942 | 3300049572 | Bacteria | 8683 |
| 393 | Ga0501036_0031655 | 3300049572 | Bacteria | 4471 |
| 394 | Ga0501036_0146489 | 3300049572 | Bacteria | 1992 |
| 395 | Ga0501036_0157486 | 3300049572 | Bacteria | 1915 |
| 396 | Ga0501036_0179766 | 3300049572 | Bacteria | 1781 |
| 397 | Ga0501037_0022426 | 3300049573 | Bacteria | 4671 |
| 398 | Ga0501037_0083911 | 3300049573 | Unclassified | 2308 |
| 399 | Ga0501037_0091022 | 3300049573 | Bacteria | 2206 |
| 400 | Ga0501037_0320242 | 3300049573 | Unclassified | 1074 |
| 401 | Ga0501037_0679875 | 3300049573 | Bacteria | 686 |
| 402 | Ga0501038_0003890 | 3300049574 | Bacteria | 13883 |
| 403 | Ga0501038_0016112 | 3300049574 | Bacteria | 6784 |
| 404 | Ga0501038_0030362 | 3300049574 | Bacteria | 4784 |
| 405 | Ga0501038_0142199 | 3300049574 | Bacteria | 1962 |
| 406 | Ga0501038_0171023 | 3300049574 | Bacteria | 1759 |
| 407 | Ga0501038_0224865 | 3300049574 | Bacteria | 1496 |
| 408 | Ga0501038_0862459 | 3300049574 | Bacteria | 670 |
| 409 | Ga0501038_0883859 | 3300049574 | Bacteria | 660 |
| 410 | Ga0501038_1319913 | 3300049574 | Bacteria | 520 |
| 411 | Ga0501039_0006320 | 3300049575 | Bacteria | 8994 |
| 412 | Ga0501039_0015299 | 3300049575 | Bacteria | 5872 |
| 413 | Ga0501039_0027830 | 3300049575 | Bacteria | 4347 |
| 414 | Ga0501039_0028687 | 3300049575 | Bacteria | 4285 |
| 415 | Ga0501039_0050029 | 3300049575 | Bacteria | 3232 |
| 416 | Ga0501039_0221006 | 3300049575 | Unclassified | 1489 |
| 417 | Ga0501039_0748889 | 3300049575 | Bacteria | 763 |
| 418 | Ga0501039_1108324 | 3300049575 | Bacteria | 613 |
| 419 | Ga0501040_0001230 | 3300049576 | Bacteria | 16284 |
| 420 | Ga0501040_0002734 | 3300049576 | Bacteria | 11360 |
| 421 | Ga0501040_0008178 | 3300049576 | Bacteria | 6800 |
| 422 | Ga0501040_0076409 | 3300049576 | Unclassified | 2315 |
| 423 | Ga0501040_0089248 | 3300049576 | Bacteria | 2142 |
| 424 | Ga0501040_0101981 | 3300049576 | Unclassified | 2002 |
| 425 | Ga0501040_0203594 | 3300049576 | Bacteria | 1406 |
| 426 | Ga0501040_0549949 | 3300049576 | Bacteria | 833 |
| 427 | Ga0501041_0001967 | 3300049577 | Bacteria | 11553 |
| 428 | Ga0501041_0005525 | 3300049577 | Bacteria | 7396 |
| 429 | Ga0501041_0025859 | 3300049577 | Bacteria | 3529 |
| 430 | Ga0501041_0056620 | 3300049577 | Bacteria | 2396 |
| 431 | Ga0501041_0149264 | 3300049577 | Bacteria | 1459 |
| 432 | Ga0501041_0327247 | 3300049577 | Bacteria | 967 |
| 433 | Ga0501042_0007393 | 3300049578 | Bacteria | 7193 |
| 434 | Ga0501042_0009114 | 3300049578 | Bacteria | 6596 |
| 435 | Ga0501042_0009725 | 3300049578 | Bacteria | 6422 |
| 436 | Ga0501042_0018338 | 3300049578 | Bacteria | 4843 |
| 437 | Ga0501042_0127337 | 3300049578 | Bacteria | 1834 |
| 438 | Ga0501042_0339900 | 3300049578 | Bacteria | 1085 |
| 439 | Ga0501042_0468656 | 3300049578 | Bacteria | 914 |
| 440 | Ga0501042_0834250 | 3300049578 | Bacteria | 671 |
| 441 | Ga0501043_0014409 | 3300049579 | Bacteria | 6188 |
| 442 | Ga0501043_0021543 | 3300049579 | Bacteria | 5055 |
| 443 | Ga0501043_0154070 | 3300049579 | Bacteria | 1798 |
| 444 | Ga0501043_0648216 | 3300049579 | Bacteria | 776 |
| 445 | Ga0501043_0673227 | 3300049579 | Bacteria | 758 |
| 446 | Ga0501046_0001562 | 3300049580 | Bacteria | 21884 |
| 447 | Ga0501046_0026569 | 3300049580 | Bacteria | 4728 |
| 448 | Ga0501046_0037482 | 3300049580 | Bacteria | 3895 |
| 449 | Ga0501046_0096379 | 3300049580 | Unclassified | 2272 |
| 450 | Ga0501046_0391076 | 3300049580 | Bacteria | 1005 |
| 451 | Ga0501047_1047054 | 3300049581 | Bacteria | 629 |
| 452 | Ga0501048_0000658 | 3300049582 | Bacteria | 24898 |
| 453 | Ga0501048_0003614 | 3300049582 | Bacteria | 11783 |
| 454 | Ga0501048_0009771 | 3300049582 | Bacteria | 7193 |
| 455 | Ga0501048_0019079 | 3300049582 | Bacteria | 5037 |
| 456 | Ga0501048_0318894 | 3300049582 | Bacteria | 1107 |
| 457 | Ga0501048_0409043 | 3300049582 | Bacteria | 970 |
| 458 | Ga0501048_0570141 | 3300049582 | Bacteria | 812 |
| 459 | Ga0501068_0054956 | 3300049584 | Bacteria | 2412 |
| 460 | Ga0501068_0085558 | 3300049584 | Bacteria | 1940 |
| 461 | Ga0501068_0319005 | 3300049584 | Bacteria | 996 |
| 462 | Ga0501069_0012649 | 3300049585 | Bacteria | 4490 |
| 463 | Ga0501069_0114273 | 3300049585 | Bacteria | 1539 |
| 464 | Ga0501069_0212748 | 3300049585 | Unclassified | 1122 |
| 465 | Ga0501069_0640362 | 3300049585 | Unclassified | 639 |
| 466 | Ga0501070_0085771 | 3300049586 | Bacteria | 2607 |
| 467 | Ga0501070_0212774 | 3300049586 | Bacteria | 1586 |
| 468 | Ga0501070_0432130 | 3300049586 | Bacteria | 1063 |
| 469 | Ga0501070_0584561 | 3300049586 | Unclassified | 891 |
| 470 | Ga0501071_0000168 | 3300049587 | Bacteria | 28360 |
| 471 | Ga0501071_0003789 | 3300049587 | Bacteria | 9502 |
| 472 | Ga0501071_0005328 | 3300049587 | Bacteria | 8258 |
| 473 | Ga0501071_0018078 | 3300049587 | Bacteria | 4874 |
| 474 | Ga0501071_0096089 | 3300049587 | Unclassified | 2181 |
| 475 | Ga0501071_0184326 | 3300049587 | Bacteria | 1564 |
| 476 | Ga0501071_0346034 | 3300049587 | Bacteria | 1131 |
| 477 | Ga0501071_0446807 | 3300049587 | Bacteria | 989 |
| 478 | Ga0501071_0632649 | 3300049587 | Bacteria | 823 |
| 479 | Ga0501071_1075921 | 3300049587 | Bacteria | 621 |
| 480 | Ga0501071_1342606 | 3300049587 | Bacteria | 552 |
| 481 | Ga0501072_0000363 | 3300049588 | Bacteria | 32287 |
| 482 | Ga0501072_0005088 | 3300049588 | Bacteria | 10009 |
| 483 | Ga0501072_0029065 | 3300049588 | Bacteria | 4315 |
| 484 | Ga0501072_0051684 | 3300049588 | Bacteria | 3235 |
| 485 | Ga0501072_0177204 | 3300049588 | Bacteria | 1700 |
| 486 | Ga0501072_0430355 | 3300049588 | Bacteria | 1046 |
| 487 | Ga0501072_0582523 | 3300049588 | Bacteria | 882 |
| 488 | Ga0501072_1559563 | 3300049588 | Unclassified | 509 |
| 489 | Ga0501073_0129114 | 3300049589 | Bacteria | 1752 |
| 490 | Ga0501073_0247814 | 3300049589 | Bacteria | 1230 |
| 491 | Ga0501074_0004175 | 3300049590 | Bacteria | 10319 |
| 492 | Ga0501074_0005090 | 3300049590 | Bacteria | 9440 |
| 493 | Ga0501074_0063818 | 3300049590 | Bacteria | 2653 |
| 494 | Ga0501075_0017594 | 3300049591 | Bacteria | 5162 |
| 495 | Ga0501075_0025251 | 3300049591 | Bacteria | 4365 |
| 496 | Ga0501075_0038005 | 3300049591 | Bacteria | 3598 |
| 497 | Ga0501075_0042522 | 3300049591 | Bacteria | 3407 |
| 498 | Ga0501075_0073873 | 3300049591 | Bacteria | 2579 |
| 499 | Ga0501075_0131624 | 3300049591 | Bacteria | 1906 |
| 500 | Ga0501075_0253477 | 3300049591 | Bacteria | 1341 |
| 501 | Ga0501075_0472052 | 3300049591 | Unclassified | 957 |
| 502 | Ga0501075_0843736 | 3300049591 | Bacteria | 697 |
| 503 | Ga0501076_0000503 | 3300049592 | Bacteria | 24750 |
| 504 | Ga0501076_0007299 | 3300049592 | Bacteria | 8043 |
| 505 | Ga0501076_0011368 | 3300049592 | Bacteria | 6627 |
| 506 | Ga0501076_0021881 | 3300049592 | Bacteria | 4910 |
| 507 | Ga0501076_0128288 | 3300049592 | Bacteria | 2056 |
| 508 | Ga0501076_1258601 | 3300049592 | Bacteria | 609 |
| 509 | Ga0501077_0000434 | 3300049593 | Bacteria | 25322 |
| 510 | Ga0501077_0012604 | 3300049593 | Bacteria | 5294 |
| 511 | Ga0501077_0027697 | 3300049593 | Bacteria | 3598 |
| 512 | Ga0501077_0116240 | 3300049593 | Bacteria | 1695 |
| 513 | Ga0501077_0556779 | 3300049593 | Bacteria | 736 |
| 514 | Ga0501079_0000072 | 3300049741 | Bacteria | 46737 |
| 515 | Ga0501079_0015419 | 3300049741 | Bacteria | 5831 |
| 516 | Ga0501079_0017881 | 3300049741 | Bacteria | 5415 |
| 517 | Ga0501079_0149972 | 3300049741 | Unclassified | 1817 |
| 518 | Ga0501079_0522966 | 3300049741 | Bacteria | 933 |
| 519 | Ga0501079_0794644 | 3300049741 | Bacteria | 745 |
| 520 | Ga0501080_0007813 | 3300049742 | Bacteria | 9674 |
| 521 | Ga0501080_0019209 | 3300049742 | Bacteria | 6328 |
| 522 | Ga0501080_0090126 | 3300049742 | Bacteria | 2849 |
| 523 | Ga0501080_0251397 | 3300049742 | Bacteria | 1612 |
| 524 | Ga0501080_0266467 | 3300049742 | Bacteria | 1560 |
| 525 | Ga0501080_0396937 | 3300049742 | Bacteria | 1241 |
| 526 | Ga0501081_0001036 | 3300049743 | Bacteria | 16624 |
| 527 | Ga0501081_0023825 | 3300049743 | Bacteria | 4105 |
| 528 | Ga0501081_0063188 | 3300049743 | Bacteria | 2569 |
| 529 | Ga0501081_0107128 | 3300049743 | Unclassified | 1982 |
| 530 | Ga0501081_0225171 | 3300049743 | Bacteria | 1365 |
| 531 | Ga0501081_0425494 | 3300049743 | Unclassified | 985 |
| 532 | Ga0501083_0005449 | 3300049744 | Bacteria | 9012 |
| 533 | Ga0501083_0428275 | 3300049744 | Bacteria | 861 |
| 534 | Ga0501083_0703471 | 3300049744 | Bacteria | 657 |
| 535 | Ga0501035_0020568 | 3300049822 | Bacteria | 6061 |
| 536 | Ga0501035_0023824 | 3300049822 | Bacteria | 5617 |
| 537 | Ga0501035_0875592 | 3300049822 | Unclassified | 713 |
| 538 | Ga0501044_0089368 | 3300049823 | Bacteria | 3109 |
| 539 | Ga0501044_0144575 | 3300049823 | Bacteria | 2365 |
| 540 | Ga0501044_0197017 | 3300049823 | Bacteria | 1974 |
| 541 | Ga0501044_0254288 | 3300049823 | Bacteria | 1697 |
| 542 | Ga0501045_0000448 | 3300049824 | Bacteria | 25394 |
| 543 | Ga0501045_0007314 | 3300049824 | Bacteria | 7671 |
| 544 | Ga0501045_0024155 | 3300049824 | Bacteria | 4363 |
| 545 | Ga0501045_0068240 | 3300049824 | Bacteria | 2612 |
| 546 | Ga0501045_0069500 | 3300049824 | Bacteria | 2589 |
| 547 | Ga0501045_1110211 | 3300049824 | Bacteria | 578 |
| 548 | Ga0501045_1166037 | 3300049824 | Bacteria | 563 |
| 549 | Ga0501045_1303604 | 3300049824 | Bacteria | 528 |
| 550 | nmdc:mga0yw44_100424_c1 | 3300050492 | Bacteria | 1842 |
| 551 | nmdc:mga0k408_382696_c1 | 3300050493 | Bacteria | 838 |
| 552 | nmdc:mga06z11_298142_c1 | 3300050494 | Bacteria | 958 |
| 553 | nmdc:mga09592_453237_c1 | 3300050508 | Bacteria | 1107 |
| 554 | nmdc:mga0qj67_282164_c1 | 3300050509 | Bacteria | 1346 |
| 555 | nmdc:mga06r32_15644_c1 | 3300050510 | Bacteria | 6893 |
| 556 | nmdc:mga06r32_944532_c1 | 3300050510 | Bacteria | 817 |
| 557 | nmdc:mga06r32_95259_c1 | 3300050510 | Bacteria | 2913 |
| 558 | nmdc:mga08y16_125441_c1 | 3300050511 | Unclassified | 2671 |
| 559 | nmdc:mga08y16_81795_c1 | 3300050511 | Bacteria | 3367 |
| 560 | nmdc:mga0rr50_212993_c1 | 3300050513 | Bacteria | 1592 |
| 561 | Ga0495601_0102175 | 3300053077 | Bacteria | 1852 |
| 562 | Ga0495601_0261608 | 3300053077 | Archaea | 1129 |
| 563 | Ga0495612_0073642 | 3300053078 | Bacteria | 1427 |
| 564 | Ga0500635_0158959 | 3300053080 | Unclassified | 866 |
| 565 | Ga0495595_0076227 | 3300053084 | Unclassified | 1591 |
| 566 | Ga0495595_0219154 | 3300053084 | Bacteria | 949 |
| 567 | Ga0495619_0033372 | 3300053085 | Bacteria | 3342 |
| 568 | Ga0495619_0284131 | 3300053085 | Bacteria | 1146 |
| 569 | Ga0495619_0628062 | 3300053085 | Archaea | 734 |
| 570 | Ga0495619_0908584 | 3300053085 | Bacteria | 592 |
| 571 | Ga0500641_0021245 | 3300053096 | Bacteria | 2472 |
| 572 | Ga0500554_004626 | 3300053102 | Bacteria | 2932 |
| 573 | Ga0500554_040203 | 3300053102 | Bacteria | 1432 |
| 574 | Ga0500588_0013234 | 3300053146 | Bacteria | 2066 |
| 575 | Ga0500630_047580 | 3300053159 | Bacteria | 2079 |
| 576 | Ga0501084_0004055 | 3300054114 | Bacteria | 11928 |
| 577 | Ga0501084_0006635 | 3300054114 | Bacteria | 9520 |
| 578 | Ga0501084_0016176 | 3300054114 | Bacteria | 6194 |
| 579 | Ga0501084_0173819 | 3300054114 | Bacteria | 1818 |
| 580 | Ga0501084_0180624 | 3300054114 | Unclassified | 1781 |
| 581 | Ga0501084_0191428 | 3300054114 | Bacteria | 1726 |
| 582 | Ga0501084_0307664 | 3300054114 | Bacteria | 1338 |
| 583 | Ga0501084_1344047 | 3300054114 | Bacteria | 599 |
| 584 | Ga0590075_088798 | 3300059424 | Bacteria | 802 |
| 585 | Ga0501082_0006922 | 3300060353 | Bacteria | 9800 |
| 586 | Ga0501082_0008405 | 3300060353 | Bacteria | 8905 |
| 587 | Ga0501082_1592635 | 3300060353 | Bacteria | 570 |
| 588 | Ga0466962_0411094 | 3300061719 | Unclassified | 678 |
| 589 | Ga0530510_0000027 | 3300061734 | Bacteria | 65176 |
| 590 | Ga0530510_0004966 | 3300061734 | Bacteria | 9188 |
| 591 | Ga0530510_0027074 | 3300061734 | Bacteria | 4107 |
| 592 | Ga0530510_0036464 | 3300061734 | Bacteria | 3545 |
| 593 | Ga0530510_0097778 | 3300061734 | Bacteria | 2146 |
| 594 | Ga0530510_0108012 | 3300061734 | Bacteria | 2037 |
| 595 | Ga0530510_0120798 | 3300061734 | Unclassified | 1923 |
| 596 | Ga0530510_0461048 | 3300061734 | Bacteria | 961 |
| 597 | Ga0530510_1094178 | 3300061734 | Bacteria | 610 |
| 598 | Ga0530510_1403699 | 3300061734 | Bacteria | 536 |
| 599 | Ga0075430_100092670 | |||
| 600 | JGI24735J21928_10090167 | |||
| 601 | rootL2_10164362 | |||
| 602 | JGI25407J50210_10040800 | |||
| 603 | JGI25407J50210_10084073 | |||
| 604 | Ga0070676_10752843 | |||
| 605 | Ga0070683_101735145 | |||
| 606 | Ga0070683_102242672 | |||
| 607 | Ga0070670_100066237 | |||
| 608 | Ga0068869_100320902 | |||
| 609 | Ga0070682_100341999 | |||
| 610 | Ga0068868_100017489 | |||
| 611 | Ga0068868_101130132 | |||
| 612 | Ga0070660_100020138 | |||
| 613 | Ga0070691_10099270 | |||
| 614 | Ga0070691_10395433 | |||
| 615 | Ga0070687_100554469 | |||
| 616 | Ga0070661_100098332 | |||
| 617 | Ga0070692_10313260 | |||
| 618 | Ga0070669_100123282 | |||
| 619 | Ga0070675_100005116 | |||
| 620 | Ga0070671_101656798 | |||
| 621 | Ga0070674_100958503 | |||
| 622 | Ga0070659_100511797 | |||
| 623 | Ga0070709_10020516 | |||
| 624 | Ga0070714_100132747 | |||
| 625 | Ga0070714_100192175 | |||
| 626 | Ga0070714_101715151 | |||
| 627 | Ga0070713_100206298 | |||
| 628 | Ga0070713_100498536 | |||
| 629 | Ga0070713_100528998 | |||
| 630 | Ga0070713_100699513 | |||
| 631 | Ga0070710_10036380 | |||
| 632 | Ga0070710_10082703 | |||
| 633 | Ga0070710_10378870 | |||
| 634 | Ga0070701_11246566 | |||
| 635 | Ga0070711_100024566 | |||
| 636 | Ga0070711_100066219 | |||
| 637 | Ga0070694_101701957 | |||
| 638 | Ga0070708_100523421 | |||
| 639 | Ga0070708_101066913 | |||
| 640 | Ga0070663_100053682 | |||
| 641 | Ga0070678_100139955 | |||
| 642 | Ga0070678_101054797 | |||
| 643 | Ga0070662_100010177 | |||
| 644 | Ga0070681_11384176 | |||
| 645 | Ga0070706_100634704 | |||
| 646 | Ga0070707_100032907 | |||
| 647 | Ga0070707_100333865 | |||
| 648 | Ga0070698_100560557 | |||
| 649 | Ga0070699_100004196 | |||
| 650 | Ga0070684_100035795 | |||
| 651 | Ga0070684_100539304 | |||
| 652 | Ga0070684_101679122 | |||
| 653 | Ga0070686_100947256 | |||
| 654 | Ga0070696_100320146 | |||
| 655 | Ga0070693_101415244 | |||
| 656 | Ga0070665_101184584 | |||
| 657 | Ga0070665_101224374 | |||
| 658 | Ga0070665_102352295 | |||
| 659 | Ga0068855_101779795 | |||
| 660 | Ga0070664_100003607 | |||
| 661 | Ga0070664_100659162 | |||
| 662 | Ga0070664_101146553 | |||
| 663 | Ga0068857_100010543 | |||
| 664 | Ga0068854_100303156 | |||
| 665 | Ga0068856_100283314 | |||
| 666 | Ga0070702_100037710 | |||
| 667 | Ga0070702_100985149 | |||
| 668 | Ga0068852_100892224 | |||
| 669 | Ga0068852_101158270 | |||
| 670 | Ga0068859_100434232 | |||
| 671 | Ga0068864_100206979 | |||
| 672 | Ga0068861_100604567 | |||
| 673 | Ga0068863_100228185 | |||
| 674 | Ga0068863_102581873 | |||
| 675 | Ga0068858_100021295 | |||
| 676 | Ga0068858_100078913 | |||
| 677 | Ga0068860_100471504 | |||
| 678 | Ga0068862_101143294 | |||
| 679 | Ga0081455_10112024 | |||
| 680 | Ga0081455_10343453 | |||
| 681 | Ga0081455_10408656 | |||
| 682 | Ga0081538_10022862 | |||
| 683 | Ga0081538_10024593 | |||
| 684 | Ga0081538_10025060 | |||
| 685 | Ga0081538_10039732 | |||
| 686 | Ga0081540_1004915 | |||
| 687 | Ga0081539_10002046 | |||
| 688 | Ga0070717_10121118 | |||
| 689 | Ga0070717_10281719 | |||
| 690 | Ga0070717_10336878 | |||
| 691 | Ga0075365_10268486 | |||
| 692 | Ga0075364_10413783 | |||
| 693 | Ga0070715_10071700 | |||
| 694 | Ga0070715_10085499 | |||
| 695 | Ga0070715_10375693 | |||
| 696 | Ga0070716_100026965 | |||
| 697 | Ga0070716_100134183 | |||
| 698 | Ga0070712_100790910 | |||
| 699 | Ga0075367_10493257 | |||
| 700 | Ga0097621_100535019 | |||
| 701 | Ga0097621_100573390 | |||
| 702 | Ga0068871_100498986 | |||
| 703 | Ga0075430_100219032 | |||
| 704 | Ga0075431_100351972 | |||
| 705 | Ga0075431_100555623 | |||
| 706 | Ga0075433_10746401 | |||
| 707 | Ga0075434_102323502 | |||
| 708 | Ga0075429_100517588 | |||
| 709 | Ga0068865_100146168 | |||
| 710 | Ga0068865_100485791 | |||
| 711 | Ga0075436_100606396 | |||
| 712 | Ga0097620_100434247 | |||
| 713 | Ga0075435_100188385 | |||
| 714 | Ga0105240_11403776 | |||
| 715 | Ga0111539_10034656 | |||
| 716 | Ga0111539_10126683 | |||
| 717 | Ga0105245_10006478 | |||
| 718 | Ga0105245_10203894 | |||
| 719 | Ga0114129_10373616 | |||
| 720 | Ga0105243_10255226 | |||
| 721 | Ga0105248_13452838 | |||
| 722 | Ga0105237_10360579 | |||
| 723 | Ga0105238_10129984 | |||
| 724 | Ga0105238_10484555 | |||
| 725 | Ga0105249_10069890 | |||
| 726 | Ga0105249_10343465 | |||
| 727 | Ga0105249_11547899 | |||
| 728 | Ga0105239_10060179 | |||
| 729 | Ga0105239_10377299 | |||
| 730 | Ga0105239_11777320 | |||
| 731 | Ga0105246_10085742 | |||
| 732 | Ga0157370_10029499 | |||
| 733 | Ga0157374_10112243 | |||
| 734 | Ga0163162_10074199 | |||
| 735 | Ga0157375_10144301 | |||
| 736 | Ga0157375_12921787 | |||
| 737 | Ga0163163_10017651 | |||
| 738 | Ga0157380_12664761 | |||
| 739 | Ga0157377_10001627 | |||
| 740 | Ga0157377_10464181 | |||
| 741 | Ga0157379_10015275 | |||
| 742 | Ga0157376_10115726 | |||
| 743 | Ga0213874_10005600 | |||
| 744 | Ga0213876_10027510 | |||
| 745 | Ga0213876_10330606 | |||
| 746 | Ga0213876_10437375 | |||
| 747 | Ga0224712_10069960 | |||
| 748 | Ga0207692_10045864 | |||
| 749 | Ga0207692_10102159 | |||
| 750 | Ga0207688_10076834 | |||
| 751 | Ga0207685_10263936 | |||
| 752 | Ga0207685_10285870 | |||
| 753 | Ga0207699_10106384 | |||
| 754 | Ga0207699_11282480 | |||
| 755 | Ga0207645_10659250 | |||
| 756 | Ga0207671_10136797 | |||
| 757 | Ga0207671_10545329 | |||
| 758 | Ga0207693_10002068 | |||
| 759 | Ga0207693_10060050 | |||
| 760 | Ga0207663_10024634 | |||
| 761 | Ga0207663_10098461 | |||
| 762 | Ga0207663_10245863 | |||
| 763 | Ga0207662_10873254 | |||
| 764 | Ga0207657_10026044 | |||
| 765 | Ga0207657_11252035 | |||
| 766 | Ga0207649_10007609 | |||
| 767 | Ga0207646_10077418 | |||
| 768 | Ga0207646_10492988 | |||
| 769 | Ga0207681_10584115 | |||
| 770 | Ga0207694_10057901 | |||
| 771 | Ga0207694_10328122 | |||
| 772 | Ga0207650_10131987 | |||
| 773 | Ga0207659_10020891 | |||
| 774 | Ga0207687_10098744 | |||
| 775 | Ga0207700_10021782 | |||
| 776 | Ga0207700_10106097 | |||
| 777 | Ga0207700_10126339 | |||
| 778 | Ga0207700_11529506 | |||
| 779 | Ga0207664_10006223 | |||
| 780 | Ga0207664_10298697 | |||
| 781 | Ga0207664_10336201 | |||
| 782 | Ga0207664_11665116 | |||
| 783 | Ga0207690_10473745 | |||
| 784 | Ga0207690_10498776 | |||
| 785 | Ga0207706_10019591 | |||
| 786 | Ga0207709_10460083 | |||
| 787 | Ga0207704_10238742 | |||
| 788 | Ga0207704_10611595 | |||
| 789 | Ga0207665_10026207 | |||
| 790 | Ga0207665_10069811 | |||
| 791 | Ga0207665_10185519 | |||
| 792 | Ga0207689_10668574 | |||
| 793 | Ga0207661_10197315 | |||
| 794 | Ga0207661_11644476 | |||
| 795 | Ga0207679_10060279 | |||
| 796 | Ga0207667_11626659 | |||
| 797 | Ga0207712_11836282 | |||
| 798 | Ga0207668_10049614 | |||
| 799 | Ga0207677_10026802 | |||
| 800 | Ga0207677_10101520 | |||
| 801 | Ga0207703_10062117 | |||
| 802 | Ga0207703_10462015 | |||
| 803 | Ga0207678_10044634 | |||
| 804 | Ga0207708_10057409 | |||
| 805 | Ga0207702_10049082 | |||
| 806 | Ga0207702_10409792 | |||
| 807 | Ga0207702_11273100 | |||
| 808 | Ga0207641_10166501 | |||
| 809 | Ga0207641_11140480 | |||
| 810 | Ga0207674_10009169 | |||
| 811 | Ga0207674_10111927 | |||
| 812 | Ga0207675_100319889 | |||
| 813 | Ga0207675_101307656 | |||
| 814 | Ga0207683_10149481 | |||
| 815 | Ga0207683_10729758 | |||
| 816 | Ga0207698_10589919 | |||
| 817 | Ga0207698_12075444 | |||
| 818 | Ga0207428_10063899 | |||
| 819 | Ga0268265_10087568 | |||
| 820 | Ga0268264_10628758 | |||
| 821 | Ga0265318_10180995 | |||
| 822 | Ga0307515_10135846 | |||
| 823 | Ga0265327_10006202 | |||
| 824 | Ga0307408_100095274 | |||
| 825 | Ga0307405_10048483 | |||
| 826 | Ga0307405_10166497 | |||
| 827 | Ga0307410_10034701 | |||
| 828 | Ga0307410_11292616 | |||
| 829 | Ga0307406_10122542 | |||
| 830 | Ga0307407_10939337 | |||
| 831 | Ga0307409_100158432 | |||
| 832 | Ga0307409_100384587 | |||
| 833 | Ga0307409_100618935 | |||
| 834 | Ga0307409_100850976 | |||
| 835 | Ga0307409_101692776 | |||
| 836 | Ga0307416_100038565 | |||
| 837 | Ga0307416_100788219 | |||
| 838 | Ga0307414_10432291 | |||
| 839 | Ga0307411_10020850 | |||
| 840 | Ga0307415_100496992 | |||
| 841 | Ga0373923_0112104 | |||
| 842 | Ga0373953_0047555 | |||
| 843 | Ga0373953_0093788 | |||
| 844 | Ga0373954_0036556 | |||
| 845 | Ga0373954_0056334 | |||
| 846 | Ga0373956_0104246 | |||
| 847 | Ga0373956_0545988 | |||
| 848 | Ga0373957_0106122 | |||
| 849 | Ga0373955_0149872 | |||
| 850 | Ga0373955_0847975 | |||
| 851 | Ga0373935_0179913 | |||
| 852 | Ga0373947_0141289 | |||
| 853 | Ga0373947_0464252 | |||
| 854 | Ga0373937_0230207 | |||
| 855 | Ga0373937_0236767 | |||
| 856 | Ga0373925_0122767 | |||
| 857 | Ga0373925_0297920 | |||
| 858 | Ga0373925_0686366 | |||
| 859 | Ga0436364_0642729 | |||
| 860 | Ga0436365_0095687 | |||
| 861 | Ga0436365_0452435 | |||
| 862 | Ga0436365_0959978 | |||
| 863 | Ga0436365_1086149 | |||
| 864 | Ga0436365_1417417 | |||
| 865 | Ga0436365_1816999 | |||
| 866 | Ga0436363_0964834 | |||
| 867 | Ga0436363_1313035 | |||
| 868 | Ga0436363_1674390 | |||
| 869 | Ga0436362_0727121 | |||
| 870 | Ga0436362_1159380 | |||
| 871 | Ga0436362_1185108 | |||
| 872 | Ga0439465_0180920 | |||
| 873 | Ga0451839_0858136 | |||
| 874 | Ga0439448_0023130 | |||
| 875 | Ga0439448_0055511 | |||
| 876 | Ga0439455_0043765 | |||
| 877 | Ga0439463_035966 | |||
| 878 | Ga0439463_123789 | |||
| 879 | Ga0450888_020187 | |||
| 880 | Ga0439444_0006932 | |||
| 881 | Ga0439460_0033417 | |||
| 882 | Ga0439440_0008226 | |||
| 883 | Ga0466970_0551777 | |||
| 884 | Ga0466967_0062726 | |||
| 885 | Ga0466967_0729842 | |||
| 886 | Ga0466967_2484235 | |||
| 887 | Ga0495592_0557013 | |||
| 888 | Ga0495603_0178511 | |||
| 889 | Ga0495629_0253656 | |||
| 890 | Ga0495641_0112324 | |||
| 891 | Ga0495641_0233590 | |||
| 892 | Ga0495651_0002129 | |||
| 893 | Ga0495651_0010390 | |||
| 894 | Ga0495580_1052638 | |||
| 895 | Ga0495639_0219952 | |||
| 896 | Ga0495662_0276850 | |||
| 897 | Ga0495664_0099518 | |||
| 898 | Ga0495608_0001555 | |||
| 899 | Ga0495608_0048233 | |||
| 900 | Ga0495608_0778478 | |||
| 901 | Ga0495618_0003152 | |||
| 902 | Ga0495618_0007832 | |||
| 903 | Ga0495628_0197228 | |||
| 904 | Ga0495628_0200255 | |||
| 905 | Ga0495628_0434178 | |||
| 906 | Ga0495630_0077414 | |||
| 907 | Ga0495652_0036115 | |||
| 908 | Ga0495640_0035323 | |||
| 909 | Ga0495640_0189374 | |||
| 910 | Ga0495586_0383882 | |||
| 911 | Ga0495587_0002344 | |||
| 912 | Ga0495587_0051259 | |||
| 913 | Ga0495587_0366596 | |||
| 914 | Ga0495645_0097350 | |||
| 915 | Ga0495645_0136440 | |||
| 916 | Ga0495667_0001230 | |||
| 917 | Ga0495667_0001423 | |||
| 918 | Ga0495634_0015412 | |||
| 919 | Ga0495634_0059596 | |||
| 920 | Ga0495625_0398161 | |||
| 921 | Ga0495635_0015542 | |||
| 922 | Ga0495635_0023911 | |||
| 923 | Ga0495635_0193851 | |||
| 924 | Ga0495635_0719132 | |||
| 925 | Ga0495657_0034713 | |||
| 926 | Ga0495599_0004753 | |||
| 927 | Ga0495599_0092400 | |||
| 928 | Ga0495599_0869982 | |||
| 929 | Ga0495623_0037709 | |||
| 930 | Ga0495623_0038888 | |||
| 931 | Ga0495646_0010659 | |||
| 932 | Ga0495646_0120901 | |||
| 933 | Ga0495658_0184369 | |||
| 934 | Ga0495658_0403387 | |||
| 935 | Ga0495613_0062666 | |||
| 936 | Ga0495613_0148447 | |||
| 937 | Ga0495624_0167468 | |||
| 938 | Ga0495600_0008914 | |||
| 939 | Ga0495600_0018758 | |||
| 940 | Ga0495581_0101199 | |||
| 941 | Ga0495581_0416765 | |||
| 942 | Ga0495604_0003214 | |||
| 943 | Ga0495604_0005796 | |||
| 944 | Ga0495604_0399077 | |||
| 945 | Ga0495674_0007842 | |||
| 946 | Ga0495680_0011793 | |||
| 947 | Ga0495680_0012785 | |||
| 948 | Ga0495680_0224420 | |||
| 949 | Ga0495680_0283696 | |||
| 950 | Ga0495675_0122064 | |||
| 951 | Ga0495684_0000775 | |||
| 952 | Ga0495684_0006759 | |||
| 953 | Ga0495593_0038916 | |||
| 954 | Ga0495602_0015688 | |||
| 955 | Ga0495602_0028686 | |||
| 956 | Ga0495602_0432802 | |||
| 957 | Ga0496100_0611843 | |||
| 958 | Ga0496101_1466981 | |||
| 959 | Ga0496102_0788931 | |||
| 960 | Ga0496104_0229730 | |||
| 961 | Ga0496104_0244691 | |||
| 962 | Ga0496105_0179036 | |||
| 963 | Ga0496108_0035032 | |||
| 964 | Ga0496108_0448898 | |||
| 965 | Ga0496108_1160613 | |||
| 966 | Ga0496109_0035009 | |||
| 967 | Ga0496109_1300686 | |||
| 968 | Ga0496110_0501017 | |||
| 969 | Ga0496111_0081061 | |||
| 970 | Ga0496111_0561298 | |||
| 971 | Ga0496112_0639463 | |||
| 972 | Ga0496113_0199847 | |||
| 973 | Ga0496114_1100443 | |||
| 974 | Ga0496115_0524171 | |||
| 975 | Ga0501031_0002316 | |||
| 976 | Ga0501031_0048750 | |||
| 977 | Ga0501031_0060399 | |||
| 978 | Ga0501031_0133206 | |||
| 979 | Ga0501032_0013911 | |||
| 980 | Ga0501032_0042115 | |||
| 981 | Ga0501032_0056020 | |||
| 982 | Ga0501032_0142678 | |||
| 983 | Ga0501032_0355172 | |||
| 984 | Ga0501033_0044435 | |||
| 985 | Ga0501033_0057873 | |||
| 986 | Ga0501034_0189738 | |||
| 987 | Ga0501034_0454846 | |||
| 988 | Ga0501036_0001001 | |||
| 989 | Ga0501036_0007003 | |||
| 990 | Ga0501036_0007942 | |||
| 991 | Ga0501036_0031655 | |||
| 992 | Ga0501036_0146489 | |||
| 993 | Ga0501036_0157486 | |||
| 994 | Ga0501036_0179766 | |||
| 995 | Ga0501037_0022426 | |||
| 996 | Ga0501037_0083911 | |||
| 997 | Ga0501037_0091022 | |||
| 998 | Ga0501037_0320242 | |||
| 999 | Ga0501037_0679875 | |||
| 1000 | Ga0501038_0003890 | |||
| 1001 | Ga0501038_0016112 | |||
| 1002 | Ga0501038_0030362 | |||
| 1003 | Ga0501038_0142199 | |||
| 1004 | Ga0501038_0171023 | |||
| 1005 | Ga0501038_0224865 | |||
| 1006 | Ga0501038_0862459 | |||
| 1007 | Ga0501038_0883859 | |||
| 1008 | Ga0501038_1319913 | |||
| 1009 | Ga0501039_0006320 | |||
| 1010 | Ga0501039_0015299 | |||
| 1011 | Ga0501039_0027830 | |||
| 1012 | Ga0501039_0028687 | |||
| 1013 | Ga0501039_0050029 | |||
| 1014 | Ga0501039_0221006 | |||
| 1015 | Ga0501039_0748889 | |||
| 1016 | Ga0501039_1108324 | |||
| 1017 | Ga0501040_0001230 | |||
| 1018 | Ga0501040_0002734 | |||
| 1019 | Ga0501040_0008178 | |||
| 1020 | Ga0501040_0076409 | |||
| 1021 | Ga0501040_0089248 | |||
| 1022 | Ga0501040_0101981 | |||
| 1023 | Ga0501040_0203594 | |||
| 1024 | Ga0501040_0549949 | |||
| 1025 | Ga0501041_0001967 | |||
| 1026 | Ga0501041_0005525 | |||
| 1027 | Ga0501041_0025859 | |||
| 1028 | Ga0501041_0056620 | |||
| 1029 | Ga0501041_0149264 | |||
| 1030 | Ga0501041_0327247 | |||
| 1031 | Ga0501042_0007393 | |||
| 1032 | Ga0501042_0009114 | |||
| 1033 | Ga0501042_0009725 | |||
| 1034 | Ga0501042_0018338 | |||
| 1035 | Ga0501042_0127337 | |||
| 1036 | Ga0501042_0339900 | |||
| 1037 | Ga0501042_0468656 | |||
| 1038 | Ga0501042_0834250 | |||
| 1039 | Ga0501043_0014409 | |||
| 1040 | Ga0501043_0021543 | |||
| 1041 | Ga0501043_0154070 | |||
| 1042 | Ga0501043_0648216 | |||
| 1043 | Ga0501043_0673227 | |||
| 1044 | Ga0501046_0001562 | |||
| 1045 | Ga0501046_0026569 | |||
| 1046 | Ga0501046_0037482 | |||
| 1047 | Ga0501046_0096379 | |||
| 1048 | Ga0501046_0391076 | |||
| 1049 | Ga0501047_1047054 | |||
| 1050 | Ga0501048_0000658 | |||
| 1051 | Ga0501048_0003614 | |||
| 1052 | Ga0501048_0009771 | |||
| 1053 | Ga0501048_0019079 | |||
| 1054 | Ga0501048_0318894 | |||
| 1055 | Ga0501048_0409043 | |||
| 1056 | Ga0501048_0570141 | |||
| 1057 | Ga0501068_0054956 | |||
| 1058 | Ga0501068_0085558 | |||
| 1059 | Ga0501068_0319005 | |||
| 1060 | Ga0501069_0012649 | |||
| 1061 | Ga0501069_0114273 | |||
| 1062 | Ga0501069_0212748 | |||
| 1063 | Ga0501069_0640362 | |||
| 1064 | Ga0501070_0085771 | |||
| 1065 | Ga0501070_0212774 | |||
| 1066 | Ga0501070_0432130 | |||
| 1067 | Ga0501070_0584561 | |||
| 1068 | Ga0501071_0000168 | |||
| 1069 | Ga0501071_0003789 | |||
| 1070 | Ga0501071_0005328 | |||
| 1071 | Ga0501071_0018078 | |||
| 1072 | Ga0501071_0096089 | |||
| 1073 | Ga0501071_0184326 | |||
| 1074 | Ga0501071_0346034 | |||
| 1075 | Ga0501071_0446807 | |||
| 1076 | Ga0501071_0632649 | |||
| 1077 | Ga0501071_1075921 | |||
| 1078 | Ga0501071_1342606 | |||
| 1079 | Ga0501072_0000363 | |||
| 1080 | Ga0501072_0005088 | |||
| 1081 | Ga0501072_0029065 | |||
| 1082 | Ga0501072_0051684 | |||
| 1083 | Ga0501072_0177204 | |||
| 1084 | Ga0501072_0430355 | |||
| 1085 | Ga0501072_0582523 | |||
| 1086 | Ga0501072_1559563 | |||
| 1087 | Ga0501073_0129114 | |||
| 1088 | Ga0501073_0247814 | |||
| 1089 | Ga0501074_0004175 | |||
| 1090 | Ga0501074_0005090 | |||
| 1091 | Ga0501074_0063818 | |||
| 1092 | Ga0501075_0017594 | |||
| 1093 | Ga0501075_0025251 | |||
| 1094 | Ga0501075_0038005 | |||
| 1095 | Ga0501075_0042522 | |||
| 1096 | Ga0501075_0073873 | |||
| 1097 | Ga0501075_0131624 | |||
| 1098 | Ga0501075_0253477 | |||
| 1099 | Ga0501075_0472052 | |||
| 1100 | Ga0501075_0843736 | |||
| 1101 | Ga0501076_0000503 | |||
| 1102 | Ga0501076_0007299 | |||
| 1103 | Ga0501076_0011368 | |||
| 1104 | Ga0501076_0021881 | |||
| 1105 | Ga0501076_0128288 | |||
| 1106 | Ga0501076_1258601 | |||
| 1107 | Ga0501077_0000434 | |||
| 1108 | Ga0501077_0012604 | |||
| 1109 | Ga0501077_0027697 | |||
| 1110 | Ga0501077_0116240 | |||
| 1111 | Ga0501077_0556779 | |||
| 1112 | Ga0501079_0000072 | |||
| 1113 | Ga0501079_0015419 | |||
| 1114 | Ga0501079_0017881 | |||
| 1115 | Ga0501079_0149972 | |||
| 1116 | Ga0501079_0522966 | |||
| 1117 | Ga0501079_0794644 | |||
| 1118 | Ga0501080_0007813 | |||
| 1119 | Ga0501080_0019209 | |||
| 1120 | Ga0501080_0090126 | |||
| 1121 | Ga0501080_0251397 | |||
| 1122 | Ga0501080_0266467 | |||
| 1123 | Ga0501080_0396937 | |||
| 1124 | Ga0501081_0001036 | |||
| 1125 | Ga0501081_0023825 | |||
| 1126 | Ga0501081_0063188 | |||
| 1127 | Ga0501081_0107128 | |||
| 1128 | Ga0501081_0225171 | |||
| 1129 | Ga0501081_0425494 | |||
| 1130 | Ga0501083_0005449 | |||
| 1131 | Ga0501083_0428275 | |||
| 1132 | Ga0501083_0703471 | |||
| 1133 | Ga0501035_0020568 | |||
| 1134 | Ga0501035_0023824 | |||
| 1135 | Ga0501035_0875592 | |||
| 1136 | Ga0501044_0089368 | |||
| 1137 | Ga0501044_0144575 | |||
| 1138 | Ga0501044_0197017 | |||
| 1139 | Ga0501044_0254288 | |||
| 1140 | Ga0501045_0000448 | |||
| 1141 | Ga0501045_0007314 | |||
| 1142 | Ga0501045_0024155 | |||
| 1143 | Ga0501045_0068240 | |||
| 1144 | Ga0501045_0069500 | |||
| 1145 | Ga0501045_1110211 | |||
| 1146 | Ga0501045_1166037 | |||
| 1147 | Ga0501045_1303604 | |||
| 1148 | nmdc:mga0yw44_100424_c1 | |||
| 1149 | nmdc:mga0k408_382696_c1 | |||
| 1150 | nmdc:mga06z11_298142_c1 | |||
| 1151 | nmdc:mga09592_453237_c1 | |||
| 1152 | nmdc:mga0qj67_282164_c1 | |||
| 1153 | nmdc:mga06r32_15644_c1 | |||
| 1154 | nmdc:mga06r32_944532_c1 | |||
| 1155 | nmdc:mga06r32_95259_c1 | |||
| 1156 | nmdc:mga08y16_125441_c1 | |||
| 1157 | nmdc:mga08y16_81795_c1 | |||
| 1158 | nmdc:mga0rr50_212993_c1 | |||
| 1159 | Ga0495601_0102175 | |||
| 1160 | Ga0495601_0261608 | |||
| 1161 | Ga0495612_0073642 | |||
| 1162 | Ga0500635_0158959 | |||
| 1163 | Ga0495595_0076227 | |||
| 1164 | Ga0495595_0219154 | |||
| 1165 | Ga0495619_0033372 | |||
| 1166 | Ga0495619_0284131 | |||
| 1167 | Ga0495619_0628062 | |||
| 1168 | Ga0495619_0908584 | |||
| 1169 | Ga0500641_0021245 | |||
| 1170 | Ga0500554_004626 | |||
| 1171 | Ga0500554_040203 | |||
| 1172 | Ga0500588_0013234 | |||
| 1173 | Ga0500630_047580 | |||
| 1174 | Ga0501084_0004055 | |||
| 1175 | Ga0501084_0006635 | |||
| 1176 | Ga0501084_0016176 | |||
| 1177 | Ga0501084_0173819 | |||
| 1178 | Ga0501084_0180624 | |||
| 1179 | Ga0501084_0191428 | |||
| 1180 | Ga0501084_0307664 | |||
| 1181 | Ga0501084_1344047 | |||
| 1182 | Ga0590075_088798 | |||
| 1183 | Ga0501082_0006922 | |||
| 1184 | Ga0501082_0008405 | |||
| 1185 | Ga0501082_1592635 | |||
| 1186 | Ga0466962_0411094 | |||
| 1187 | Ga0530510_0000027 | |||
| 1188 | Ga0530510_0004966 | |||
| 1189 | Ga0530510_0027074 | |||
| 1190 | Ga0530510_0036464 | |||
| 1191 | Ga0530510_0097778 | |||
| 1192 | Ga0530510_0108012 | |||
| 1193 | Ga0530510_0120798 | |||
| 1194 | Ga0530510_0461048 | |||
| 1195 | Ga0530510_1094178 | |||
| 1196 | Ga0530510_1403699 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9486 | 18 | 73 |
| 1sfu-assembly1.cif.gz_B | crystal structure of the viral zalpha domain bound to left-handed z-dna | 0.9312 | 29 | 72 |
| 2quf-assembly1.cif.gz_A | crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus | 0.9305 | 13 | 73 |
| 7wqu-assembly1.cif.gz_B | feoc from klebsiella pneumoniae | 0.9287 | 18 | 73 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.927 | 21 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9728 | 17 | 72 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.963 | 13 | 75 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9626 | 15 | 71 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9486 | 18 | 73 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9449 | 9 | 74 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H5CYU2-F1-model_v4 | Transcriptional regulator, ArsR family | 0.9879 | 6 | 89 |
GO:0003700
|
| AF-A0A1Y4RKQ4-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9649 | 4 | 90 |
GO:0003700
|
| AF-A0A538JLE8-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9619 | 4 | 100 |
GO:0003700
|
| AF-A0A7D7VF50-F1-model_v4 | Metalloregulator ArsR/SmtB family transcription factor | 0.9619 | 2 | 86 |
GO:0003700
|
| AF-A0A6A7LP56-F1-model_v4 | Metalloregulator ArsR/SmtB family transcription factor | 0.9618 | 4 | 89 |
GO:0003700
|