F467772

General Info

Members Datasets Scaffolds Average Seq Length
598 285 1196 111

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100092670|Ga0075430_1000926705
Length 123
Sequence MTADPAVPAGDPFGALGDAHRRQIVTLIADGPRSVRELADELPISRPAVSRHLRLLKEAGLVGEEPEGTRRIYRLRREGVEAMQAYLQQVWGDAAARFRLVAENTTPDPAGSDTESDSTELQR

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
279 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
280 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 3.01
Rhizosphere 92.14
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100092670 3300006846 Bacteria 2526
2 JGI24735J21928_10090167 3300002067 Bacteria 879
3 rootL2_10164362 3300003322 Bacteria 1300
4 JGI25407J50210_10040800 3300003373 Bacteria 1189
5 JGI25407J50210_10084073 3300003373 Bacteria 790
6 Ga0070676_10752843 3300005328 Bacteria 715
7 Ga0070683_101735145 3300005329 Bacteria 600
8 Ga0070683_102242672 3300005329 Bacteria 524
9 Ga0070670_100066237 3300005331 Bacteria 3099
10 Ga0068869_100320902 3300005334 Bacteria 1256
11 Ga0070682_100341999 3300005337 Bacteria 1112
12 Ga0068868_100017489 3300005338 Bacteria 5344
13 Ga0068868_101130132 3300005338 Unclassified 722
14 Ga0070660_100020138 3300005339 Bacteria 4899
15 Ga0070691_10099270 3300005341 Bacteria 1444
16 Ga0070691_10395433 3300005341 Bacteria 778
17 Ga0070687_100554469 3300005343 Unclassified 782
18 Ga0070661_100098332 3300005344 Bacteria 2174
19 Ga0070692_10313260 3300005345 Bacteria 962
20 Ga0070669_100123282 3300005353 Bacteria 1980
21 Ga0070675_100005116 3300005354 Bacteria 10005
22 Ga0070671_101656798 3300005355 Bacteria 567
23 Ga0070674_100958503 3300005356 Bacteria 748
24 Ga0070659_100511797 3300005366 Bacteria 1024
25 Ga0070709_10020516 3300005434 Bacteria 3834
26 Ga0070714_100132747 3300005435 Bacteria 2226
27 Ga0070714_100192175 3300005435 Bacteria 1863
28 Ga0070714_101715151 3300005435 Unclassified 613
29 Ga0070713_100206298 3300005436 Bacteria 1777
30 Ga0070713_100498536 3300005436 Bacteria 1149
31 Ga0070713_100528998 3300005436 Bacteria 1115
32 Ga0070713_100699513 3300005436 Bacteria 967
33 Ga0070710_10036380 3300005437 Bacteria 2691
34 Ga0070710_10082703 3300005437 Bacteria 1877
35 Ga0070710_10378870 3300005437 Bacteria 943
36 Ga0070701_11246566 3300005438 Bacteria 529
37 Ga0070711_100024566 3300005439 Bacteria 3932
38 Ga0070711_100066219 3300005439 Bacteria 2530
39 Ga0070694_101701957 3300005444 Unclassified 536
40 Ga0070708_100523421 3300005445 Bacteria 1118
41 Ga0070708_101066913 3300005445 Bacteria 757
42 Ga0070663_100053682 3300005455 Bacteria 2878
43 Ga0070678_100139955 3300005456 Bacteria 1935
44 Ga0070678_101054797 3300005456 Bacteria 749
45 Ga0070662_100010177 3300005457 Bacteria 6165
46 Ga0070681_11384176 3300005458 Bacteria 627
47 Ga0070706_100634704 3300005467 Bacteria 992
48 Ga0070707_100032907 3300005468 Bacteria 4940
49 Ga0070707_100333865 3300005468 Bacteria 1473
50 Ga0070698_100560557 3300005471 Bacteria 1082
51 Ga0070699_100004196 3300005518 Bacteria 12751
52 Ga0070684_100035795 3300005535 Bacteria 4251
53 Ga0070684_100539304 3300005535 Bacteria 1082
54 Ga0070684_101679122 3300005535 Bacteria 599
55 Ga0070686_100947256 3300005544 Bacteria 703
56 Ga0070696_100320146 3300005546 Bacteria 1193
57 Ga0070693_101415244 3300005547 Unclassified 541
58 Ga0070665_101184584 3300005548 Bacteria 775
59 Ga0070665_101224374 3300005548 Unclassified 761
60 Ga0070665_102352295 3300005548 Unclassified 535
61 Ga0068855_101779795 3300005563 Bacteria 626
62 Ga0070664_100003607 3300005564 Bacteria 12469
63 Ga0070664_100659162 3300005564 Bacteria 973
64 Ga0070664_101146553 3300005564 Bacteria 733
65 Ga0068857_100010543 3300005577 Bacteria 8034
66 Ga0068854_100303156 3300005578 Bacteria 1293
67 Ga0068856_100283314 3300005614 Bacteria 1674
68 Ga0070702_100037710 3300005615 Bacteria 2685
69 Ga0070702_100985149 3300005615 Bacteria 666
70 Ga0068852_100892224 3300005616 Bacteria 906
71 Ga0068852_101158270 3300005616 Bacteria 794
72 Ga0068859_100434232 3300005617 Bacteria 1409
73 Ga0068864_100206979 3300005618 Bacteria 1805
74 Ga0068861_100604567 3300005719 Bacteria 1007
75 Ga0068863_100228185 3300005841 Bacteria 1795
76 Ga0068863_102581873 3300005841 Bacteria 517
77 Ga0068858_100021295 3300005842 Bacteria 6055
78 Ga0068858_100078913 3300005842 Bacteria 3059
79 Ga0068860_100471504 3300005843 Bacteria 1250
80 Ga0068862_101143294 3300005844 Bacteria 775
81 Ga0081455_10112024 3300005937 Bacteria 2167
82 Ga0081455_10343453 3300005937 Bacteria 1055
83 Ga0081455_10408656 3300005937 Bacteria 940
84 Ga0081538_10022862 3300005981 Bacteria 4513
85 Ga0081538_10024593 3300005981 Bacteria 4286
86 Ga0081538_10025060 3300005981 Bacteria 4224
87 Ga0081538_10039732 3300005981 Bacteria 3012
88 Ga0081540_1004915 3300005983 Bacteria 10063
89 Ga0081539_10002046 3300005985 Bacteria 30317
90 Ga0070717_10121118 3300006028 Bacteria 2241
91 Ga0070717_10281719 3300006028 Bacteria 1474
92 Ga0070717_10336878 3300006028 Bacteria 1346
93 Ga0075365_10268486 3300006038 Unclassified 1200
94 Ga0075364_10413783 3300006051 Bacteria 920
95 Ga0070715_10071700 3300006163 Bacteria 1549
96 Ga0070715_10085499 3300006163 Bacteria 1441
97 Ga0070715_10375693 3300006163 Unclassified 783
98 Ga0070716_100026965 3300006173 Bacteria 3081
99 Ga0070716_100134183 3300006173 Bacteria 1569
100 Ga0070712_100790910 3300006175 Unclassified 813
101 Ga0075367_10493257 3300006178 Bacteria 777
102 Ga0097621_100535019 3300006237 Bacteria 1065
103 Ga0097621_100573390 3300006237 Unclassified 1029
104 Ga0068871_100498986 3300006358 Bacteria 1097
105 Ga0075430_100219032 3300006846 Bacteria 1579
106 Ga0075431_100351972 3300006847 Bacteria 1481
107 Ga0075431_100555623 3300006847 Bacteria 1135
108 Ga0075433_10746401 3300006852 Bacteria 856
109 Ga0075434_102323502 3300006871 Unclassified 539
110 Ga0075429_100517588 3300006880 Bacteria 1045
111 Ga0068865_100146168 3300006881 Bacteria 1788
112 Ga0068865_100485791 3300006881 Bacteria 1027
113 Ga0075436_100606396 3300006914 Bacteria 807
114 Ga0097620_100434247 3300006931 Bacteria 1409
115 Ga0075435_100188385 3300007076 Bacteria 1745
116 Ga0105240_11403776 3300009093 Bacteria 734
117 Ga0111539_10034656 3300009094 Bacteria 6117
118 Ga0111539_10126683 3300009094 Bacteria 2991
119 Ga0105245_10006478 3300009098 Bacteria 10294
120 Ga0105245_10203894 3300009098 Bacteria 1901
121 Ga0114129_10373616 3300009147 Bacteria 1884
122 Ga0105243_10255226 3300009148 Bacteria 1567
123 Ga0105248_13452838 3300009177 Bacteria 502
124 Ga0105237_10360579 3300009545 Bacteria 1458
125 Ga0105238_10129984 3300009551 Bacteria 2496
126 Ga0105238_10484555 3300009551 Bacteria 1236
127 Ga0105249_10069890 3300009553 Bacteria 3241
128 Ga0105249_10343465 3300009553 Bacteria 1510
129 Ga0105249_11547899 3300009553 Bacteria 735
130 Ga0105239_10060179 3300010375 Bacteria 4168
131 Ga0105239_10377299 3300010375 Bacteria 1603
132 Ga0105239_11777320 3300010375 Bacteria 714
133 Ga0105246_10085742 3300011119 Bacteria 2256
134 Ga0157370_10029499 3300013104 Bacteria 5381
135 Ga0157374_10112243 3300013296 Bacteria 2623
136 Ga0163162_10074199 3300013306 Bacteria 3460
137 Ga0157375_10144301 3300013308 Bacteria 2510
138 Ga0157375_12921787 3300013308 Bacteria 571
139 Ga0163163_10017651 3300014325 Bacteria 6662
140 Ga0157380_12664761 3300014326 Bacteria 566
141 Ga0157377_10001627 3300014745 Bacteria 9785
142 Ga0157377_10464181 3300014745 Bacteria 877
143 Ga0157379_10015275 3300014968 Bacteria 6734
144 Ga0157376_10115726 3300014969 Bacteria 2368
145 Ga0213874_10005600 3300021377 Unclassified 2936
146 Ga0213876_10027510 3300021384 Unclassified 3000
147 Ga0213876_10330606 3300021384 Unclassified 810
148 Ga0213876_10437375 3300021384 Unclassified 696
149 Ga0224712_10069960 3300022467 Bacteria 1422
150 Ga0207692_10045864 3300025898 Bacteria 2189
151 Ga0207692_10102159 3300025898 Bacteria 1576
152 Ga0207688_10076834 3300025901 Bacteria 1902
153 Ga0207685_10263936 3300025905 Unclassified 838
154 Ga0207685_10285870 3300025905 Bacteria 811
155 Ga0207699_10106384 3300025906 Bacteria 1790
156 Ga0207699_11282480 3300025906 Bacteria 542
157 Ga0207645_10659250 3300025907 Bacteria 711
158 Ga0207671_10136797 3300025914 Bacteria 1884
159 Ga0207671_10545329 3300025914 Bacteria 924
160 Ga0207693_10002068 3300025915 Bacteria 17538
161 Ga0207693_10060050 3300025915 Bacteria 2979
162 Ga0207663_10024634 3300025916 Bacteria 3467
163 Ga0207663_10098461 3300025916 Bacteria 1958
164 Ga0207663_10245863 3300025916 Bacteria 1314
165 Ga0207662_10873254 3300025918 Unclassified 636
166 Ga0207657_10026044 3300025919 Bacteria 5382
167 Ga0207657_11252035 3300025919 Bacteria 562
168 Ga0207649_10007609 3300025920 Bacteria 5891
169 Ga0207646_10077418 3300025922 Bacteria 2972
170 Ga0207646_10492988 3300025922 Bacteria 1104
171 Ga0207681_10584115 3300025923 Bacteria 922
172 Ga0207694_10057901 3300025924 Bacteria 3014
173 Ga0207694_10328122 3300025924 Bacteria 1264
174 Ga0207650_10131987 3300025925 Bacteria 1955
175 Ga0207659_10020891 3300025926 Bacteria 4336
176 Ga0207687_10098744 3300025927 Bacteria 2144
177 Ga0207700_10021782 3300025928 Bacteria 4383
178 Ga0207700_10106097 3300025928 Bacteria 2251
179 Ga0207700_10126339 3300025928 Bacteria 2081
180 Ga0207700_11529506 3300025928 Bacteria 592
181 Ga0207664_10006223 3300025929 Bacteria 8197
182 Ga0207664_10298697 3300025929 Bacteria 1416
183 Ga0207664_10336201 3300025929 Unclassified 1335
184 Ga0207664_11665116 3300025929 Bacteria 560
185 Ga0207690_10473745 3300025932 Bacteria 1010
186 Ga0207690_10498776 3300025932 Bacteria 984
187 Ga0207706_10019591 3300025933 Bacteria 6086
188 Ga0207709_10460083 3300025935 Unclassified 985
189 Ga0207704_10238742 3300025938 Bacteria 1356
190 Ga0207704_10611595 3300025938 Bacteria 893
191 Ga0207665_10026207 3300025939 Bacteria 3848
192 Ga0207665_10069811 3300025939 Bacteria 2396
193 Ga0207665_10185519 3300025939 Bacteria 1509
194 Ga0207689_10668574 3300025942 Bacteria 875
195 Ga0207661_10197315 3300025944 Bacteria 1768
196 Ga0207661_11644476 3300025944 Bacteria 587
197 Ga0207679_10060279 3300025945 Bacteria 2819
198 Ga0207667_11626659 3300025949 Bacteria 614
199 Ga0207712_11836282 3300025961 Unclassified 543
200 Ga0207668_10049614 3300025972 Bacteria 2887
201 Ga0207677_10026802 3300026023 Bacteria 3620
202 Ga0207677_10101520 3300026023 Bacteria 2118
203 Ga0207703_10062117 3300026035 Bacteria 3060
204 Ga0207703_10462015 3300026035 Bacteria 1187
205 Ga0207678_10044634 3300026067 Bacteria 3833
206 Ga0207708_10057409 3300026075 Bacteria 2969
207 Ga0207702_10049082 3300026078 Bacteria 3561
208 Ga0207702_10409792 3300026078 Bacteria 1309
209 Ga0207702_11273100 3300026078 Unclassified 729
210 Ga0207641_10166501 3300026088 Bacteria 2008
211 Ga0207641_11140480 3300026088 Bacteria 779
212 Ga0207674_10009169 3300026116 Bacteria 11347
213 Ga0207674_10111927 3300026116 Bacteria 2704
214 Ga0207675_100319889 3300026118 Bacteria 1514
215 Ga0207675_101307656 3300026118 Bacteria 745
216 Ga0207683_10149481 3300026121 Bacteria 2107
217 Ga0207683_10729758 3300026121 Bacteria 919
218 Ga0207698_10589919 3300026142 Bacteria 1094
219 Ga0207698_12075444 3300026142 Bacteria 582
220 Ga0207428_10063899 3300027907 Bacteria 2907
221 Ga0268265_10087568 3300028380 Bacteria 2478
222 Ga0268264_10628758 3300028381 Bacteria 1060
223 Ga0265318_10180995 3300028577 Bacteria 772
224 Ga0307515_10135846 3300028794 Bacteria 2675
225 Ga0265327_10006202 3300031251 Bacteria 9642
226 Ga0307408_100095274 3300031548 Bacteria 2256
227 Ga0307405_10048483 3300031731 Bacteria 2620
228 Ga0307405_10166497 3300031731 Bacteria 1567
229 Ga0307410_10034701 3300031852 Bacteria 3270
230 Ga0307410_11292616 3300031852 Bacteria 638
231 Ga0307406_10122542 3300031901 Bacteria 1810
232 Ga0307407_10939337 3300031903 Bacteria 665
233 Ga0307409_100158432 3300031995 Bacteria 1976
234 Ga0307409_100384587 3300031995 Bacteria 1335
235 Ga0307409_100618935 3300031995 Bacteria 1072
236 Ga0307409_100850976 3300031995 Bacteria 923
237 Ga0307409_101692776 3300031995 Bacteria 661
238 Ga0307416_100038565 3300032002 Bacteria 3687
239 Ga0307416_100788219 3300032002 Bacteria 1045
240 Ga0307414_10432291 3300032004 Bacteria 1150
241 Ga0307411_10020850 3300032005 Bacteria 3822
242 Ga0307415_100496992 3300032126 Bacteria 1065
243 Ga0373923_0112104 3300035111 Unclassified 1212
244 Ga0373953_0047555 3300035117 Bacteria 1726
245 Ga0373953_0093788 3300035117 Unclassified 1258
246 Ga0373954_0036556 3300035118 Bacteria 2280
247 Ga0373954_0056334 3300035118 Bacteria 1850
248 Ga0373956_0104246 3300035119 Unclassified 1318
249 Ga0373956_0545988 3300035119 Bacteria 553
250 Ga0373957_0106122 3300035120 Bacteria 1128
251 Ga0373955_0149872 3300035172 Bacteria 1372
252 Ga0373955_0847975 3300035172 Unclassified 562
253 Ga0373935_0179913 3300035692 Bacteria 1451
254 Ga0373947_0141289 3300035725 Bacteria 1544
255 Ga0373947_0464252 3300035725 Bacteria 858
256 Ga0373937_0230207 3300036401 Bacteria 1745
257 Ga0373937_0236767 3300036401 Unclassified 1719
258 Ga0373925_0122767 3300037068 Bacteria 2018
259 Ga0373925_0297920 3300037068 Bacteria 1301
260 Ga0373925_0686366 3300037068 Bacteria 844
261 Ga0436364_0642729 3300037853 Bacteria 2333
262 Ga0436365_0095687 3300039437 Unclassified 1601
263 Ga0436365_0452435 3300039437 Unclassified 844
264 Ga0436365_0959978 3300039437 Unclassified 800
265 Ga0436365_1086149 3300039437 Bacteria 5415
266 Ga0436365_1417417 3300039437 Bacteria 5482
267 Ga0436365_1816999 3300039437 Bacteria 3024
268 Ga0436363_0964834 3300039450 Bacteria 907
269 Ga0436363_1313035 3300039450 Bacteria 882
270 Ga0436363_1674390 3300039450 Bacteria 51173
271 Ga0436362_0727121 3300039453 Bacteria 651
272 Ga0436362_1159380 3300039453 Unclassified 642
273 Ga0436362_1185108 3300039453 Bacteria 1079
274 Ga0439465_0180920 3300041413 Bacteria 763
275 Ga0451839_0858136 3300041496 Bacteria 527
276 Ga0439448_0023130 3300042005 Bacteria 1936
277 Ga0439448_0055511 3300042005 Bacteria 1303
278 Ga0439455_0043765 3300042012 Bacteria 1154
279 Ga0439463_035966 3300042016 Bacteria 1254
280 Ga0439463_123789 3300042016 Bacteria 668
281 Ga0450888_020187 3300042126 Bacteria 845
282 Ga0439444_0006932 3300042437 Bacteria 1726
283 Ga0439460_0033417 3300042461 Bacteria 1477
284 Ga0439440_0008226 3300042993 Bacteria 2137
285 Ga0466970_0551777 3300044765 Unclassified 666
286 Ga0466967_0062726 3300045976 Bacteria 3300
287 Ga0466967_0729842 3300045976 Bacteria 982
288 Ga0466967_2484235 3300045976 Bacteria 513
289 Ga0495592_0557013 3300046454 Unclassified 704
290 Ga0495603_0178511 3300046455 Bacteria 1229
291 Ga0495629_0253656 3300046459 Bacteria 1210
292 Ga0495641_0112324 3300046461 Bacteria 1216
293 Ga0495641_0233590 3300046461 Bacteria 825
294 Ga0495651_0002129 3300046462 Bacteria 15315
295 Ga0495651_0010390 3300046462 Bacteria 7152
296 Ga0495580_1052638 3300046472 Archaea 517
297 Ga0495639_0219952 3300046475 Bacteria 933
298 Ga0495662_0276850 3300046476 Unclassified 826
299 Ga0495664_0099518 3300046477 Bacteria 1751
300 Ga0495608_0001555 3300046511 Bacteria 16384
301 Ga0495608_0048233 3300046511 Bacteria 2830
302 Ga0495608_0778478 3300046511 Bacteria 566
303 Ga0495618_0003152 3300046514 Bacteria 10359
304 Ga0495618_0007832 3300046514 Bacteria 6466
305 Ga0495628_0197228 3300046516 Unclassified 1518
306 Ga0495628_0200255 3300046516 Archaea 1505
307 Ga0495628_0434178 3300046516 Bacteria 955
308 Ga0495630_0077414 3300046517 Bacteria 2507
309 Ga0495652_0036115 3300046529 Bacteria 4298
310 Ga0495640_0035323 3300046533 Bacteria 3538
311 Ga0495640_0189374 3300046533 Bacteria 1308
312 Ga0495586_0383882 3300046535 Bacteria 808
313 Ga0495587_0002344 3300046536 Bacteria 12656
314 Ga0495587_0051259 3300046536 Bacteria 2440
315 Ga0495587_0366596 3300046536 Bacteria 802
316 Ga0495645_0097350 3300046543 Bacteria 2095
317 Ga0495645_0136440 3300046543 Bacteria 1716
318 Ga0495667_0001230 3300046559 Bacteria 16761
319 Ga0495667_0001423 3300046559 Bacteria 15747
320 Ga0495634_0015412 3300046642 Bacteria 5494
321 Ga0495634_0059596 3300046642 Bacteria 2542
322 Ga0495625_0398161 3300046660 Bacteria 861
323 Ga0495635_0015542 3300046663 Bacteria 5320
324 Ga0495635_0023911 3300046663 Bacteria 4258
325 Ga0495635_0193851 3300046663 Archaea 1379
326 Ga0495635_0719132 3300046663 Bacteria 647
327 Ga0495657_0034713 3300046675 Bacteria 3500
328 Ga0495599_0004753 3300046678 Bacteria 8072
329 Ga0495599_0092400 3300046678 Unclassified 1888
330 Ga0495599_0869982 3300046678 Bacteria 512
331 Ga0495623_0037709 3300046679 Bacteria 3091
332 Ga0495623_0038888 3300046679 Bacteria 3041
333 Ga0495646_0010659 3300046680 Bacteria 5839
334 Ga0495646_0120901 3300046680 Unclassified 1482
335 Ga0495658_0184369 3300046683 Bacteria 1296
336 Ga0495658_0403387 3300046683 Unclassified 872
337 Ga0495613_0062666 3300046689 Bacteria 2721
338 Ga0495613_0148447 3300046689 Bacteria 1673
339 Ga0495624_0167468 3300046690 Bacteria 1341
340 Ga0495600_0008914 3300046809 Bacteria 6180
341 Ga0495600_0018758 3300046809 Bacteria 4412
342 Ga0495581_0101199 3300047315 Bacteria 1674
343 Ga0495581_0416765 3300047315 Unclassified 783
344 Ga0495604_0003214 3300047317 Bacteria 13057
345 Ga0495604_0005796 3300047317 Bacteria 9801
346 Ga0495604_0399077 3300047317 Bacteria 906
347 Ga0495674_0007842 3300047319 Bacteria 10196
348 Ga0495680_0011793 3300047322 Bacteria 7720
349 Ga0495680_0012785 3300047322 Bacteria 7361
350 Ga0495680_0224420 3300047322 Archaea 1340
351 Ga0495680_0283696 3300047322 Bacteria 1166
352 Ga0495675_0122064 3300047444 Bacteria 1622
353 Ga0495684_0000775 3300047471 Bacteria 25881
354 Ga0495684_0006759 3300047471 Bacteria 8906
355 Ga0495593_0038916 3300047673 Bacteria 2567
356 Ga0495602_0015688 3300048088 Bacteria 7637
357 Ga0495602_0028686 3300048088 Bacteria 5320
358 Ga0495602_0432802 3300048088 Unclassified 932
359 Ga0496100_0611843 3300048903 Bacteria 847
360 Ga0496101_1466981 3300048904 Bacteria 531
361 Ga0496102_0788931 3300048905 Unclassified 872
362 Ga0496104_0229730 3300048907 Bacteria 1767
363 Ga0496104_0244691 3300048907 Bacteria 1706
364 Ga0496105_0179036 3300048908 Bacteria 1736
365 Ga0496108_0035032 3300048911 Bacteria 4171
366 Ga0496108_0448898 3300048911 Bacteria 1127
367 Ga0496108_1160613 3300048911 Bacteria 654
368 Ga0496109_0035009 3300048912 Bacteria 4527
369 Ga0496109_1300686 3300048912 Bacteria 663
370 Ga0496110_0501017 3300048913 Bacteria 1106
371 Ga0496111_0081061 3300048914 Bacteria 2369
372 Ga0496111_0561298 3300048914 Bacteria 838
373 Ga0496112_0639463 3300048915 Bacteria 994
374 Ga0496113_0199847 3300048916 Bacteria 1589
375 Ga0496114_1100443 3300048917 Bacteria 679
376 Ga0496115_0524171 3300048918 Bacteria 950
377 Ga0501031_0002316 3300049568 Bacteria 12062
378 Ga0501031_0048750 3300049568 Bacteria 2760
379 Ga0501031_0060399 3300049568 Bacteria 2470
380 Ga0501031_0133206 3300049568 Bacteria 1624
381 Ga0501032_0013911 3300049569 Bacteria 5709
382 Ga0501032_0042115 3300049569 Bacteria 3099
383 Ga0501032_0056020 3300049569 Unclassified 2651
384 Ga0501032_0142678 3300049569 Bacteria 1577
385 Ga0501032_0355172 3300049569 Bacteria 944
386 Ga0501033_0044435 3300049570 Bacteria 3307
387 Ga0501033_0057873 3300049570 Bacteria 2864
388 Ga0501034_0189738 3300049571 Bacteria 2018
389 Ga0501034_0454846 3300049571 Bacteria 1198
390 Ga0501036_0001001 3300049572 Bacteria 21361
391 Ga0501036_0007003 3300049572 Bacteria 9178
392 Ga0501036_0007942 3300049572 Bacteria 8683
393 Ga0501036_0031655 3300049572 Bacteria 4471
394 Ga0501036_0146489 3300049572 Bacteria 1992
395 Ga0501036_0157486 3300049572 Bacteria 1915
396 Ga0501036_0179766 3300049572 Bacteria 1781
397 Ga0501037_0022426 3300049573 Bacteria 4671
398 Ga0501037_0083911 3300049573 Unclassified 2308
399 Ga0501037_0091022 3300049573 Bacteria 2206
400 Ga0501037_0320242 3300049573 Unclassified 1074
401 Ga0501037_0679875 3300049573 Bacteria 686
402 Ga0501038_0003890 3300049574 Bacteria 13883
403 Ga0501038_0016112 3300049574 Bacteria 6784
404 Ga0501038_0030362 3300049574 Bacteria 4784
405 Ga0501038_0142199 3300049574 Bacteria 1962
406 Ga0501038_0171023 3300049574 Bacteria 1759
407 Ga0501038_0224865 3300049574 Bacteria 1496
408 Ga0501038_0862459 3300049574 Bacteria 670
409 Ga0501038_0883859 3300049574 Bacteria 660
410 Ga0501038_1319913 3300049574 Bacteria 520
411 Ga0501039_0006320 3300049575 Bacteria 8994
412 Ga0501039_0015299 3300049575 Bacteria 5872
413 Ga0501039_0027830 3300049575 Bacteria 4347
414 Ga0501039_0028687 3300049575 Bacteria 4285
415 Ga0501039_0050029 3300049575 Bacteria 3232
416 Ga0501039_0221006 3300049575 Unclassified 1489
417 Ga0501039_0748889 3300049575 Bacteria 763
418 Ga0501039_1108324 3300049575 Bacteria 613
419 Ga0501040_0001230 3300049576 Bacteria 16284
420 Ga0501040_0002734 3300049576 Bacteria 11360
421 Ga0501040_0008178 3300049576 Bacteria 6800
422 Ga0501040_0076409 3300049576 Unclassified 2315
423 Ga0501040_0089248 3300049576 Bacteria 2142
424 Ga0501040_0101981 3300049576 Unclassified 2002
425 Ga0501040_0203594 3300049576 Bacteria 1406
426 Ga0501040_0549949 3300049576 Bacteria 833
427 Ga0501041_0001967 3300049577 Bacteria 11553
428 Ga0501041_0005525 3300049577 Bacteria 7396
429 Ga0501041_0025859 3300049577 Bacteria 3529
430 Ga0501041_0056620 3300049577 Bacteria 2396
431 Ga0501041_0149264 3300049577 Bacteria 1459
432 Ga0501041_0327247 3300049577 Bacteria 967
433 Ga0501042_0007393 3300049578 Bacteria 7193
434 Ga0501042_0009114 3300049578 Bacteria 6596
435 Ga0501042_0009725 3300049578 Bacteria 6422
436 Ga0501042_0018338 3300049578 Bacteria 4843
437 Ga0501042_0127337 3300049578 Bacteria 1834
438 Ga0501042_0339900 3300049578 Bacteria 1085
439 Ga0501042_0468656 3300049578 Bacteria 914
440 Ga0501042_0834250 3300049578 Bacteria 671
441 Ga0501043_0014409 3300049579 Bacteria 6188
442 Ga0501043_0021543 3300049579 Bacteria 5055
443 Ga0501043_0154070 3300049579 Bacteria 1798
444 Ga0501043_0648216 3300049579 Bacteria 776
445 Ga0501043_0673227 3300049579 Bacteria 758
446 Ga0501046_0001562 3300049580 Bacteria 21884
447 Ga0501046_0026569 3300049580 Bacteria 4728
448 Ga0501046_0037482 3300049580 Bacteria 3895
449 Ga0501046_0096379 3300049580 Unclassified 2272
450 Ga0501046_0391076 3300049580 Bacteria 1005
451 Ga0501047_1047054 3300049581 Bacteria 629
452 Ga0501048_0000658 3300049582 Bacteria 24898
453 Ga0501048_0003614 3300049582 Bacteria 11783
454 Ga0501048_0009771 3300049582 Bacteria 7193
455 Ga0501048_0019079 3300049582 Bacteria 5037
456 Ga0501048_0318894 3300049582 Bacteria 1107
457 Ga0501048_0409043 3300049582 Bacteria 970
458 Ga0501048_0570141 3300049582 Bacteria 812
459 Ga0501068_0054956 3300049584 Bacteria 2412
460 Ga0501068_0085558 3300049584 Bacteria 1940
461 Ga0501068_0319005 3300049584 Bacteria 996
462 Ga0501069_0012649 3300049585 Bacteria 4490
463 Ga0501069_0114273 3300049585 Bacteria 1539
464 Ga0501069_0212748 3300049585 Unclassified 1122
465 Ga0501069_0640362 3300049585 Unclassified 639
466 Ga0501070_0085771 3300049586 Bacteria 2607
467 Ga0501070_0212774 3300049586 Bacteria 1586
468 Ga0501070_0432130 3300049586 Bacteria 1063
469 Ga0501070_0584561 3300049586 Unclassified 891
470 Ga0501071_0000168 3300049587 Bacteria 28360
471 Ga0501071_0003789 3300049587 Bacteria 9502
472 Ga0501071_0005328 3300049587 Bacteria 8258
473 Ga0501071_0018078 3300049587 Bacteria 4874
474 Ga0501071_0096089 3300049587 Unclassified 2181
475 Ga0501071_0184326 3300049587 Bacteria 1564
476 Ga0501071_0346034 3300049587 Bacteria 1131
477 Ga0501071_0446807 3300049587 Bacteria 989
478 Ga0501071_0632649 3300049587 Bacteria 823
479 Ga0501071_1075921 3300049587 Bacteria 621
480 Ga0501071_1342606 3300049587 Bacteria 552
481 Ga0501072_0000363 3300049588 Bacteria 32287
482 Ga0501072_0005088 3300049588 Bacteria 10009
483 Ga0501072_0029065 3300049588 Bacteria 4315
484 Ga0501072_0051684 3300049588 Bacteria 3235
485 Ga0501072_0177204 3300049588 Bacteria 1700
486 Ga0501072_0430355 3300049588 Bacteria 1046
487 Ga0501072_0582523 3300049588 Bacteria 882
488 Ga0501072_1559563 3300049588 Unclassified 509
489 Ga0501073_0129114 3300049589 Bacteria 1752
490 Ga0501073_0247814 3300049589 Bacteria 1230
491 Ga0501074_0004175 3300049590 Bacteria 10319
492 Ga0501074_0005090 3300049590 Bacteria 9440
493 Ga0501074_0063818 3300049590 Bacteria 2653
494 Ga0501075_0017594 3300049591 Bacteria 5162
495 Ga0501075_0025251 3300049591 Bacteria 4365
496 Ga0501075_0038005 3300049591 Bacteria 3598
497 Ga0501075_0042522 3300049591 Bacteria 3407
498 Ga0501075_0073873 3300049591 Bacteria 2579
499 Ga0501075_0131624 3300049591 Bacteria 1906
500 Ga0501075_0253477 3300049591 Bacteria 1341
501 Ga0501075_0472052 3300049591 Unclassified 957
502 Ga0501075_0843736 3300049591 Bacteria 697
503 Ga0501076_0000503 3300049592 Bacteria 24750
504 Ga0501076_0007299 3300049592 Bacteria 8043
505 Ga0501076_0011368 3300049592 Bacteria 6627
506 Ga0501076_0021881 3300049592 Bacteria 4910
507 Ga0501076_0128288 3300049592 Bacteria 2056
508 Ga0501076_1258601 3300049592 Bacteria 609
509 Ga0501077_0000434 3300049593 Bacteria 25322
510 Ga0501077_0012604 3300049593 Bacteria 5294
511 Ga0501077_0027697 3300049593 Bacteria 3598
512 Ga0501077_0116240 3300049593 Bacteria 1695
513 Ga0501077_0556779 3300049593 Bacteria 736
514 Ga0501079_0000072 3300049741 Bacteria 46737
515 Ga0501079_0015419 3300049741 Bacteria 5831
516 Ga0501079_0017881 3300049741 Bacteria 5415
517 Ga0501079_0149972 3300049741 Unclassified 1817
518 Ga0501079_0522966 3300049741 Bacteria 933
519 Ga0501079_0794644 3300049741 Bacteria 745
520 Ga0501080_0007813 3300049742 Bacteria 9674
521 Ga0501080_0019209 3300049742 Bacteria 6328
522 Ga0501080_0090126 3300049742 Bacteria 2849
523 Ga0501080_0251397 3300049742 Bacteria 1612
524 Ga0501080_0266467 3300049742 Bacteria 1560
525 Ga0501080_0396937 3300049742 Bacteria 1241
526 Ga0501081_0001036 3300049743 Bacteria 16624
527 Ga0501081_0023825 3300049743 Bacteria 4105
528 Ga0501081_0063188 3300049743 Bacteria 2569
529 Ga0501081_0107128 3300049743 Unclassified 1982
530 Ga0501081_0225171 3300049743 Bacteria 1365
531 Ga0501081_0425494 3300049743 Unclassified 985
532 Ga0501083_0005449 3300049744 Bacteria 9012
533 Ga0501083_0428275 3300049744 Bacteria 861
534 Ga0501083_0703471 3300049744 Bacteria 657
535 Ga0501035_0020568 3300049822 Bacteria 6061
536 Ga0501035_0023824 3300049822 Bacteria 5617
537 Ga0501035_0875592 3300049822 Unclassified 713
538 Ga0501044_0089368 3300049823 Bacteria 3109
539 Ga0501044_0144575 3300049823 Bacteria 2365
540 Ga0501044_0197017 3300049823 Bacteria 1974
541 Ga0501044_0254288 3300049823 Bacteria 1697
542 Ga0501045_0000448 3300049824 Bacteria 25394
543 Ga0501045_0007314 3300049824 Bacteria 7671
544 Ga0501045_0024155 3300049824 Bacteria 4363
545 Ga0501045_0068240 3300049824 Bacteria 2612
546 Ga0501045_0069500 3300049824 Bacteria 2589
547 Ga0501045_1110211 3300049824 Bacteria 578
548 Ga0501045_1166037 3300049824 Bacteria 563
549 Ga0501045_1303604 3300049824 Bacteria 528
550 nmdc:mga0yw44_100424_c1 3300050492 Bacteria 1842
551 nmdc:mga0k408_382696_c1 3300050493 Bacteria 838
552 nmdc:mga06z11_298142_c1 3300050494 Bacteria 958
553 nmdc:mga09592_453237_c1 3300050508 Bacteria 1107
554 nmdc:mga0qj67_282164_c1 3300050509 Bacteria 1346
555 nmdc:mga06r32_15644_c1 3300050510 Bacteria 6893
556 nmdc:mga06r32_944532_c1 3300050510 Bacteria 817
557 nmdc:mga06r32_95259_c1 3300050510 Bacteria 2913
558 nmdc:mga08y16_125441_c1 3300050511 Unclassified 2671
559 nmdc:mga08y16_81795_c1 3300050511 Bacteria 3367
560 nmdc:mga0rr50_212993_c1 3300050513 Bacteria 1592
561 Ga0495601_0102175 3300053077 Bacteria 1852
562 Ga0495601_0261608 3300053077 Archaea 1129
563 Ga0495612_0073642 3300053078 Bacteria 1427
564 Ga0500635_0158959 3300053080 Unclassified 866
565 Ga0495595_0076227 3300053084 Unclassified 1591
566 Ga0495595_0219154 3300053084 Bacteria 949
567 Ga0495619_0033372 3300053085 Bacteria 3342
568 Ga0495619_0284131 3300053085 Bacteria 1146
569 Ga0495619_0628062 3300053085 Archaea 734
570 Ga0495619_0908584 3300053085 Bacteria 592
571 Ga0500641_0021245 3300053096 Bacteria 2472
572 Ga0500554_004626 3300053102 Bacteria 2932
573 Ga0500554_040203 3300053102 Bacteria 1432
574 Ga0500588_0013234 3300053146 Bacteria 2066
575 Ga0500630_047580 3300053159 Bacteria 2079
576 Ga0501084_0004055 3300054114 Bacteria 11928
577 Ga0501084_0006635 3300054114 Bacteria 9520
578 Ga0501084_0016176 3300054114 Bacteria 6194
579 Ga0501084_0173819 3300054114 Bacteria 1818
580 Ga0501084_0180624 3300054114 Unclassified 1781
581 Ga0501084_0191428 3300054114 Bacteria 1726
582 Ga0501084_0307664 3300054114 Bacteria 1338
583 Ga0501084_1344047 3300054114 Bacteria 599
584 Ga0590075_088798 3300059424 Bacteria 802
585 Ga0501082_0006922 3300060353 Bacteria 9800
586 Ga0501082_0008405 3300060353 Bacteria 8905
587 Ga0501082_1592635 3300060353 Bacteria 570
588 Ga0466962_0411094 3300061719 Unclassified 678
589 Ga0530510_0000027 3300061734 Bacteria 65176
590 Ga0530510_0004966 3300061734 Bacteria 9188
591 Ga0530510_0027074 3300061734 Bacteria 4107
592 Ga0530510_0036464 3300061734 Bacteria 3545
593 Ga0530510_0097778 3300061734 Bacteria 2146
594 Ga0530510_0108012 3300061734 Bacteria 2037
595 Ga0530510_0120798 3300061734 Unclassified 1923
596 Ga0530510_0461048 3300061734 Bacteria 961
597 Ga0530510_1094178 3300061734 Bacteria 610
598 Ga0530510_1403699 3300061734 Bacteria 536
599 Ga0075430_100092670
600 JGI24735J21928_10090167
601 rootL2_10164362
602 JGI25407J50210_10040800
603 JGI25407J50210_10084073
604 Ga0070676_10752843
605 Ga0070683_101735145
606 Ga0070683_102242672
607 Ga0070670_100066237
608 Ga0068869_100320902
609 Ga0070682_100341999
610 Ga0068868_100017489
611 Ga0068868_101130132
612 Ga0070660_100020138
613 Ga0070691_10099270
614 Ga0070691_10395433
615 Ga0070687_100554469
616 Ga0070661_100098332
617 Ga0070692_10313260
618 Ga0070669_100123282
619 Ga0070675_100005116
620 Ga0070671_101656798
621 Ga0070674_100958503
622 Ga0070659_100511797
623 Ga0070709_10020516
624 Ga0070714_100132747
625 Ga0070714_100192175
626 Ga0070714_101715151
627 Ga0070713_100206298
628 Ga0070713_100498536
629 Ga0070713_100528998
630 Ga0070713_100699513
631 Ga0070710_10036380
632 Ga0070710_10082703
633 Ga0070710_10378870
634 Ga0070701_11246566
635 Ga0070711_100024566
636 Ga0070711_100066219
637 Ga0070694_101701957
638 Ga0070708_100523421
639 Ga0070708_101066913
640 Ga0070663_100053682
641 Ga0070678_100139955
642 Ga0070678_101054797
643 Ga0070662_100010177
644 Ga0070681_11384176
645 Ga0070706_100634704
646 Ga0070707_100032907
647 Ga0070707_100333865
648 Ga0070698_100560557
649 Ga0070699_100004196
650 Ga0070684_100035795
651 Ga0070684_100539304
652 Ga0070684_101679122
653 Ga0070686_100947256
654 Ga0070696_100320146
655 Ga0070693_101415244
656 Ga0070665_101184584
657 Ga0070665_101224374
658 Ga0070665_102352295
659 Ga0068855_101779795
660 Ga0070664_100003607
661 Ga0070664_100659162
662 Ga0070664_101146553
663 Ga0068857_100010543
664 Ga0068854_100303156
665 Ga0068856_100283314
666 Ga0070702_100037710
667 Ga0070702_100985149
668 Ga0068852_100892224
669 Ga0068852_101158270
670 Ga0068859_100434232
671 Ga0068864_100206979
672 Ga0068861_100604567
673 Ga0068863_100228185
674 Ga0068863_102581873
675 Ga0068858_100021295
676 Ga0068858_100078913
677 Ga0068860_100471504
678 Ga0068862_101143294
679 Ga0081455_10112024
680 Ga0081455_10343453
681 Ga0081455_10408656
682 Ga0081538_10022862
683 Ga0081538_10024593
684 Ga0081538_10025060
685 Ga0081538_10039732
686 Ga0081540_1004915
687 Ga0081539_10002046
688 Ga0070717_10121118
689 Ga0070717_10281719
690 Ga0070717_10336878
691 Ga0075365_10268486
692 Ga0075364_10413783
693 Ga0070715_10071700
694 Ga0070715_10085499
695 Ga0070715_10375693
696 Ga0070716_100026965
697 Ga0070716_100134183
698 Ga0070712_100790910
699 Ga0075367_10493257
700 Ga0097621_100535019
701 Ga0097621_100573390
702 Ga0068871_100498986
703 Ga0075430_100219032
704 Ga0075431_100351972
705 Ga0075431_100555623
706 Ga0075433_10746401
707 Ga0075434_102323502
708 Ga0075429_100517588
709 Ga0068865_100146168
710 Ga0068865_100485791
711 Ga0075436_100606396
712 Ga0097620_100434247
713 Ga0075435_100188385
714 Ga0105240_11403776
715 Ga0111539_10034656
716 Ga0111539_10126683
717 Ga0105245_10006478
718 Ga0105245_10203894
719 Ga0114129_10373616
720 Ga0105243_10255226
721 Ga0105248_13452838
722 Ga0105237_10360579
723 Ga0105238_10129984
724 Ga0105238_10484555
725 Ga0105249_10069890
726 Ga0105249_10343465
727 Ga0105249_11547899
728 Ga0105239_10060179
729 Ga0105239_10377299
730 Ga0105239_11777320
731 Ga0105246_10085742
732 Ga0157370_10029499
733 Ga0157374_10112243
734 Ga0163162_10074199
735 Ga0157375_10144301
736 Ga0157375_12921787
737 Ga0163163_10017651
738 Ga0157380_12664761
739 Ga0157377_10001627
740 Ga0157377_10464181
741 Ga0157379_10015275
742 Ga0157376_10115726
743 Ga0213874_10005600
744 Ga0213876_10027510
745 Ga0213876_10330606
746 Ga0213876_10437375
747 Ga0224712_10069960
748 Ga0207692_10045864
749 Ga0207692_10102159
750 Ga0207688_10076834
751 Ga0207685_10263936
752 Ga0207685_10285870
753 Ga0207699_10106384
754 Ga0207699_11282480
755 Ga0207645_10659250
756 Ga0207671_10136797
757 Ga0207671_10545329
758 Ga0207693_10002068
759 Ga0207693_10060050
760 Ga0207663_10024634
761 Ga0207663_10098461
762 Ga0207663_10245863
763 Ga0207662_10873254
764 Ga0207657_10026044
765 Ga0207657_11252035
766 Ga0207649_10007609
767 Ga0207646_10077418
768 Ga0207646_10492988
769 Ga0207681_10584115
770 Ga0207694_10057901
771 Ga0207694_10328122
772 Ga0207650_10131987
773 Ga0207659_10020891
774 Ga0207687_10098744
775 Ga0207700_10021782
776 Ga0207700_10106097
777 Ga0207700_10126339
778 Ga0207700_11529506
779 Ga0207664_10006223
780 Ga0207664_10298697
781 Ga0207664_10336201
782 Ga0207664_11665116
783 Ga0207690_10473745
784 Ga0207690_10498776
785 Ga0207706_10019591
786 Ga0207709_10460083
787 Ga0207704_10238742
788 Ga0207704_10611595
789 Ga0207665_10026207
790 Ga0207665_10069811
791 Ga0207665_10185519
792 Ga0207689_10668574
793 Ga0207661_10197315
794 Ga0207661_11644476
795 Ga0207679_10060279
796 Ga0207667_11626659
797 Ga0207712_11836282
798 Ga0207668_10049614
799 Ga0207677_10026802
800 Ga0207677_10101520
801 Ga0207703_10062117
802 Ga0207703_10462015
803 Ga0207678_10044634
804 Ga0207708_10057409
805 Ga0207702_10049082
806 Ga0207702_10409792
807 Ga0207702_11273100
808 Ga0207641_10166501
809 Ga0207641_11140480
810 Ga0207674_10009169
811 Ga0207674_10111927
812 Ga0207675_100319889
813 Ga0207675_101307656
814 Ga0207683_10149481
815 Ga0207683_10729758
816 Ga0207698_10589919
817 Ga0207698_12075444
818 Ga0207428_10063899
819 Ga0268265_10087568
820 Ga0268264_10628758
821 Ga0265318_10180995
822 Ga0307515_10135846
823 Ga0265327_10006202
824 Ga0307408_100095274
825 Ga0307405_10048483
826 Ga0307405_10166497
827 Ga0307410_10034701
828 Ga0307410_11292616
829 Ga0307406_10122542
830 Ga0307407_10939337
831 Ga0307409_100158432
832 Ga0307409_100384587
833 Ga0307409_100618935
834 Ga0307409_100850976
835 Ga0307409_101692776
836 Ga0307416_100038565
837 Ga0307416_100788219
838 Ga0307414_10432291
839 Ga0307411_10020850
840 Ga0307415_100496992
841 Ga0373923_0112104
842 Ga0373953_0047555
843 Ga0373953_0093788
844 Ga0373954_0036556
845 Ga0373954_0056334
846 Ga0373956_0104246
847 Ga0373956_0545988
848 Ga0373957_0106122
849 Ga0373955_0149872
850 Ga0373955_0847975
851 Ga0373935_0179913
852 Ga0373947_0141289
853 Ga0373947_0464252
854 Ga0373937_0230207
855 Ga0373937_0236767
856 Ga0373925_0122767
857 Ga0373925_0297920
858 Ga0373925_0686366
859 Ga0436364_0642729
860 Ga0436365_0095687
861 Ga0436365_0452435
862 Ga0436365_0959978
863 Ga0436365_1086149
864 Ga0436365_1417417
865 Ga0436365_1816999
866 Ga0436363_0964834
867 Ga0436363_1313035
868 Ga0436363_1674390
869 Ga0436362_0727121
870 Ga0436362_1159380
871 Ga0436362_1185108
872 Ga0439465_0180920
873 Ga0451839_0858136
874 Ga0439448_0023130
875 Ga0439448_0055511
876 Ga0439455_0043765
877 Ga0439463_035966
878 Ga0439463_123789
879 Ga0450888_020187
880 Ga0439444_0006932
881 Ga0439460_0033417
882 Ga0439440_0008226
883 Ga0466970_0551777
884 Ga0466967_0062726
885 Ga0466967_0729842
886 Ga0466967_2484235
887 Ga0495592_0557013
888 Ga0495603_0178511
889 Ga0495629_0253656
890 Ga0495641_0112324
891 Ga0495641_0233590
892 Ga0495651_0002129
893 Ga0495651_0010390
894 Ga0495580_1052638
895 Ga0495639_0219952
896 Ga0495662_0276850
897 Ga0495664_0099518
898 Ga0495608_0001555
899 Ga0495608_0048233
900 Ga0495608_0778478
901 Ga0495618_0003152
902 Ga0495618_0007832
903 Ga0495628_0197228
904 Ga0495628_0200255
905 Ga0495628_0434178
906 Ga0495630_0077414
907 Ga0495652_0036115
908 Ga0495640_0035323
909 Ga0495640_0189374
910 Ga0495586_0383882
911 Ga0495587_0002344
912 Ga0495587_0051259
913 Ga0495587_0366596
914 Ga0495645_0097350
915 Ga0495645_0136440
916 Ga0495667_0001230
917 Ga0495667_0001423
918 Ga0495634_0015412
919 Ga0495634_0059596
920 Ga0495625_0398161
921 Ga0495635_0015542
922 Ga0495635_0023911
923 Ga0495635_0193851
924 Ga0495635_0719132
925 Ga0495657_0034713
926 Ga0495599_0004753
927 Ga0495599_0092400
928 Ga0495599_0869982
929 Ga0495623_0037709
930 Ga0495623_0038888
931 Ga0495646_0010659
932 Ga0495646_0120901
933 Ga0495658_0184369
934 Ga0495658_0403387
935 Ga0495613_0062666
936 Ga0495613_0148447
937 Ga0495624_0167468
938 Ga0495600_0008914
939 Ga0495600_0018758
940 Ga0495581_0101199
941 Ga0495581_0416765
942 Ga0495604_0003214
943 Ga0495604_0005796
944 Ga0495604_0399077
945 Ga0495674_0007842
946 Ga0495680_0011793
947 Ga0495680_0012785
948 Ga0495680_0224420
949 Ga0495680_0283696
950 Ga0495675_0122064
951 Ga0495684_0000775
952 Ga0495684_0006759
953 Ga0495593_0038916
954 Ga0495602_0015688
955 Ga0495602_0028686
956 Ga0495602_0432802
957 Ga0496100_0611843
958 Ga0496101_1466981
959 Ga0496102_0788931
960 Ga0496104_0229730
961 Ga0496104_0244691
962 Ga0496105_0179036
963 Ga0496108_0035032
964 Ga0496108_0448898
965 Ga0496108_1160613
966 Ga0496109_0035009
967 Ga0496109_1300686
968 Ga0496110_0501017
969 Ga0496111_0081061
970 Ga0496111_0561298
971 Ga0496112_0639463
972 Ga0496113_0199847
973 Ga0496114_1100443
974 Ga0496115_0524171
975 Ga0501031_0002316
976 Ga0501031_0048750
977 Ga0501031_0060399
978 Ga0501031_0133206
979 Ga0501032_0013911
980 Ga0501032_0042115
981 Ga0501032_0056020
982 Ga0501032_0142678
983 Ga0501032_0355172
984 Ga0501033_0044435
985 Ga0501033_0057873
986 Ga0501034_0189738
987 Ga0501034_0454846
988 Ga0501036_0001001
989 Ga0501036_0007003
990 Ga0501036_0007942
991 Ga0501036_0031655
992 Ga0501036_0146489
993 Ga0501036_0157486
994 Ga0501036_0179766
995 Ga0501037_0022426
996 Ga0501037_0083911
997 Ga0501037_0091022
998 Ga0501037_0320242
999 Ga0501037_0679875
1000 Ga0501038_0003890
1001 Ga0501038_0016112
1002 Ga0501038_0030362
1003 Ga0501038_0142199
1004 Ga0501038_0171023
1005 Ga0501038_0224865
1006 Ga0501038_0862459
1007 Ga0501038_0883859
1008 Ga0501038_1319913
1009 Ga0501039_0006320
1010 Ga0501039_0015299
1011 Ga0501039_0027830
1012 Ga0501039_0028687
1013 Ga0501039_0050029
1014 Ga0501039_0221006
1015 Ga0501039_0748889
1016 Ga0501039_1108324
1017 Ga0501040_0001230
1018 Ga0501040_0002734
1019 Ga0501040_0008178
1020 Ga0501040_0076409
1021 Ga0501040_0089248
1022 Ga0501040_0101981
1023 Ga0501040_0203594
1024 Ga0501040_0549949
1025 Ga0501041_0001967
1026 Ga0501041_0005525
1027 Ga0501041_0025859
1028 Ga0501041_0056620
1029 Ga0501041_0149264
1030 Ga0501041_0327247
1031 Ga0501042_0007393
1032 Ga0501042_0009114
1033 Ga0501042_0009725
1034 Ga0501042_0018338
1035 Ga0501042_0127337
1036 Ga0501042_0339900
1037 Ga0501042_0468656
1038 Ga0501042_0834250
1039 Ga0501043_0014409
1040 Ga0501043_0021543
1041 Ga0501043_0154070
1042 Ga0501043_0648216
1043 Ga0501043_0673227
1044 Ga0501046_0001562
1045 Ga0501046_0026569
1046 Ga0501046_0037482
1047 Ga0501046_0096379
1048 Ga0501046_0391076
1049 Ga0501047_1047054
1050 Ga0501048_0000658
1051 Ga0501048_0003614
1052 Ga0501048_0009771
1053 Ga0501048_0019079
1054 Ga0501048_0318894
1055 Ga0501048_0409043
1056 Ga0501048_0570141
1057 Ga0501068_0054956
1058 Ga0501068_0085558
1059 Ga0501068_0319005
1060 Ga0501069_0012649
1061 Ga0501069_0114273
1062 Ga0501069_0212748
1063 Ga0501069_0640362
1064 Ga0501070_0085771
1065 Ga0501070_0212774
1066 Ga0501070_0432130
1067 Ga0501070_0584561
1068 Ga0501071_0000168
1069 Ga0501071_0003789
1070 Ga0501071_0005328
1071 Ga0501071_0018078
1072 Ga0501071_0096089
1073 Ga0501071_0184326
1074 Ga0501071_0346034
1075 Ga0501071_0446807
1076 Ga0501071_0632649
1077 Ga0501071_1075921
1078 Ga0501071_1342606
1079 Ga0501072_0000363
1080 Ga0501072_0005088
1081 Ga0501072_0029065
1082 Ga0501072_0051684
1083 Ga0501072_0177204
1084 Ga0501072_0430355
1085 Ga0501072_0582523
1086 Ga0501072_1559563
1087 Ga0501073_0129114
1088 Ga0501073_0247814
1089 Ga0501074_0004175
1090 Ga0501074_0005090
1091 Ga0501074_0063818
1092 Ga0501075_0017594
1093 Ga0501075_0025251
1094 Ga0501075_0038005
1095 Ga0501075_0042522
1096 Ga0501075_0073873
1097 Ga0501075_0131624
1098 Ga0501075_0253477
1099 Ga0501075_0472052
1100 Ga0501075_0843736
1101 Ga0501076_0000503
1102 Ga0501076_0007299
1103 Ga0501076_0011368
1104 Ga0501076_0021881
1105 Ga0501076_0128288
1106 Ga0501076_1258601
1107 Ga0501077_0000434
1108 Ga0501077_0012604
1109 Ga0501077_0027697
1110 Ga0501077_0116240
1111 Ga0501077_0556779
1112 Ga0501079_0000072
1113 Ga0501079_0015419
1114 Ga0501079_0017881
1115 Ga0501079_0149972
1116 Ga0501079_0522966
1117 Ga0501079_0794644
1118 Ga0501080_0007813
1119 Ga0501080_0019209
1120 Ga0501080_0090126
1121 Ga0501080_0251397
1122 Ga0501080_0266467
1123 Ga0501080_0396937
1124 Ga0501081_0001036
1125 Ga0501081_0023825
1126 Ga0501081_0063188
1127 Ga0501081_0107128
1128 Ga0501081_0225171
1129 Ga0501081_0425494
1130 Ga0501083_0005449
1131 Ga0501083_0428275
1132 Ga0501083_0703471
1133 Ga0501035_0020568
1134 Ga0501035_0023824
1135 Ga0501035_0875592
1136 Ga0501044_0089368
1137 Ga0501044_0144575
1138 Ga0501044_0197017
1139 Ga0501044_0254288
1140 Ga0501045_0000448
1141 Ga0501045_0007314
1142 Ga0501045_0024155
1143 Ga0501045_0068240
1144 Ga0501045_0069500
1145 Ga0501045_1110211
1146 Ga0501045_1166037
1147 Ga0501045_1303604
1148 nmdc:mga0yw44_100424_c1
1149 nmdc:mga0k408_382696_c1
1150 nmdc:mga06z11_298142_c1
1151 nmdc:mga09592_453237_c1
1152 nmdc:mga0qj67_282164_c1
1153 nmdc:mga06r32_15644_c1
1154 nmdc:mga06r32_944532_c1
1155 nmdc:mga06r32_95259_c1
1156 nmdc:mga08y16_125441_c1
1157 nmdc:mga08y16_81795_c1
1158 nmdc:mga0rr50_212993_c1
1159 Ga0495601_0102175
1160 Ga0495601_0261608
1161 Ga0495612_0073642
1162 Ga0500635_0158959
1163 Ga0495595_0076227
1164 Ga0495595_0219154
1165 Ga0495619_0033372
1166 Ga0495619_0284131
1167 Ga0495619_0628062
1168 Ga0495619_0908584
1169 Ga0500641_0021245
1170 Ga0500554_004626
1171 Ga0500554_040203
1172 Ga0500588_0013234
1173 Ga0500630_047580
1174 Ga0501084_0004055
1175 Ga0501084_0006635
1176 Ga0501084_0016176
1177 Ga0501084_0173819
1178 Ga0501084_0180624
1179 Ga0501084_0191428
1180 Ga0501084_0307664
1181 Ga0501084_1344047
1182 Ga0590075_088798
1183 Ga0501082_0006922
1184 Ga0501082_0008405
1185 Ga0501082_1592635
1186 Ga0466962_0411094
1187 Ga0530510_0000027
1188 Ga0530510_0004966
1189 Ga0530510_0027074
1190 Ga0530510_0036464
1191 Ga0530510_0097778
1192 Ga0530510_0108012
1193 Ga0530510_0120798
1194 Ga0530510_0461048
1195 Ga0530510_1094178
1196 Ga0530510_1403699

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

16

65

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

18

64

0.96

PF01978

TrmB

Sugar-specific transcriptional regulator TrmB

23

77

0.91

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

18

62

0.91

PF09339

HTH_IclR

IclR helix-turn-helix domain

23

66

0.87

PF08279

HTH_11

HTH domain

20

81

0.86

PF12802

MarR_2

MarR family

16

72

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9486 18 73
1sfu-assembly1.cif.gz_B crystal structure of the viral zalpha domain bound to left-handed z-dna 0.9312 29 72
2quf-assembly1.cif.gz_A crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus 0.9305 13 73
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9287 18 73
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.927 21 73
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9728 17 72 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.963 13 75 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 15 71 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9486 18 73 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9449 9 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0H5CYU2-F1-model_v4 Transcriptional regulator, ArsR family 0.9879 6 89 GO:0003700
AF-A0A1Y4RKQ4-F1-model_v4 HTH arsR-type domain-containing protein 0.9649 4 90 GO:0003700
AF-A0A538JLE8-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9619 4 100 GO:0003700
AF-A0A7D7VF50-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9619 2 86 GO:0003700
AF-A0A6A7LP56-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9618 4 89 GO:0003700

Map