F467762

General Info

Members Datasets Scaffolds Average Seq Length
598 264 592 339

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100210892|Ga0068859_1002108922
Length 386
Sequence MSELVDGTGTAGVPACYKTTKIIVGYRAGEDDCVPSNSDIIMTNCFNNWNWQPPSLWQKITTIEMHTGGEPLRVFVFGLPPIEGNTVLEKRRYFREHYDHIRKGTMWEPRGHADMYGAVVTQSRDADLDVFFLHNEGYSTMCGHAIIALTKLAIETGLVGKPLERRQLTINVPAGRIKAEARVANGKVCETSFHNVASFLYLRDQEVDVPGIGLVRFDVSYGGAFYAFVDAASVGVRLVAEDLPRLIDYGRRIKHAVMENFPIKHPFEDDLSFLYGTIFTGPALDLAHHSRNVCIFADGEVDRSATGSGVSARAALHHAKSELNVGEKITIESIVGSTMGVKVVELTRFGPYDAVIPEVSGTASFTGRNEFWFDPEDEFGNGFILR

Samples

Sample ID Description Type Environment
1 2511231012 Pseudomonas sp. GM33 Isolate Nodule
2 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
3 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
4 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
175 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
176 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
188 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
189 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
190 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
229 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
230 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
231 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
232 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
233 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
234 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
235 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
236 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
239 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
244 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.17
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0.67
Rhizoplane 1.17
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000222 3300002459 Bacteria 23862
2 Ga0065714_10064524 3300005288 Bacteria 41924
3 Ga0065704_10006628 3300005289 Unclassified 3966
4 Ga0065712_10003097 3300005290 Bacteria 5385
5 Ga0065715_10092098 3300005293 Bacteria 5337
6 Ga0065707_10003075 3300005295 Bacteria 6028
7 Ga0065707_10084860 3300005295 Bacteria 6702
8 Ga0065707_10110044 3300005295 Unclassified 2446
9 Ga0070676_10163523 3300005328 Bacteria 1434
10 Ga0070690_100000760 3300005330 Bacteria 16501
11 Ga0070690_100006762 3300005330 Bacteria 6516
12 Ga0070690_100130591 3300005330 Unclassified 1696
13 Ga0070670_100001195 3300005331 Bacteria 20613
14 Ga0070670_100018076 3300005331 Bacteria 6051
15 Ga0070670_100030144 3300005331 Unclassified 4672
16 Ga0070670_100285265 3300005331 Bacteria 1442
17 Ga0068869_100003816 3300005334 Bacteria 9292
18 Ga0068869_100150773 3300005334 Bacteria 1803
19 Ga0068869_100234814 3300005334 Bacteria 1458
20 Ga0070666_10010982 3300005335 Bacteria 5675
21 Ga0070680_100004282 3300005336 Bacteria 10720
22 Ga0070680_100140926 3300005336 Bacteria 2022
23 Ga0070682_100012841 3300005337 Bacteria 4807
24 Ga0070682_100042271 3300005337 Bacteria 2812
25 Ga0070682_100075823 3300005337 Bacteria 2164
26 Ga0070689_100000404 3300005340 Bacteria 25404
27 Ga0070689_100007201 3300005340 Bacteria 7756
28 Ga0070687_100002878 3300005343 Bacteria 6577
29 Ga0070687_100003900 3300005343 Bacteria 5865
30 Ga0070687_100014864 3300005343 Unclassified 3506
31 Ga0070687_100039038 3300005343 Unclassified 2383
32 Ga0070661_100001230 3300005344 Bacteria 18024
33 Ga0070692_10029218 3300005345 Bacteria 2746
34 Ga0070692_10112942 3300005345 Bacteria 1505
35 Ga0070692_10162640 3300005345 Unclassified 1280
36 Ga0070668_100190783 3300005347 Bacteria 1678
37 Ga0070669_100004587 3300005353 Bacteria 9976
38 Ga0070675_100001429 3300005354 Bacteria 17548
39 Ga0070671_100003274 3300005355 Bacteria 12633
40 Ga0070671_100012305 3300005355 Bacteria 6889
41 Ga0070671_100021163 3300005355 Bacteria 5311
42 Ga0070674_100068546 3300005356 Bacteria 2500
43 Ga0070673_100020327 3300005364 Bacteria 4788
44 Ga0070673_100021702 3300005364 Bacteria 4663
45 Ga0070673_100024258 3300005364 Bacteria 4444
46 Ga0070673_100094861 3300005364 Bacteria 2446
47 Ga0070673_100241716 3300005364 Bacteria 1570
48 Ga0070688_100035449 3300005365 Bacteria 3031
49 Ga0070667_100012250 3300005367 Bacteria 7094
50 Ga0070667_100040393 3300005367 Bacteria 3912
51 Ga0070667_100086764 3300005367 Bacteria 2685
52 Ga0070667_100128215 3300005367 Unclassified 2213
53 Ga0070703_10000303 3300005406 Bacteria 22520
54 Ga0070703_10003997 3300005406 Bacteria 4168
55 Ga0070709_10194063 3300005434 Bacteria 1434
56 Ga0070705_100007443 3300005440 Bacteria 5387
57 Ga0070700_100000101 3300005441 Bacteria 53894
58 Ga0070700_100006078 3300005441 Bacteria 6429
59 Ga0070700_100020541 3300005441 Unclassified 3827
60 Ga0070700_100035285 3300005441 Bacteria 3026
61 Ga0070700_100044878 3300005441 Bacteria 2724
62 Ga0070694_100009983 3300005444 Bacteria 5836
63 Ga0070694_100016632 3300005444 Unclassified 4632
64 Ga0070694_100019151 3300005444 Bacteria 4353
65 Ga0070694_100075578 3300005444 Bacteria 2330
66 Ga0070694_100079753 3300005444 Bacteria 2273
67 Ga0070694_100182738 3300005444 Bacteria 1552
68 Ga0070694_100270238 3300005444 Unclassified 1293
69 Ga0070708_100016668 3300005445 Bacteria 6105
70 Ga0070708_100151474 3300005445 Bacteria 2157
71 Ga0070678_100034748 3300005456 Bacteria 3513
72 Ga0070678_100105237 3300005456 Bacteria 2196
73 Ga0070681_10001279 3300005458 Bacteria 21955
74 Ga0068867_100012328 3300005459 Bacteria 6048
75 Ga0068867_100118406 3300005459 Unclassified 2043
76 Ga0068867_100134260 3300005459 Bacteria 1927
77 Ga0068867_100247547 3300005459 Bacteria 1448
78 Ga0070685_10020641 3300005466 Bacteria 3566
79 Ga0070706_100000436 3300005467 Bacteria 50128
80 Ga0070707_100037385 3300005468 Bacteria 4633
81 Ga0070698_100033518 3300005471 Bacteria 5318
82 Ga0070698_100042506 3300005471 Bacteria 4662
83 Ga0070699_100004454 3300005518 Bacteria 12385
84 Ga0070699_100015657 3300005518 Bacteria 6513
85 Ga0070699_100080573 3300005518 Bacteria 2837
86 Ga0070679_100002107 3300005530 Bacteria 17921
87 Ga0070684_100094857 3300005535 Bacteria 2658
88 Ga0070697_100054555 3300005536 Bacteria 3249
89 Ga0070697_100360136 3300005536 Unclassified 1257
90 Ga0070672_100004458 3300005543 Bacteria 9168
91 Ga0070672_100063823 3300005543 Unclassified 2908
92 Ga0070686_100000900 3300005544 Bacteria 17298
93 Ga0070686_100007985 3300005544 Bacteria 5914
94 Ga0070695_100114680 3300005545 Bacteria 1835
95 Ga0070696_100103444 3300005546 Bacteria 2043
96 Ga0070696_100157438 3300005546 Bacteria 1671
97 Ga0070693_100008726 3300005547 Bacteria 5017
98 Ga0070693_100167270 3300005547 Bacteria 1405
99 Ga0070665_100062296 3300005548 Bacteria 3740
100 Ga0070704_100018543 3300005549 Unclassified 4453
101 Ga0070704_100076016 3300005549 Bacteria 2455
102 Ga0070704_100097516 3300005549 Bacteria 2206
103 Ga0070664_100020875 3300005564 Bacteria 5396
104 Ga0070664_100100011 3300005564 Bacteria 2521
105 Ga0070664_100165228 3300005564 Unclassified 1961
106 Ga0068857_100022400 3300005577 Bacteria 5558
107 Ga0068857_100036219 3300005577 Unclassified 4372
108 Ga0068857_100244710 3300005577 Bacteria 1643
109 Ga0068856_100161748 3300005614 Bacteria 2249
110 Ga0070702_100011809 3300005615 Bacteria 4355
111 Ga0070702_100081775 3300005615 Bacteria 1936
112 Ga0068852_100263243 3300005616 Bacteria 1656
113 Ga0068859_100002785 3300005617 Bacteria 17712
114 Ga0068859_100006017 3300005617 Bacteria 12326
115 Ga0068859_100007186 3300005617 Bacteria 11302
116 Ga0068859_100062185 3300005617 Bacteria 3763
117 Ga0068859_100145597 3300005617 Bacteria 2444
118 Ga0068859_100210892 3300005617 Bacteria 2029
119 Ga0068859_100251331 3300005617 Bacteria 1859
120 Ga0068859_100317888 3300005617 Unclassified 1651
121 Ga0068859_100399897 3300005617 Bacteria 1469
122 Ga0068864_100001368 3300005618 Bacteria 20233
123 Ga0068864_100007715 3300005618 Bacteria 8866
124 Ga0068864_100009934 3300005618 Bacteria 7851
125 Ga0068864_100071213 3300005618 Bacteria 3027
126 Ga0068864_100084805 3300005618 Bacteria 2784
127 Ga0068864_100176981 3300005618 Bacteria 1948
128 Ga0068861_100003244 3300005719 Bacteria 10768
129 Ga0068861_100121115 3300005719 Bacteria 2111
130 Ga0068861_100166908 3300005719 Bacteria 1821
131 Ga0068851_10005347 3300005834 Bacteria 5827
132 Ga0068870_10091198 3300005840 Bacteria 1704
133 Ga0068863_100005547 3300005841 Bacteria 12408
134 Ga0068863_100009090 3300005841 Bacteria 9701
135 Ga0068863_100154464 3300005841 Bacteria 2197
136 Ga0068863_100156741 3300005841 Bacteria 2180
137 Ga0068863_100275398 3300005841 Unclassified 1629
138 Ga0068858_100016740 3300005842 Bacteria 6884
139 Ga0068858_100039467 3300005842 Bacteria 4378
140 Ga0068858_100045584 3300005842 Bacteria 4064
141 Ga0068858_100060987 3300005842 Bacteria 3486
142 Ga0068858_100066611 3300005842 Bacteria 3335
143 Ga0068858_100070487 3300005842 Bacteria 3240
144 Ga0068858_100073163 3300005842 Bacteria 3182
145 Ga0068858_100198419 3300005842 Bacteria 1897
146 Ga0068858_100213771 3300005842 Bacteria 1825
147 Ga0068858_100300085 3300005842 Unclassified 1532
148 Ga0068860_100005318 3300005843 Bacteria 13066
149 Ga0068860_100045095 3300005843 Bacteria 4203
150 Ga0068860_100052868 3300005843 Bacteria 3863
151 Ga0068860_100118906 3300005843 Bacteria 2529
152 Ga0068860_100198094 3300005843 Bacteria 1946
153 Ga0068860_100213011 3300005843 Bacteria 1874
154 Ga0068860_100335372 3300005843 Bacteria 1486
155 Ga0068860_100460824 3300005843 Bacteria 1265
156 Ga0068862_100007725 3300005844 Bacteria 8894
157 Ga0068862_100028146 3300005844 Bacteria 4732
158 Ga0068862_100158407 3300005844 Unclassified 2019
159 Ga0081539_10000823 3300005985 Bacteria 59946
160 Ga0070717_10168182 3300006028 Bacteria 1905
161 Ga0070716_100012811 3300006173 Bacteria 4261
162 Ga0075366_10002853 3300006195 Bacteria 8954
163 Ga0097621_100020521 3300006237 Bacteria 5091
164 Ga0097621_100092632 3300006237 Bacteria 2531
165 Ga0068871_100010186 3300006358 Bacteria 6846
166 Ga0068871_100043948 3300006358 Bacteria 3591
167 Ga0068871_100059410 3300006358 Bacteria 3115
168 Ga0068871_100346142 3300006358 Bacteria 1314
169 Ga0068871_100354876 3300006358 Bacteria 1298
170 Ga0075428_100004837 3300006844 Bacteria 14943
171 Ga0075430_100005043 3300006846 Bacteria 11116
172 Ga0075430_100049830 3300006846 Bacteria 3533
173 Ga0075430_100075849 3300006846 Bacteria 2818
174 Ga0075431_100000095 3300006847 Bacteria 54629
175 Ga0075431_100002478 3300006847 Bacteria 17790
176 Ga0075431_100166157 3300006847 Bacteria 2268
177 Ga0075433_10011156 3300006852 Bacteria 7228
178 Ga0075433_10053421 3300006852 Bacteria 3522
179 Ga0075433_10092171 3300006852 Bacteria 2679
180 Ga0075434_100018537 3300006871 Bacteria 6725
181 Ga0075429_100002344 3300006880 Bacteria 15924
182 Ga0068865_100152371 3300006881 Unclassified 1755
183 Ga0075436_100000002 3300006914 Bacteria 475522
184 Ga0097620_100002785 3300006931 Bacteria 17712
185 Ga0097620_100006017 3300006931 Bacteria 12326
186 Ga0097620_100007186 3300006931 Bacteria 11302
187 Ga0097620_100062182 3300006931 Bacteria 3763
188 Ga0097620_100145604 3300006931 Bacteria 2444
189 Ga0097620_100210890 3300006931 Bacteria 2029
190 Ga0097620_100251327 3300006931 Bacteria 1859
191 Ga0097620_100317871 3300006931 Unclassified 1651
192 Ga0097620_100399902 3300006931 Bacteria 1469
193 Ga0075435_100002835 3300007076 Bacteria 11598
194 Ga0105251_10023950 3300009011 Bacteria 3142
195 Ga0105240_10008440 3300009093 Bacteria 14735
196 Ga0105240_10143601 3300009093 Bacteria 2851
197 Ga0111539_10010910 3300009094 Bacteria 11435
198 Ga0111539_10020646 3300009094 Bacteria 8113
199 Ga0111539_10032213 3300009094 Bacteria 6368
200 Ga0111539_10045777 3300009094 Bacteria 5236
201 Ga0111539_10102358 3300009094 Unclassified 3361
202 Ga0105245_10015309 3300009098 Bacteria 6684
203 Ga0105245_10193661 3300009098 Unclassified 1949
204 Ga0105247_10000534 3300009101 Bacteria 30844
205 Ga0105247_10061468 3300009101 Archaea 2329
206 Ga0114129_10009220 3300009147 Bacteria 14074
207 Ga0114129_10030392 3300009147 Bacteria 7643
208 Ga0114129_10038702 3300009147 Bacteria 6725
209 Ga0114129_10044005 3300009147 Bacteria 6282
210 Ga0114129_10102717 3300009147 Bacteria 3953
211 Ga0114129_10192692 3300009147 Bacteria 2766
212 Ga0114129_10203575 3300009147 Unclassified 2679
213 Ga0105243_10000073 3300009148 Bacteria 114756
214 Ga0105243_10004691 3300009148 Bacteria 10759
215 Ga0105243_10005357 3300009148 Bacteria 10013
216 Ga0105243_10014886 3300009148 Bacteria 5887
217 Ga0105243_10071906 3300009148 Unclassified 2798
218 Ga0105243_10098567 3300009148 Unclassified 2421
219 Ga0105243_10122166 3300009148 Bacteria 2197
220 Ga0105243_10218827 3300009148 Bacteria 1682
221 Ga0105241_10069393 3300009174 Bacteria 2733
222 Ga0105241_10071258 3300009174 Bacteria 2698
223 Ga0105241_10337664 3300009174 Bacteria 1304
224 Ga0105242_10000043 3300009176 Bacteria 85748
225 Ga0105242_10001013 3300009176 Bacteria 22070
226 Ga0105242_10001366 3300009176 Bacteria 19252
227 Ga0105242_10043521 3300009176 Bacteria 3632
228 Ga0105242_10059252 3300009176 Bacteria 3140
229 Ga0105242_10157672 3300009176 Bacteria 1984
230 Ga0105248_10008504 3300009177 Bacteria 11269
231 Ga0105248_10011822 3300009177 Bacteria 9629
232 Ga0105248_10027618 3300009177 Bacteria 6321
233 Ga0105248_10140567 3300009177 Bacteria 2724
234 Ga0105248_10200507 3300009177 Bacteria 2248
235 Ga0105248_10244075 3300009177 Bacteria 2022
236 Ga0105248_10448996 3300009177 Bacteria 1453
237 Ga0105248_10526360 3300009177 Bacteria 1333
238 Ga0105237_10002093 3300009545 Bacteria 25200
239 Ga0105237_10039930 3300009545 Bacteria 4734
240 Ga0105237_10103967 3300009545 Bacteria 2832
241 Ga0105237_10617311 3300009545 Bacteria 1091
242 Ga0105238_10018882 3300009551 Bacteria 7020
243 Ga0105238_10036299 3300009551 Bacteria 5009
244 Ga0105238_10415066 3300009551 Bacteria 1340
245 Ga0105249_10001548 3300009553 Bacteria 20182
246 Ga0105249_10002234 3300009553 Bacteria 16788
247 Ga0105249_10020889 3300009553 Bacteria 5855
248 Ga0105249_10048983 3300009553 Bacteria 3853
249 Ga0105249_10184919 3300009553 Unclassified 2030
250 Ga0105249_10320377 3300009553 Bacteria 1561
251 Ga0105239_10526102 3300010375 Unclassified 1346
252 Ga0105246_10102704 3300011119 Bacteria 2085
253 Ga0105246_10174908 3300011119 Bacteria 1648
254 Ga0105246_10203807 3300011119 Bacteria 1540
255 Ga0105246_10207796 3300011119 Bacteria 1526
256 Ga0105246_10296807 3300011119 Unclassified 1303
257 Ga0105246_10315591 3300011119 Bacteria 1268
258 Ga0157373_10009657 3300013100 Bacteria 7121
259 Ga0157373_10022445 3300013100 Bacteria 4579
260 Ga0157374_10004256 3300013296 Bacteria 12033
261 Ga0157378_10000004 3300013297 Bacteria 201051
262 Ga0157378_10001387 3300013297 Bacteria 21775
263 Ga0157378_10026327 3300013297 Bacteria 5127
264 Ga0157378_10502157 3300013297 Bacteria 1212
265 Ga0163162_10000230 3300013306 Bacteria 51221
266 Ga0163162_10000831 3300013306 Bacteria 28720
267 Ga0163162_10020638 3300013306 Bacteria 6475
268 Ga0163162_10023513 3300013306 Bacteria 6082
269 Ga0163162_10030430 3300013306 Bacteria 5349
270 Ga0163162_10031277 3300013306 Bacteria 5279
271 Ga0163162_10100598 3300013306 Bacteria 2982
272 Ga0163162_10176740 3300013306 Bacteria 2260
273 Ga0163162_10609380 3300013306 Bacteria 1218
274 Ga0157372_10422493 3300013307 Bacteria 1553
275 Ga0157375_10000479 3300013308 Bacteria 36426
276 Ga0157375_10089504 3300013308 Bacteria 3134
277 Ga0157375_10297341 3300013308 Bacteria 1778
278 Ga0157375_10300590 3300013308 Unclassified 1768
279 Ga0157375_10516599 3300013308 Bacteria 1358
280 Ga0163163_10000334 3300014325 Bacteria 45303
281 Ga0163163_10004205 3300014325 Bacteria 12269
282 Ga0163163_10041815 3300014325 Unclassified 4485
283 Ga0163163_10079064 3300014325 Bacteria 3286
284 Ga0163163_10232652 3300014325 Bacteria 1892
285 Ga0163163_10331353 3300014325 Unclassified 1577
286 Ga0157380_10002594 3300014326 Bacteria 12217
287 Ga0157380_10014474 3300014326 Bacteria 5772
288 Ga0157380_10185470 3300014326 Bacteria 1832
289 Ga0157377_10000885 3300014745 Bacteria 12487
290 Ga0157377_10042076 3300014745 Unclassified 2537
291 Ga0157377_10144320 3300014745 Bacteria 1466
292 Ga0157379_10058097 3300014968 Bacteria 3458
293 Ga0157379_10093518 3300014968 Unclassified 2697
294 Ga0157376_10008430 3300014969 Bacteria 7438
295 Ga0157376_10010721 3300014969 Bacteria 6721
296 Ga0163161_10171230 3300017792 Bacteria 1660
297 Ga0209050_1001226 3300025298 Bacteria 29774
298 Ga0209051_1003672 3300025303 Bacteria 9929
299 Ga0207697_10010603 3300025315 Bacteria 3933
300 Ga0207697_10013386 3300025315 Unclassified 3423
301 Ga0207656_10002909 3300025321 Bacteria 5839
302 Ga0207653_10000210 3300025885 Bacteria 39415
303 Ga0207653_10002366 3300025885 Bacteria 6010
304 Ga0207710_10001728 3300025900 Bacteria 10568
305 Ga0207710_10019201 3300025900 Bacteria 2916
306 Ga0207680_10013599 3300025903 Bacteria 4187
307 Ga0207680_10241315 3300025903 Bacteria 1245
308 Ga0207699_10117782 3300025906 Bacteria 1713
309 Ga0207643_10003313 3300025908 Bacteria 8689
310 Ga0207684_10003948 3300025910 Bacteria 14197
311 Ga0207684_10013297 3300025910 Bacteria 7120
312 Ga0207707_10000080 3300025912 Bacteria 96693
313 Ga0207695_10149201 3300025913 Bacteria 2278
314 Ga0207660_10026610 3300025917 Bacteria 3940
315 Ga0207660_10204403 3300025917 Bacteria 1544
316 Ga0207662_10001395 3300025918 Bacteria 11673
317 Ga0207662_10011021 3300025918 Bacteria 5003
318 Ga0207662_10052912 3300025918 Bacteria 2417
319 Ga0207662_10075686 3300025918 Bacteria 2045
320 Ga0207662_10234836 3300025918 Bacteria 1199
321 Ga0207649_10003552 3300025920 Bacteria 8522
322 Ga0207652_10001974 3300025921 Bacteria 17736
323 Ga0207646_10043228 3300025922 Unclassified 4047
324 Ga0207646_10111341 3300025922 Bacteria 2457
325 Ga0207681_10016336 3300025923 Bacteria 4642
326 Ga0207694_10013885 3300025924 Bacteria 6073
327 Ga0207650_10000332 3300025925 Bacteria 45789
328 Ga0207650_10005284 3300025925 Bacteria 8808
329 Ga0207650_10014749 3300025925 Bacteria 5432
330 Ga0207659_10022335 3300025926 Bacteria 4212
331 Ga0207659_10157273 3300025926 Bacteria 1781
332 Ga0207687_10229876 3300025927 Unclassified 1465
333 Ga0207644_10009250 3300025931 Bacteria 6464
334 Ga0207644_10018001 3300025931 Bacteria 4777
335 Ga0207644_10049981 3300025931 Bacteria 2995
336 Ga0207644_10065054 3300025931 Unclassified 2651
337 Ga0207706_10047799 3300025933 Bacteria 3785
338 Ga0207706_10102676 3300025933 Bacteria 2515
339 Ga0207686_10000003 3300025934 Bacteria 376934
340 Ga0207686_10000244 3300025934 Bacteria 41692
341 Ga0207686_10000965 3300025934 Bacteria 17144
342 Ga0207686_10047545 3300025934 Bacteria 2653
343 Ga0207709_10000124 3300025935 Bacteria 114743
344 Ga0207709_10000469 3300025935 Bacteria 37165
345 Ga0207709_10002901 3300025935 Bacteria 10475
346 Ga0207669_10159107 3300025937 Unclassified 1593
347 Ga0207704_10046703 3300025938 Bacteria 2583
348 Ga0207704_10394546 3300025938 Bacteria 1090
349 Ga0207691_10021136 3300025940 Bacteria 6150
350 Ga0207691_10035152 3300025940 Unclassified 4655
351 Ga0207711_10002023 3300025941 Bacteria 18347
352 Ga0207711_10022643 3300025941 Bacteria 5255
353 Ga0207711_10032331 3300025941 Unclassified 4424
354 Ga0207711_10245037 3300025941 Bacteria 1644
355 Ga0207689_10000898 3300025942 Bacteria 28576
356 Ga0207689_10031409 3300025942 Unclassified 4422
357 Ga0207689_10093643 3300025942 Bacteria 2468
358 Ga0207689_10240501 3300025942 Unclassified 1496
359 Ga0207679_10054013 3300025945 Bacteria 2955
360 Ga0207679_10122782 3300025945 Bacteria 2071
361 Ga0207679_10289176 3300025945 Bacteria 1408
362 Ga0207651_10008743 3300025960 Bacteria 5492
363 Ga0207651_10032278 3300025960 Bacteria 3362
364 Ga0207651_10067130 3300025960 Bacteria 2523
365 Ga0207712_10003879 3300025961 Bacteria 9448
366 Ga0207712_10030357 3300025961 Unclassified 3633
367 Ga0207712_10110532 3300025961 Bacteria 2061
368 Ga0207640_10110678 3300025981 Unclassified 1946
369 Ga0207640_10264528 3300025981 Unclassified 1342
370 Ga0207658_10011740 3300025986 Bacteria 5966
371 Ga0207658_10028959 3300025986 Bacteria 3905
372 Ga0207658_10173235 3300025986 Bacteria 1780
373 Ga0207677_10330032 3300026023 Bacteria 1271
374 Ga0207703_10026355 3300026035 Bacteria 4574
375 Ga0207703_10043076 3300026035 Bacteria 3621
376 Ga0207703_10048692 3300026035 Bacteria 3422
377 Ga0207703_10074709 3300026035 Bacteria 2807
378 Ga0207703_10121190 3300026035 Bacteria 2245
379 Ga0207703_10202594 3300026035 Bacteria 1764
380 Ga0207678_10106147 3300026067 Bacteria 2396
381 Ga0207708_10000092 3300026075 Bacteria 70135
382 Ga0207708_10004335 3300026075 Bacteria 10447
383 Ga0207708_10009835 3300026075 Bacteria 7097
384 Ga0207708_10013747 3300026075 Bacteria 6048
385 Ga0207708_10033292 3300026075 Bacteria 3915
386 Ga0207708_10057712 3300026075 Bacteria 2962
387 Ga0207708_10277542 3300026075 Bacteria 1357
388 Ga0207702_10024513 3300026078 Bacteria 5006
389 Ga0207641_10004482 3300026088 Bacteria 12084
390 Ga0207641_10038653 3300026088 Bacteria 3990
391 Ga0207641_10039452 3300026088 Bacteria 3949
392 Ga0207648_10010332 3300026089 Bacteria 8853
393 Ga0207648_10025948 3300026089 Bacteria 5211
394 Ga0207648_10029644 3300026089 Bacteria 4852
395 Ga0207648_10114316 3300026089 Bacteria 2371
396 Ga0207648_10147978 3300026089 Unclassified 2072
397 Ga0207676_10005442 3300026095 Bacteria 9010
398 Ga0207676_10149182 3300026095 Unclassified 2012
399 Ga0207676_10246594 3300026095 Bacteria 1605
400 Ga0207674_10048560 3300026116 Bacteria 4344
401 Ga0207674_10107892 3300026116 Bacteria 2761
402 Ga0207674_10257850 3300026116 Bacteria 1691
403 Ga0207675_100006813 3300026118 Bacteria 10819
404 Ga0207675_100012394 3300026118 Bacteria 7963
405 Ga0207675_100016678 3300026118 Bacteria 6858
406 Ga0207675_100045648 3300026118 Bacteria 4094
407 Ga0207675_100049721 3300026118 Unclassified 3912
408 Ga0207675_100191250 3300026118 Bacteria 1963
409 Ga0207683_10053712 3300026121 Bacteria 3533
410 Ga0207683_10071650 3300026121 Bacteria 3064
411 Ga0207698_10123894 3300026142 Bacteria 2194
412 Ga0207428_10012870 3300027907 Bacteria 7335
413 Ga0207428_10028144 3300027907 Bacteria 4672
414 Ga0268265_10024680 3300028380 Bacteria 4257
415 Ga0268265_10152937 3300028380 Bacteria 1948
416 Ga0268264_10016000 3300028381 Bacteria 6146
417 Ga0268264_10105726 3300028381 Bacteria 2456
418 Ga0268264_10120699 3300028381 Bacteria 2309
419 Ga0268264_10144275 3300028381 Bacteria 2127
420 Ga0268264_10223307 3300028381 Bacteria 1735
421 Ga0268264_10303970 3300028381 Bacteria 1503
422 Ga0265338_10013553 3300028800 Bacteria 9189
423 Ga0265340_10031906 3300031247 Bacteria 2632
424 Ga0307408_100003078 3300031548 Bacteria 11500
425 Ga0307408_100056807 3300031548 Bacteria 2839
426 Ga0307408_100204927 3300031548 Bacteria 1599
427 Ga0316579_10001379 3300031691 Bacteria 8793
428 Ga0316579_10022190 3300031691 Bacteria 2837
429 Ga0316576_10000499 3300031727 Bacteria 18426
430 Ga0316576_10004155 3300031727 Bacteria 8638
431 Ga0316576_10011843 3300031727 Bacteria 5736
432 Ga0316576_10100318 3300031727 Bacteria 2163
433 Ga0316578_10000285 3300031728 Bacteria 15362
434 Ga0316578_10002190 3300031728 Bacteria 8444
435 Ga0316578_10100201 3300031728 Bacteria 1736
436 Ga0307405_10024814 3300031731 Bacteria 3432
437 Ga0307405_10110334 3300031731 Bacteria 1863
438 Ga0316577_10000341 3300031733 Bacteria 17356
439 Ga0316577_10005012 3300031733 Bacteria 6904
440 Ga0316577_10035269 3300031733 Unclassified 2795
441 Ga0316577_10105499 3300031733 Unclassified 1581
442 Ga0316577_10161984 3300031733 Bacteria 1262
443 Ga0307407_10292251 3300031903 Bacteria 1133
444 Ga0307416_100087318 3300032002 Bacteria 2662
445 Ga0307416_100087579 3300032002 Unclassified 2659
446 Ga0307411_10024372 3300032005 Bacteria 3606
447 Ga0307415_100006724 3300032126 Bacteria 6229
448 Ga0316583_10004147 3300032133 Bacteria 5155
449 Ga0316583_10032646 3300032133 Unclassified 1850
450 Ga0316585_10000177 3300032137 Bacteria 13026
451 Ga0316580_10000346 3300032139 Bacteria 10228
452 Ga0307510_10000005 3300033180 Bacteria 633068
453 Ga0307510_10007486 3300033180 Bacteria 13003
454 Ga0316596_1004572 3300033541 Bacteria 3115
455 Ga0373951_0000742 3300035091 Bacteria 8927
456 Ga0373942_0008109 3300035207 Unclassified 2443
457 Ga0316574_0003621 3300035398 Bacteria 7989
458 Ga0316574_0031157 3300035398 Unclassified 3234
459 Ga0316574_0094424 3300035398 Unclassified 1910
460 Ga0373937_0132051 3300036401 Bacteria 2332
461 Ga0316582_0001638 3300036647 Bacteria 10003
462 Ga0316582_0018492 3300036647 Bacteria 4058
463 Ga0316582_0069431 3300036647 Unclassified 2277
464 Ga0316584_0003162 3300036712 Bacteria 10640
465 Ga0316584_0005033 3300036712 Bacteria 8810
466 Ga0316584_0045925 3300036712 Unclassified 3261
467 Ga0316584_0048895 3300036712 Unclassified 3160
468 Ga0316584_0125102 3300036712 Bacteria 1920
469 Ga0316581_0000287 3300037588 Bacteria 8894
470 Ga0316581_0005973 3300037588 Unclassified 3202
471 Ga0316581_0021432 3300037588 Unclassified 1899
472 Ga0436364_0031979 3300037853 Bacteria 1118
473 Ga0242422_01793 3300038699 Bacteria 1481
474 Ga0400484_31965 3300038725 Bacteria 21409
475 Ga0400490_33134 3300038726 Bacteria 59693
476 Ga0400490_38810 3300038726 Bacteria 5234
477 Ga0242420_002873 3300038996 Bacteria 2499
478 Ga0453684_0125662 3300044712 Unclassified 3088
479 Ga0451576_0006280 3300045051 Bacteria 14621
480 Ga0451576_0301864 3300045051 Bacteria 1675
481 Ga0451576_0341651 3300045051 Bacteria 1567
482 Ga0495590_0010781 3300046457 Bacteria 3425
483 Ga0495662_0013675 3300046476 Unclassified 3953
484 Ga0495625_0030579 3300046660 Bacteria 4016
485 Ga0495659_0002750 3300046664 Bacteria 5657
486 Ga0495669_0045581 3300046684 Bacteria 1956
487 Ga0495613_0187058 3300046689 Unclassified 1465
488 Ga0495670_0054795 3300046691 Bacteria 1999
489 Ga0495600_0144909 3300046809 Bacteria 1540
490 Ga0495673_0002660 3300047469 Bacteria 12345
491 Ga0495684_0275059 3300047471 Bacteria 1217
492 Ga0496101_0274862 3300048904 Archaea 1316
493 Ga0496106_0008837 3300048909 Bacteria 7445
494 Ga0496106_0090303 3300048909 Bacteria 2364
495 Ga0496109_0345642 3300048912 Bacteria 1405
496 Ga0496110_0368208 3300048913 Bacteria 1309
497 Ga0496112_0121793 3300048915 Bacteria 2579
498 Ga0496112_0285811 3300048915 Bacteria 1596
499 Ga0496118_0261597 3300048921 Bacteria 976
500 Ga0496120_0104523 3300048923 Bacteria 1490
501 Ga0496121_0125202 3300048924 Bacteria 1933
502 Ga0496124_0001839 3300048927 Bacteria 29294
503 Ga0496124_0087708 3300048927 Bacteria 2545
504 Ga0501031_0003062 3300049568 Bacteria 10693
505 Ga0501036_0001227 3300049572 Bacteria 19579
506 Ga0501038_0013637 3300049574 Bacteria 7407
507 Ga0501039_0001977 3300049575 Bacteria 15188
508 Ga0501040_0001102 3300049576 Bacteria 17098
509 Ga0501040_0049411 3300049576 Unclassified 2876
510 Ga0501041_0020449 3300049577 Bacteria 3958
511 Ga0501041_0136075 3300049577 Unclassified 1531
512 Ga0501042_0001096 3300049578 Bacteria 15570
513 Ga0501046_0001328 3300049580 Bacteria 23960
514 Ga0501048_0009298 3300049582 Bacteria 7381
515 Ga0501068_0010095 3300049584 Bacteria 5299
516 Ga0501068_0195917 3300049584 Unclassified 1281
517 Ga0501071_0000741 3300049587 Bacteria 17237
518 Ga0501071_0060318 3300049587 Bacteria 2746
519 Ga0501072_0000879 3300049588 Bacteria 22004
520 Ga0501072_0010271 3300049588 Bacteria 7133
521 Ga0501072_0010575 3300049588 Bacteria 7027
522 Ga0501072_0114173 3300049588 Unclassified 2150
523 Ga0501074_0037818 3300049590 Bacteria 3497
524 Ga0501075_0001981 3300049591 Bacteria 13529
525 Ga0501075_0003149 3300049591 Bacteria 11044
526 Ga0501075_0031840 3300049591 Bacteria 3917
527 Ga0501076_0000609 3300049592 Bacteria 22844
528 Ga0501076_0009507 3300049592 Bacteria 7181
529 Ga0501077_0018750 3300049593 Bacteria 4377
530 Ga0501217_004205 3300049661 Bacteria 2952
531 Ga0501217_053726 3300049661 Bacteria 1059
532 Ga0501224_005947 3300049664 Bacteria 1761
533 Ga0501227_001316 3300049665 Bacteria 5565
534 Ga0501227_009038 3300049665 Bacteria 2142
535 Ga0501239_006377 3300049672 Bacteria 1212
536 Ga0501243_001192 3300049675 Unclassified 3714
537 Ga0501243_017986 3300049675 Bacteria 1149
538 Ga0501251_001823 3300049681 Bacteria 2008
539 Ga0501253_027712 3300049683 Bacteria 1055
540 Ga0501257_020454 3300049686 Bacteria 1554
541 Ga0501259_005305 3300049688 Unclassified 2039
542 Ga0501225_0001009 3300049705 Bacteria 8834
543 Ga0501225_0012602 3300049705 Bacteria 2373
544 Ga0501229_008058 3300049706 Bacteria 1314
545 Ga0501234_016749 3300049707 Bacteria 1157
546 Ga0501079_0001881 3300049741 Bacteria 15039
547 Ga0501079_0108705 3300049741 Unclassified 2153
548 Ga0501079_0275911 3300049741 Bacteria 1314
549 Ga0501081_0000226 3300049743 Bacteria 28295
550 Ga0501081_0050029 3300049743 Bacteria 2879
551 Ga0501083_0193246 3300049744 Bacteria 1328
552 Ga0501268_010107 3300049765 Bacteria 1463
553 Ga0501273_006720 3300049770 Bacteria 1339
554 Ga0501045_0003374 3300049824 Bacteria 10930
555 Ga0501226_002191 3300049853 Bacteria 2415
556 nmdc:mga0k408_22871_c1 3300050493 Bacteria 3522
557 nmdc:mga05p37_146994_c1 3300050507 Bacteria 2885
558 nmdc:mga05p37_26820_c1 3300050507 Bacteria 7008
559 nmdc:mga05p37_424234_c1 3300050507 Bacteria 1547
560 nmdc:mga05p37_467284_c1 3300050507 Bacteria 1456
561 nmdc:mga05p37_63388_c2 3300050507 Bacteria 3328
562 nmdc:mga09592_471273_c1 3300050508 Bacteria 1082
563 nmdc:mga09592_69447_c1 3300050508 Bacteria 2989
564 nmdc:mga0qj67_15015_c1 3300050509 Bacteria 5859
565 nmdc:mga0qj67_32311_c1 3300050509 Bacteria 4080
566 nmdc:mga0qj67_8504_c1 3300050509 Bacteria 7615
567 nmdc:mga06r32_100437_c1 3300050510 Bacteria 2838
568 nmdc:mga06r32_1004_c1 3300050510 Bacteria 25303
569 nmdc:mga06r32_2409_c1 3300050510 Bacteria 16731
570 nmdc:mga06r32_99271_c1 3300050510 Bacteria 2855
571 nmdc:mga08y16_14577_c1 3300050511 Bacteria 8267
572 nmdc:mga08y16_167088_c1 3300050511 Unclassified 2286
573 nmdc:mga08y16_679506_c1 3300050511 Bacteria 1031
574 nmdc:mga0n895_31203_c1 3300050512 Bacteria 5099
575 nmdc:mga0rr50_1698_c1 3300050513 Bacteria 12165
576 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
577 nmdc:mga0a205_414961_c1 3300050515 Bacteria 1209
578 nmdc:mga0a205_574319_c1 3300050515 Bacteria 982
579 nmdc:mga0a205_97266_c1 3300050515 Bacteria 2842
580 Ga0500568_0006578 3300053139 Bacteria 5815
581 Ga0500568_0010599 3300053139 Bacteria 4303
582 Ga0500588_0003036 3300053146 Unclassified 3502
583 Ga0500604_0005744 3300053151 Bacteria 3277
584 Ga0500622_0000360 3300053156 Bacteria 44258
585 Ga0501084_0002870 3300054114 Bacteria 13937
586 Ga0501084_0044987 3300054114 Bacteria 3697
587 Ga0501082_0028172 3300060353 Bacteria 4840
588 Ga0530510_0007043 3300061734 Bacteria 7830
589 Ga0530510_0024894 3300061734 Unclassified 4277
590 Ga0530510_0028936 3300061734 Unclassified 3974
591 Ga0530510_0033335 3300061734 Bacteria 3709
592 Ga0530510_0087764 3300061734 Unclassified 2266

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2937972304 2937976801 273
2 iso_pu_bacteria 2968016561 2968021446 273
3 iso_pu_bacteria 2970469710 2970476550 273
4 3300009545 Ga0105237_10617311 Ga0105237_106173112 276
5 3300048921 Ga0496118_0261597 Ga0496118_0261597_103_966 277
6 3300050515 nmdc:mga0a205_574319_c1 nmdc:mga0a205_574319_c1_11_844 277
7 3300049577 Ga0501041_0136075 Ga0501041_0136075_74_982 296
8 3300005468 Ga0070707_100037385 Ga0070707_1000373852 304
9 3300049664 Ga0501224_005947 Ga0501224_005947_261_1181 305
10 3300026118 Ga0207675_100049721 Ga0207675_1000497212 309
11 3300061734 Ga0530510_0033335 Ga0530510_0033335_2196_3143 309
12 3300005471 Ga0070698_100042506 Ga0070698_1000425064 312
13 3300026121 Ga0207683_10053712 Ga0207683_100537124 314
14 3300049568 Ga0501031_0003062 Ga0501031_0003062_2215_3294 315
15 3300049572 Ga0501036_0001227 Ga0501036_0001227_7163_8242 315
16 3300049574 Ga0501038_0013637 Ga0501038_0013637_6151_7230 315
17 3300049575 Ga0501039_0001977 Ga0501039_0001977_11897_12976 315
18 3300049576 Ga0501040_0001102 Ga0501040_0001102_5457_6536 315
19 3300049578 Ga0501042_0001096 Ga0501042_0001096_9615_10694 315
20 3300049582 Ga0501048_0009298 Ga0501048_0009298_5364_6443 315
21 3300049584 Ga0501068_0010095 Ga0501068_0010095_842_1921 315
22 3300049587 Ga0501071_0000741 Ga0501071_0000741_6989_8068 315
23 3300049588 Ga0501072_0000879 Ga0501072_0000879_5218_6297 315
24 3300049590 Ga0501074_0037818 Ga0501074_0037818_425_1504 315
25 3300049591 Ga0501075_0001981 Ga0501075_0001981_11832_12911 315
26 3300049593 Ga0501077_0018750 Ga0501077_0018750_1271_2350 315
27 3300049741 Ga0501079_0001881 Ga0501079_0001881_6900_7979 315
28 3300049743 Ga0501081_0000226 Ga0501081_0000226_9217_10296 315
29 3300049744 Ga0501083_0193246 Ga0501083_0193246_172_1251 315
30 3300049824 Ga0501045_0003374 Ga0501045_0003374_6675_7754 315
31 3300060353 Ga0501082_0028172 Ga0501082_0028172_1718_2797 315
32 3300061734 Ga0530510_0007043 Ga0530510_0007043_4830_5909 315
33 3300009553 Ga0105249_10048983 Ga0105249_100489834 317
34 3300013306 Ga0163162_10000230 Ga0163162_1000023027 317
35 3300005334 Ga0068869_100234814 Ga0068869_1002348142 318
36 3300005337 Ga0070682_100012841 Ga0070682_1000128415 318
37 3300005367 Ga0070667_100128215 Ga0070667_1001282152 318
38 3300005406 Ga0070703_10003997 Ga0070703_100039974 318
39 3300005444 Ga0070694_100009983 Ga0070694_1000099833 318
40 3300005445 Ga0070708_100151474 Ga0070708_1001514741 318
41 3300005459 Ga0068867_100134260 Ga0068867_1001342602 318
42 3300005544 Ga0070686_100007985 Ga0070686_1000079853 318
43 3300005545 Ga0070695_100114680 Ga0070695_1001146802 318
44 3300005546 Ga0070696_100103444 Ga0070696_1001034442 318
45 3300005564 Ga0070664_100100011 Ga0070664_1001000112 318
46 3300005564 Ga0070664_100165228 Ga0070664_1001652282 318
47 3300005614 Ga0068856_100161748 Ga0068856_1001617483 318
48 3300005615 Ga0070702_100081775 Ga0070702_1000817752 318
49 3300005841 Ga0068863_100275398 Ga0068863_1002753981 318
50 3300005842 Ga0068858_100016740 Ga0068858_1000167404 318
51 3300005842 Ga0068858_100300085 Ga0068858_1003000851 318
52 3300005844 Ga0068862_100158407 Ga0068862_1001584073 318
53 3300006195 Ga0075366_10002853 Ga0075366_100028537 318
54 3300006237 Ga0097621_100092632 Ga0097621_1000926322 318
55 3300009011 Ga0105251_10023950 Ga0105251_100239504 318
56 3300009148 Ga0105243_10005357 Ga0105243_1000535710 318
57 3300025903 Ga0207680_10241315 Ga0207680_102413152 318
58 3300025927 Ga0207687_10229876 Ga0207687_102298761 318
59 3300025931 Ga0207644_10065054 Ga0207644_100650542 318
60 3300025935 Ga0207709_10002901 Ga0207709_100029019 318
61 3300025937 Ga0207669_10159107 Ga0207669_101591072 318
62 3300025940 Ga0207691_10035152 Ga0207691_100351522 318
63 3300025941 Ga0207711_10032331 Ga0207711_100323314 318
64 3300026078 Ga0207702_10024513 Ga0207702_100245133 318
65 3300026089 Ga0207648_10147978 Ga0207648_101479781 318
66 3300026116 Ga0207674_10048560 Ga0207674_100485604 318
67 3300026118 Ga0207675_100016678 Ga0207675_1000166782 318
68 3300028380 Ga0268265_10152937 Ga0268265_101529371 318
69 3300047471 Ga0495684_0275059 Ga0495684_0275059_184_1152 318
70 3300049672 Ga0501239_006377 Ga0501239_006377_221_1177 318
71 3300049683 Ga0501253_027712 Ga0501253_027712_27_983 318
72 3300049706 Ga0501229_008058 Ga0501229_008058_307_1263 318
73 3300049707 Ga0501234_016749 Ga0501234_016749_13_969 318
74 3300050510 nmdc:mga06r32_100437_c1 nmdc:mga06r32_100437_c1_69_1025 318
75 3300050511 nmdc:mga08y16_679506_c1 nmdc:mga08y16_679506_c1_54_1010 318
76 3300005617 Ga0068859_100251331 Ga0068859_1002513312 320
77 3300006931 Ga0097620_100251327 Ga0097620_1002513272 320
78 3300014969 Ga0157376_10010721 Ga0157376_100107214 321
79 3300050493 nmdc:mga0k408_22871_c1 nmdc:mga0k408_22871_c1_76_1053 321
80 3300049681 Ga0501251_001823 Ga0501251_001823_115_1098 323
81 3300005617 Ga0068859_100062185 Ga0068859_1000621854 324
82 3300006931 Ga0097620_100062182 Ga0097620_1000621822 324
83 3300033180 Ga0307510_10007486 Ga0307510_100074867 324
84 3300005343 Ga0070687_100002878 Ga0070687_1000028786 325
85 3300005549 Ga0070704_100076016 Ga0070704_1000760161 325
86 3300013100 Ga0157373_10022445 Ga0157373_100224456 325
87 3300013306 Ga0163162_10023513 Ga0163162_100235135 325
88 3300014326 Ga0157380_10014474 Ga0157380_100144743 325
89 3300025918 Ga0207662_10001395 Ga0207662_100013955 325
90 3300025961 Ga0207712_10003879 Ga0207712_100038792 325
91 3300049580 Ga0501046_0001328 Ga0501046_0001328_8829_9908 325
92 3300049592 Ga0501076_0000609 Ga0501076_0000609_7283_8362 325
93 3300054114 Ga0501084_0002870 Ga0501084_0002870_5236_6315 325
94 iso_pu_bacteria 2511231012 2511304257 325
95 iso_pu_bacteria 8056177738 8056181600 325
96 3300005843 Ga0068860_100213011 Ga0068860_1002130112 327
97 3300006852 Ga0075433_10011156 Ga0075433_100111564 327
98 3300009148 Ga0105243_10071906 Ga0105243_100719062 327
99 3300025938 Ga0207704_10394546 Ga0207704_103945461 327
100 3300025961 Ga0207712_10110532 Ga0207712_101105322 327
101 3300005288 Ga0065714_10064524 Ga0065714_1006452414 328
102 3300005288 Ga0065714_10064524 Ga0065714_100645247 328
103 3300005841 Ga0068863_100156741 Ga0068863_1001567412 328
104 3300025298 Ga0209050_1001226 Ga0209050_10012266 328
105 3300025303 Ga0209051_1003672 Ga0209051_100367210 328
106 3300046457 Ga0495590_0010781 Ga0495590_0010781_941_1948 328
107 3300047469 Ga0495673_0002660 Ga0495673_0002660_4174_5181 328
108 3300048913 Ga0496110_0368208 Ga0496110_0368208_144_1151 328
109 3300005441 Ga0070700_100000101 Ga0070700_10000010128 329
110 3300009147 Ga0114129_10192692 Ga0114129_101926923 329
111 3300026075 Ga0207708_10000092 Ga0207708_1000009242 329
112 3300031548 Ga0307408_100003078 Ga0307408_1000030789 329
113 3300031731 Ga0307405_10024814 Ga0307405_100248142 329
114 3300031903 Ga0307407_10292251 Ga0307407_102922511 329
115 3300032002 Ga0307416_100087579 Ga0307416_1000875792 329
116 3300032126 Ga0307415_100006724 Ga0307415_1000067243 329
117 3300049661 Ga0501217_004205 Ga0501217_004205_328_1320 329
118 3300049665 Ga0501227_001316 Ga0501227_001316_801_1793 329
119 3300049675 Ga0501243_001192 Ga0501243_001192_1817_2809 329
120 3300049688 Ga0501259_005305 Ga0501259_005305_869_1861 329
121 3300049705 Ga0501225_0001009 Ga0501225_0001009_6778_7770 329
122 3300005518 Ga0070699_100080573 Ga0070699_1000805732 332
123 3300005536 Ga0070697_100054555 Ga0070697_1000545551 332
124 3300031548 Ga0307408_100204927 Ga0307408_1002049272 333
125 3300005290 Ga0065712_10003097 Ga0065712_100030971 334
126 3300005293 Ga0065715_10092098 Ga0065715_100920985 334
127 3300005328 Ga0070676_10163523 Ga0070676_101635232 334
128 3300005330 Ga0070690_100000760 Ga0070690_1000007604 334
129 3300005331 Ga0070670_100018076 Ga0070670_1000180762 334
130 3300005334 Ga0068869_100003816 Ga0068869_1000038162 334
131 3300005335 Ga0070666_10010982 Ga0070666_100109823 334
132 3300005336 Ga0070680_100004282 Ga0070680_1000042824 334
133 3300005337 Ga0070682_100075823 Ga0070682_1000758232 334
134 3300005340 Ga0070689_100007201 Ga0070689_1000072014 334
135 3300005344 Ga0070661_100001230 Ga0070661_1000012308 334
136 3300005345 Ga0070692_10112942 Ga0070692_101129422 334
137 3300005347 Ga0070668_100190783 Ga0070668_1001907832 334
138 3300005354 Ga0070675_100001429 Ga0070675_1000014295 334
139 3300005355 Ga0070671_100012305 Ga0070671_1000123055 334
140 3300005364 Ga0070673_100020327 Ga0070673_1000203273 334
141 3300005367 Ga0070667_100012250 Ga0070667_1000122504 334
142 3300005440 Ga0070705_100007443 Ga0070705_1000074434 334
143 3300005441 Ga0070700_100044878 Ga0070700_1000448784 334
144 3300005456 Ga0070678_100034748 Ga0070678_1000347484 334
145 3300005458 Ga0070681_10001279 Ga0070681_1000127915 334
146 3300005459 Ga0068867_100012328 Ga0068867_1000123285 334
147 3300005466 Ga0070685_10020641 Ga0070685_100206414 334
148 3300005530 Ga0070679_100002107 Ga0070679_1000021075 334
149 3300005535 Ga0070684_100094857 Ga0070684_1000948571 334
150 3300005543 Ga0070672_100004458 Ga0070672_1000044587 334
151 3300005544 Ga0070686_100000900 Ga0070686_1000009006 334
152 3300005548 Ga0070665_100062296 Ga0070665_1000622964 334
153 3300005564 Ga0070664_100020875 Ga0070664_1000208755 334
154 3300005577 Ga0068857_100022400 Ga0068857_1000224002 334
155 3300005617 Ga0068859_100007186 Ga0068859_1000071868 334
156 3300005618 Ga0068864_100001368 Ga0068864_1000013686 334
157 3300005719 Ga0068861_100003244 Ga0068861_1000032446 334
158 3300005841 Ga0068863_100005547 Ga0068863_1000055477 334
159 3300005842 Ga0068858_100039467 Ga0068858_1000394673 334
160 3300005843 Ga0068860_100005318 Ga0068860_1000053187 334
161 3300005844 Ga0068862_100007725 Ga0068862_1000077251 334
162 3300006358 Ga0068871_100059410 Ga0068871_1000594103 334
163 3300006844 Ga0075428_100004837 Ga0075428_1000048375 334
164 3300006846 Ga0075430_100005043 Ga0075430_1000050435 334
165 3300006847 Ga0075431_100000095 Ga0075431_1000000955 334
166 3300006847 Ga0075431_100002478 Ga0075431_10000247816 334
167 3300006852 Ga0075433_10053421 Ga0075433_100534213 334
168 3300006871 Ga0075434_100018537 Ga0075434_1000185376 334
169 3300006880 Ga0075429_100002344 Ga0075429_10000234412 334
170 3300006931 Ga0097620_100007186 Ga0097620_1000071868 334
171 3300009147 Ga0114129_10009220 Ga0114129_100092202 334
172 3300009147 Ga0114129_10038702 Ga0114129_100387022 334
173 3300009148 Ga0105243_10122166 Ga0105243_101221663 334
174 3300009174 Ga0105241_10071258 Ga0105241_100712582 334
175 3300009174 Ga0105241_10337664 Ga0105241_103376641 334
176 3300009176 Ga0105242_10157672 Ga0105242_101576722 334
177 3300009177 Ga0105248_10200507 Ga0105248_102005073 334
178 3300009545 Ga0105237_10039930 Ga0105237_100399303 334
179 3300009553 Ga0105249_10002234 Ga0105249_1000223411 334
180 3300013297 Ga0157378_10502157 Ga0157378_105021572 334
181 3300013306 Ga0163162_10020638 Ga0163162_100206384 334
182 3300013307 Ga0157372_10422493 Ga0157372_104224932 334
183 3300013308 Ga0157375_10089504 Ga0157375_100895043 334
184 3300014325 Ga0163163_10079064 Ga0163163_100790643 334
185 3300014745 Ga0157377_10000885 Ga0157377_100008856 334
186 3300017792 Ga0163161_10171230 Ga0163161_101712302 334
187 3300025912 Ga0207707_10000080 Ga0207707_1000008086 334
188 3300025917 Ga0207660_10026610 Ga0207660_100266104 334
189 3300025920 Ga0207649_10003552 Ga0207649_100035525 334
190 3300025921 Ga0207652_10001974 Ga0207652_1000197410 334
191 3300025925 Ga0207650_10005284 Ga0207650_100052845 334
192 3300025926 Ga0207659_10022335 Ga0207659_100223355 334
193 3300025931 Ga0207644_10009250 Ga0207644_100092505 334
194 3300025940 Ga0207691_10021136 Ga0207691_100211364 334
195 3300025941 Ga0207711_10022643 Ga0207711_100226435 334
196 3300025942 Ga0207689_10000898 Ga0207689_1000089818 334
197 3300025945 Ga0207679_10054013 Ga0207679_100540132 334
198 3300025960 Ga0207651_10008743 Ga0207651_100087435 334
199 3300025986 Ga0207658_10028959 Ga0207658_100289593 334
200 3300026067 Ga0207678_10106147 Ga0207678_101061472 334
201 3300026075 Ga0207708_10013747 Ga0207708_100137475 334
202 3300026088 Ga0207641_10039452 Ga0207641_100394521 334
203 3300026095 Ga0207676_10246594 Ga0207676_102465942 334
204 3300026118 Ga0207675_100006813 Ga0207675_1000068136 334
205 3300028380 Ga0268265_10024680 Ga0268265_100246801 334
206 3300028381 Ga0268264_10144275 Ga0268264_101442752 334
207 3300048909 Ga0496106_0008837 Ga0496106_0008837_6028_7044 334
208 3300050507 nmdc:mga05p37_26820_c1 nmdc:mga05p37_26820_c1_1195_2199 334
209 3300050507 nmdc:mga05p37_467284_c1 nmdc:mga05p37_467284_c1_421_1443 334
210 3300050507 nmdc:mga05p37_63388_c2 nmdc:mga05p37_63388_c2_1313_2320 334
211 3300050508 nmdc:mga09592_69447_c1 nmdc:mga09592_69447_c1_932_1939 334
212 3300050509 nmdc:mga0qj67_15015_c1 nmdc:mga0qj67_15015_c1_2647_3687 334
213 3300050509 nmdc:mga0qj67_32311_c1 nmdc:mga0qj67_32311_c1_2079_3092 334
214 3300050510 nmdc:mga06r32_1004_c1 nmdc:mga06r32_1004_c1_4740_5780 334
215 3300050510 nmdc:mga06r32_2409_c1 nmdc:mga06r32_2409_c1_14447_15454 334
216 3300050512 nmdc:mga0n895_31203_c1 nmdc:mga0n895_31203_c1_3669_4673 334
217 3300050515 nmdc:mga0a205_414961_c1 nmdc:mga0a205_414961_c1_23_1027 334
218 3300005330 Ga0070690_100006762 Ga0070690_1000067622 335
219 3300005467 Ga0070706_100000436 Ga0070706_1000004365 335
220 3300005518 Ga0070699_100015657 Ga0070699_1000156573 335
221 3300009148 Ga0105243_10218827 Ga0105243_102188271 335
222 3300009177 Ga0105248_10008504 Ga0105248_100085046 335
223 3300009177 Ga0105248_10140567 Ga0105248_101405674 335
224 3300009545 Ga0105237_10103967 Ga0105237_101039672 335
225 3300013297 Ga0157378_10026327 Ga0157378_100263271 335
226 3300025910 Ga0207684_10003948 Ga0207684_100039486 335
227 3300025910 Ga0207684_10013297 Ga0207684_100132973 335
228 3300025941 Ga0207711_10002023 Ga0207711_1000202314 335
229 3300028800 Ga0265338_10013553 Ga0265338_100135537 335
230 3300031247 Ga0265340_10031906 Ga0265340_100319062 335
231 3300031691 Ga0316579_10001379 Ga0316579_100013793 335
232 3300031691 Ga0316579_10022190 Ga0316579_100221902 335
233 3300031727 Ga0316576_10000499 Ga0316576_1000049912 335
234 3300031727 Ga0316576_10004155 Ga0316576_100041557 335
235 3300031727 Ga0316576_10011843 Ga0316576_100118434 335
236 3300031727 Ga0316576_10100318 Ga0316576_101003182 335
237 3300031728 Ga0316578_10000285 Ga0316578_100002859 335
238 3300031728 Ga0316578_10002190 Ga0316578_1000219010 335
239 3300031728 Ga0316578_10100201 Ga0316578_101002011 335
240 3300031733 Ga0316577_10000341 Ga0316577_1000034113 335
241 3300031733 Ga0316577_10005012 Ga0316577_100050125 335
242 3300031733 Ga0316577_10035269 Ga0316577_100352692 335
243 3300031733 Ga0316577_10105499 Ga0316577_101054991 335
244 3300031733 Ga0316577_10161984 Ga0316577_101619841 335
245 3300032133 Ga0316583_10004147 Ga0316583_100041471 335
246 3300032133 Ga0316583_10032646 Ga0316583_100326461 335
247 3300032137 Ga0316585_10000177 Ga0316585_100001774 335
248 3300032139 Ga0316580_10000346 Ga0316580_100003463 335
249 3300033180 Ga0307510_10000005 Ga0307510_10000005262 335
250 3300033541 Ga0316596_1004572 Ga0316596_10045722 335
251 3300035398 Ga0316574_0003621 Ga0316574_0003621_2050_3078 335
252 3300035398 Ga0316574_0031157 Ga0316574_0031157_1528_2568 335
253 3300035398 Ga0316574_0094424 Ga0316574_0094424_845_1873 335
254 3300036647 Ga0316582_0001638 Ga0316582_0001638_2954_3982 335
255 3300036647 Ga0316582_0018492 Ga0316582_0018492_2029_3069 335
256 3300036647 Ga0316582_0069431 Ga0316582_0069431_1072_2100 335
257 3300036712 Ga0316584_0003162 Ga0316584_0003162_2108_3136 335
258 3300036712 Ga0316584_0005033 Ga0316584_0005033_3112_4140 335
259 3300036712 Ga0316584_0045925 Ga0316584_0045925_2027_3067 335
260 3300036712 Ga0316584_0048895 Ga0316584_0048895_383_1423 335
261 3300036712 Ga0316584_0125102 Ga0316584_0125102_435_1463 335
262 3300037588 Ga0316581_0000287 Ga0316581_0000287_5519_6547 335
263 3300037588 Ga0316581_0005973 Ga0316581_0005973_2064_3104 335
264 3300037588 Ga0316581_0021432 Ga0316581_0021432_231_1256 335
265 3300037853 Ga0436364_0031979 Ga0436364_0031979_24_1088 335
266 3300038725 Ga0400484_31965 Ga0400484_31965_16438_17466 335
267 3300038726 Ga0400490_38810 Ga0400490_38810_3339_4367 335
268 3300005406 Ga0070703_10000303 Ga0070703_100003034 336
269 3300005441 Ga0070700_100006078 Ga0070700_1000060784 336
270 3300025315 Ga0207697_10010603 Ga0207697_100106033 336
271 3300025885 Ga0207653_10000210 Ga0207653_100002104 336
272 3300005295 Ga0065707_10110044 Ga0065707_101100442 337
273 3300005330 Ga0070690_100130591 Ga0070690_1001305912 337
274 3300005336 Ga0070680_100140926 Ga0070680_1001409262 337
275 3300005343 Ga0070687_100039038 Ga0070687_1000390382 337
276 3300005353 Ga0070669_100004587 Ga0070669_1000045873 337
277 3300005356 Ga0070674_100068546 Ga0070674_1000685461 337
278 3300005364 Ga0070673_100024258 Ga0070673_1000242583 337
279 3300005364 Ga0070673_100094861 Ga0070673_1000948614 337
280 3300005364 Ga0070673_100241716 Ga0070673_1002417162 337
281 3300005434 Ga0070709_10194063 Ga0070709_101940631 337
282 3300005444 Ga0070694_100270238 Ga0070694_1002702381 337
283 3300005459 Ga0068867_100118406 Ga0068867_1001184062 337
284 3300005618 Ga0068864_100007715 Ga0068864_1000077154 337
285 3300005719 Ga0068861_100166908 Ga0068861_1001669082 337
286 3300005844 Ga0068862_100028146 Ga0068862_1000281464 337
287 3300006173 Ga0070716_100012811 Ga0070716_1000128111 337
288 3300006881 Ga0068865_100152371 Ga0068865_1001523712 337
289 3300009093 Ga0105240_10008440 Ga0105240_100084406 337
290 3300009094 Ga0111539_10102358 Ga0111539_101023582 337
291 3300009553 Ga0105249_10020889 Ga0105249_100208893 337
292 3300011119 Ga0105246_10174908 Ga0105246_101749082 337
293 3300013308 Ga0157375_10300590 Ga0157375_103005902 337
294 3300014326 Ga0157380_10002594 Ga0157380_100025944 337
295 3300025906 Ga0207699_10117782 Ga0207699_101177822 337
296 3300025918 Ga0207662_10052912 Ga0207662_100529122 337
297 3300025923 Ga0207681_10016336 Ga0207681_100163364 337
298 3300025933 Ga0207706_10047799 Ga0207706_100477993 337
299 3300025938 Ga0207704_10046703 Ga0207704_100467032 337
300 3300025960 Ga0207651_10032278 Ga0207651_100322782 337
301 3300025961 Ga0207712_10030357 Ga0207712_100303572 337
302 3300025981 Ga0207640_10110678 Ga0207640_101106782 337
303 3300026023 Ga0207677_10330032 Ga0207677_103300322 337
304 3300026075 Ga0207708_10009835 Ga0207708_100098353 337
305 3300026075 Ga0207708_10057712 Ga0207708_100577123 337
306 3300026089 Ga0207648_10025948 Ga0207648_100259485 337
307 3300026095 Ga0207676_10005442 Ga0207676_100054424 337
308 3300026118 Ga0207675_100045648 Ga0207675_1000456482 337
309 3300026121 Ga0207683_10071650 Ga0207683_100716503 337
310 3300046476 Ga0495662_0013675 Ga0495662_0013675_2690_3724 337
311 3300002459 JGI24751J29686_10000222 JGI24751J29686_1000022212 338
312 3300005289 Ga0065704_10006628 Ga0065704_100066284 338
313 3300005295 Ga0065707_10003075 Ga0065707_100030755 338
314 3300005295 Ga0065707_10084860 Ga0065707_100848602 338
315 3300005331 Ga0070670_100001195 Ga0070670_1000011953 338
316 3300005331 Ga0070670_100030144 Ga0070670_1000301441 338
317 3300005331 Ga0070670_100285265 Ga0070670_1002852651 338
318 3300005334 Ga0068869_100150773 Ga0068869_1001507733 338
319 3300005337 Ga0070682_100042271 Ga0070682_1000422713 338
320 3300005340 Ga0070689_100000404 Ga0070689_10000040429 338
321 3300005343 Ga0070687_100003900 Ga0070687_1000039004 338
322 3300005343 Ga0070687_100014864 Ga0070687_1000148642 338
323 3300005345 Ga0070692_10029218 Ga0070692_100292182 338
324 3300005345 Ga0070692_10162640 Ga0070692_101626401 338
325 3300005355 Ga0070671_100003274 Ga0070671_1000032746 338
326 3300005355 Ga0070671_100021163 Ga0070671_1000211633 338
327 3300005364 Ga0070673_100021702 Ga0070673_1000217022 338
328 3300005365 Ga0070688_100035449 Ga0070688_1000354492 338
329 3300005367 Ga0070667_100040393 Ga0070667_1000403932 338
330 3300005367 Ga0070667_100086764 Ga0070667_1000867642 338
331 3300005441 Ga0070700_100020541 Ga0070700_1000205414 338
332 3300005441 Ga0070700_100035285 Ga0070700_1000352852 338
333 3300005444 Ga0070694_100016632 Ga0070694_1000166322 338
334 3300005444 Ga0070694_100019151 Ga0070694_1000191513 338
335 3300005444 Ga0070694_100075578 Ga0070694_1000755781 338
336 3300005444 Ga0070694_100079753 Ga0070694_1000797532 338
337 3300005444 Ga0070694_100182738 Ga0070694_1001827381 338
338 3300005445 Ga0070708_100016668 Ga0070708_1000166686 338
339 3300005456 Ga0070678_100105237 Ga0070678_1001052371 338
340 3300005459 Ga0068867_100247547 Ga0068867_1002475471 338
341 3300005471 Ga0070698_100033518 Ga0070698_1000335183 338
342 3300005518 Ga0070699_100004454 Ga0070699_10000445411 338
343 3300005536 Ga0070697_100360136 Ga0070697_1003601361 338
344 3300005543 Ga0070672_100063823 Ga0070672_1000638232 338
345 3300005546 Ga0070696_100157438 Ga0070696_1001574381 338
346 3300005547 Ga0070693_100008726 Ga0070693_1000087261 338
347 3300005547 Ga0070693_100167270 Ga0070693_1001672702 338
348 3300005549 Ga0070704_100018543 Ga0070704_1000185432 338
349 3300005549 Ga0070704_100097516 Ga0070704_1000975162 338
350 3300005577 Ga0068857_100036219 Ga0068857_1000362196 338
351 3300005577 Ga0068857_100244710 Ga0068857_1002447102 338
352 3300005615 Ga0070702_100011809 Ga0070702_1000118094 338
353 3300005616 Ga0068852_100263243 Ga0068852_1002632432 338
354 3300005617 Ga0068859_100002785 Ga0068859_10000278511 338
355 3300005617 Ga0068859_100006017 Ga0068859_1000060174 338
356 3300005617 Ga0068859_100145597 Ga0068859_1001455973 338
357 3300005617 Ga0068859_100210892 Ga0068859_1002108922 338
358 3300005617 Ga0068859_100317888 Ga0068859_1003178882 338
359 3300005617 Ga0068859_100399897 Ga0068859_1003998972 338
360 3300005618 Ga0068864_100009934 Ga0068864_1000099346 338
361 3300005618 Ga0068864_100071213 Ga0068864_1000712132 338
362 3300005618 Ga0068864_100084805 Ga0068864_1000848053 338
363 3300005618 Ga0068864_100176981 Ga0068864_1001769812 338
364 3300005719 Ga0068861_100121115 Ga0068861_1001211152 338
365 3300005834 Ga0068851_10005347 Ga0068851_100053472 338
366 3300005840 Ga0068870_10091198 Ga0068870_100911983 338
367 3300005841 Ga0068863_100009090 Ga0068863_1000090902 338
368 3300005841 Ga0068863_100154464 Ga0068863_1001544642 338
369 3300005842 Ga0068858_100045584 Ga0068858_1000455843 338
370 3300005842 Ga0068858_100060987 Ga0068858_1000609872 338
371 3300005842 Ga0068858_100066611 Ga0068858_1000666112 338
372 3300005842 Ga0068858_100070487 Ga0068858_1000704876 338
373 3300005842 Ga0068858_100073163 Ga0068858_1000731633 338
374 3300005842 Ga0068858_100198419 Ga0068858_1001984192 338
375 3300005842 Ga0068858_100213771 Ga0068858_1002137711 338
376 3300005843 Ga0068860_100045095 Ga0068860_1000450952 338
377 3300005843 Ga0068860_100052868 Ga0068860_1000528683 338
378 3300005843 Ga0068860_100118906 Ga0068860_1001189064 338
379 3300005843 Ga0068860_100198094 Ga0068860_1001980943 338
380 3300005843 Ga0068860_100335372 Ga0068860_1003353722 338
381 3300005843 Ga0068860_100460824 Ga0068860_1004608242 338
382 3300005985 Ga0081539_10000823 Ga0081539_100008236 338
383 3300006028 Ga0070717_10168182 Ga0070717_101681821 338
384 3300006237 Ga0097621_100020521 Ga0097621_1000205211 338
385 3300006358 Ga0068871_100010186 Ga0068871_1000101863 338
386 3300006358 Ga0068871_100043948 Ga0068871_1000439481 338
387 3300006358 Ga0068871_100346142 Ga0068871_1003461422 338
388 3300006358 Ga0068871_100354876 Ga0068871_1003548761 338
389 3300006846 Ga0075430_100049830 Ga0075430_1000498303 338
390 3300006846 Ga0075430_100075849 Ga0075430_1000758494 338
391 3300006847 Ga0075431_100166157 Ga0075431_1001661573 338
392 3300006852 Ga0075433_10092171 Ga0075433_100921712 338
393 3300006914 Ga0075436_100000002 Ga0075436_10000000233 338
394 3300006931 Ga0097620_100002785 Ga0097620_10000278511 338
395 3300006931 Ga0097620_100006017 Ga0097620_1000060174 338
396 3300006931 Ga0097620_100145604 Ga0097620_1001456041 338
397 3300006931 Ga0097620_100210890 Ga0097620_1002108902 338
398 3300006931 Ga0097620_100317871 Ga0097620_1003178712 338
399 3300006931 Ga0097620_100399902 Ga0097620_1003999022 338
400 3300007076 Ga0075435_100002835 Ga0075435_1000028356 338
401 3300009093 Ga0105240_10143601 Ga0105240_101436012 338
402 3300009094 Ga0111539_10010910 Ga0111539_1001091010 338
403 3300009094 Ga0111539_10020646 Ga0111539_100206463 338
404 3300009094 Ga0111539_10032213 Ga0111539_100322136 338
405 3300009094 Ga0111539_10045777 Ga0111539_100457772 338
406 3300009098 Ga0105245_10015309 Ga0105245_100153095 338
407 3300009098 Ga0105245_10193661 Ga0105245_101936611 338
408 3300009101 Ga0105247_10000534 Ga0105247_100005344 338
409 3300009101 Ga0105247_10061468 Ga0105247_100614682 338
410 3300009147 Ga0114129_10030392 Ga0114129_100303924 338
411 3300009147 Ga0114129_10044005 Ga0114129_100440053 338
412 3300009147 Ga0114129_10102717 Ga0114129_101027172 338
413 3300009147 Ga0114129_10203575 Ga0114129_102035752 338
414 3300009148 Ga0105243_10000073 Ga0105243_1000007372 338
415 3300009148 Ga0105243_10004691 Ga0105243_100046912 338
416 3300009148 Ga0105243_10014886 Ga0105243_100148862 338
417 3300009148 Ga0105243_10098567 Ga0105243_100985674 338
418 3300009174 Ga0105241_10069393 Ga0105241_100693933 338
419 3300009176 Ga0105242_10000043 Ga0105242_1000004312 338
420 3300009176 Ga0105242_10001013 Ga0105242_100010135 338
421 3300009176 Ga0105242_10001366 Ga0105242_1000136612 338
422 3300009176 Ga0105242_10043521 Ga0105242_100435212 338
423 3300009176 Ga0105242_10059252 Ga0105242_100592524 338
424 3300009177 Ga0105248_10011822 Ga0105248_100118223 338
425 3300009177 Ga0105248_10027618 Ga0105248_100276182 338
426 3300009177 Ga0105248_10244075 Ga0105248_102440752 338
427 3300009177 Ga0105248_10448996 Ga0105248_104489962 338
428 3300009177 Ga0105248_10526360 Ga0105248_105263601 338
429 3300009545 Ga0105237_10002093 Ga0105237_100020937 338
430 3300009551 Ga0105238_10018882 Ga0105238_100188822 338
431 3300009551 Ga0105238_10036299 Ga0105238_100362997 338
432 3300009551 Ga0105238_10415066 Ga0105238_104150662 338
433 3300009553 Ga0105249_10001548 Ga0105249_1000154814 338
434 3300009553 Ga0105249_10184919 Ga0105249_101849192 338
435 3300009553 Ga0105249_10320377 Ga0105249_103203772 338
436 3300010375 Ga0105239_10526102 Ga0105239_105261021 338
437 3300011119 Ga0105246_10102704 Ga0105246_101027042 338
438 3300011119 Ga0105246_10203807 Ga0105246_102038072 338
439 3300011119 Ga0105246_10207796 Ga0105246_102077962 338
440 3300011119 Ga0105246_10296807 Ga0105246_102968071 338
441 3300011119 Ga0105246_10315591 Ga0105246_103155912 338
442 3300013100 Ga0157373_10009657 Ga0157373_100096573 338
443 3300013296 Ga0157374_10004256 Ga0157374_100042567 338
444 3300013297 Ga0157378_10000004 Ga0157378_1000000495 338
445 3300013297 Ga0157378_10001387 Ga0157378_100013876 338
446 3300013306 Ga0163162_10000831 Ga0163162_100008313 338
447 3300013306 Ga0163162_10030430 Ga0163162_100304303 338
448 3300013306 Ga0163162_10031277 Ga0163162_100312776 338
449 3300013306 Ga0163162_10100598 Ga0163162_101005982 338
450 3300013306 Ga0163162_10176740 Ga0163162_101767402 338
451 3300013306 Ga0163162_10609380 Ga0163162_106093802 338
452 3300013308 Ga0157375_10000479 Ga0157375_100004796 338
453 3300013308 Ga0157375_10297341 Ga0157375_102973413 338
454 3300013308 Ga0157375_10516599 Ga0157375_105165992 338
455 3300014325 Ga0163163_10000334 Ga0163163_1000033415 338
456 3300014325 Ga0163163_10004205 Ga0163163_100042056 338
457 3300014325 Ga0163163_10041815 Ga0163163_100418152 338
458 3300014325 Ga0163163_10232652 Ga0163163_102326522 338
459 3300014325 Ga0163163_10331353 Ga0163163_103313532 338
460 3300014326 Ga0157380_10185470 Ga0157380_101854702 338
461 3300014745 Ga0157377_10042076 Ga0157377_100420762 338
462 3300014745 Ga0157377_10144320 Ga0157377_101443202 338
463 3300014968 Ga0157379_10058097 Ga0157379_100580974 338
464 3300014968 Ga0157379_10093518 Ga0157379_100935183 338
465 3300014969 Ga0157376_10008430 Ga0157376_100084305 338
466 3300025315 Ga0207697_10013386 Ga0207697_100133863 338
467 3300025321 Ga0207656_10002909 Ga0207656_100029095 338
468 3300025885 Ga0207653_10002366 Ga0207653_100023662 338
469 3300025900 Ga0207710_10001728 Ga0207710_1000172810 338
470 3300025900 Ga0207710_10019201 Ga0207710_100192012 338
471 3300025903 Ga0207680_10013599 Ga0207680_100135993 338
472 3300025908 Ga0207643_10003313 Ga0207643_100033138 338
473 3300025913 Ga0207695_10149201 Ga0207695_101492012 338
474 3300025917 Ga0207660_10204403 Ga0207660_102044031 338
475 3300025918 Ga0207662_10011021 Ga0207662_100110213 338
476 3300025918 Ga0207662_10075686 Ga0207662_100756862 338
477 3300025918 Ga0207662_10234836 Ga0207662_102348362 338
478 3300025922 Ga0207646_10043228 Ga0207646_100432282 338
479 3300025922 Ga0207646_10111341 Ga0207646_101113412 338
480 3300025924 Ga0207694_10013885 Ga0207694_100138855 338
481 3300025925 Ga0207650_10000332 Ga0207650_1000033234 338
482 3300025925 Ga0207650_10014749 Ga0207650_100147495 338
483 3300025926 Ga0207659_10157273 Ga0207659_101572732 338
484 3300025931 Ga0207644_10018001 Ga0207644_100180013 338
485 3300025931 Ga0207644_10049981 Ga0207644_100499812 338
486 3300025933 Ga0207706_10102676 Ga0207706_101026763 338
487 3300025934 Ga0207686_10000003 Ga0207686_1000000331 338
488 3300025934 Ga0207686_10000244 Ga0207686_100002442 338
489 3300025934 Ga0207686_10000965 Ga0207686_100009655 338
490 3300025934 Ga0207686_10047545 Ga0207686_100475454 338
491 3300025935 Ga0207709_10000124 Ga0207709_1000012432 338
492 3300025935 Ga0207709_10000469 Ga0207709_100004697 338
493 3300025941 Ga0207711_10245037 Ga0207711_102450371 338
494 3300025942 Ga0207689_10031409 Ga0207689_100314095 338
495 3300025942 Ga0207689_10093643 Ga0207689_100936432 338
496 3300025942 Ga0207689_10240501 Ga0207689_102405012 338
497 3300025945 Ga0207679_10122782 Ga0207679_101227822 338
498 3300025945 Ga0207679_10289176 Ga0207679_102891762 338
499 3300025960 Ga0207651_10067130 Ga0207651_100671303 338
500 3300025981 Ga0207640_10264528 Ga0207640_102645281 338
501 3300025986 Ga0207658_10011740 Ga0207658_100117404 338
502 3300025986 Ga0207658_10173235 Ga0207658_101732352 338
503 3300026035 Ga0207703_10026355 Ga0207703_100263552 338
504 3300026035 Ga0207703_10043076 Ga0207703_100430762 338
505 3300026035 Ga0207703_10048692 Ga0207703_100486922 338
506 3300026035 Ga0207703_10074709 Ga0207703_100747093 338
507 3300026035 Ga0207703_10121190 Ga0207703_101211904 338
508 3300026035 Ga0207703_10202594 Ga0207703_102025942 338
509 3300026075 Ga0207708_10004335 Ga0207708_100043359 338
510 3300026075 Ga0207708_10033292 Ga0207708_100332924 338
511 3300026075 Ga0207708_10277542 Ga0207708_102775422 338
512 3300026088 Ga0207641_10004482 Ga0207641_1000448212 338
513 3300026088 Ga0207641_10038653 Ga0207641_100386533 338
514 3300026089 Ga0207648_10010332 Ga0207648_100103326 338
515 3300026089 Ga0207648_10029644 Ga0207648_100296442 338
516 3300026089 Ga0207648_10114316 Ga0207648_101143162 338
517 3300026095 Ga0207676_10149182 Ga0207676_101491822 338
518 3300026116 Ga0207674_10107892 Ga0207674_101078922 338
519 3300026116 Ga0207674_10257850 Ga0207674_102578502 338
520 3300026118 Ga0207675_100012394 Ga0207675_1000123946 338
521 3300026118 Ga0207675_100191250 Ga0207675_1001912502 338
522 3300026142 Ga0207698_10123894 Ga0207698_101238943 338
523 3300027907 Ga0207428_10012870 Ga0207428_100128707 338
524 3300027907 Ga0207428_10028144 Ga0207428_100281442 338
525 3300028381 Ga0268264_10016000 Ga0268264_100160005 338
526 3300028381 Ga0268264_10105726 Ga0268264_101057262 338
527 3300028381 Ga0268264_10120699 Ga0268264_101206992 338
528 3300028381 Ga0268264_10223307 Ga0268264_102233072 338
529 3300028381 Ga0268264_10303970 Ga0268264_103039702 338
530 3300031548 Ga0307408_100056807 Ga0307408_1000568072 338
531 3300031731 Ga0307405_10110334 Ga0307405_101103341 338
532 3300032002 Ga0307416_100087318 Ga0307416_1000873182 338
533 3300032005 Ga0307411_10024372 Ga0307411_100243721 338
534 3300035091 Ga0373951_0000742 Ga0373951_0000742_5619_6635 338
535 3300035207 Ga0373942_0008109 Ga0373942_0008109_33_1049 338
536 3300036401 Ga0373937_0132051 Ga0373937_0132051_81_1118 338
537 3300038699 Ga0242422_01793 Ga0242422_01793_362_1378 338
538 3300038726 Ga0400490_33134 Ga0400490_33134_2121_3176 338
539 3300038996 Ga0242420_002873 Ga0242420_002873_17_1033 338
540 3300044712 Ga0453684_0125662 Ga0453684_0125662_1863_2900 338
541 3300045051 Ga0451576_0006280 Ga0451576_0006280_11326_12363 338
542 3300045051 Ga0451576_0301864 Ga0451576_0301864_473_1510 338
543 3300045051 Ga0451576_0341651 Ga0451576_0341651_475_1491 338
544 3300046660 Ga0495625_0030579 Ga0495625_0030579_2753_3784 338
545 3300046664 Ga0495659_0002750 Ga0495659_0002750_3550_4584 338
546 3300046684 Ga0495669_0045581 Ga0495669_0045581_339_1373 338
547 3300046689 Ga0495613_0187058 Ga0495613_0187058_118_1155 338
548 3300046691 Ga0495670_0054795 Ga0495670_0054795_95_1129 338
549 3300046809 Ga0495600_0144909 Ga0495600_0144909_271_1308 338
550 3300048904 Ga0496101_0274862 Ga0496101_0274862_78_1115 338
551 3300048909 Ga0496106_0090303 Ga0496106_0090303_943_1959 338
552 3300048912 Ga0496109_0345642 Ga0496109_0345642_291_1307 338
553 3300048915 Ga0496112_0121793 Ga0496112_0121793_1358_2374 338
554 3300048915 Ga0496112_0285811 Ga0496112_0285811_171_1187 338
555 3300048923 Ga0496120_0104523 Ga0496120_0104523_251_1294 338
556 3300048924 Ga0496121_0125202 Ga0496121_0125202_57_1112 338
557 3300048927 Ga0496124_0001839 Ga0496124_0001839_25802_26845 338
558 3300048927 Ga0496124_0087708 Ga0496124_0087708_362_1399 338
559 3300049576 Ga0501040_0049411 Ga0501040_0049411_868_1920 338
560 3300049577 Ga0501041_0020449 Ga0501041_0020449_2717_3769 338
561 3300049584 Ga0501068_0195917 Ga0501068_0195917_120_1214 338
562 3300049587 Ga0501071_0060318 Ga0501071_0060318_399_1451 338
563 3300049588 Ga0501072_0010271 Ga0501072_0010271_4842_5894 338
564 3300049588 Ga0501072_0010575 Ga0501072_0010575_1901_2953 338
565 3300049588 Ga0501072_0114173 Ga0501072_0114173_630_1682 338
566 3300049591 Ga0501075_0003149 Ga0501075_0003149_5865_6917 338
567 3300049591 Ga0501075_0031840 Ga0501075_0031840_742_1794 338
568 3300049592 Ga0501076_0009507 Ga0501076_0009507_873_1925 338
569 3300049661 Ga0501217_053726 Ga0501217_053726_19_1035 338
570 3300049665 Ga0501227_009038 Ga0501227_009038_759_1775 338
571 3300049675 Ga0501243_017986 Ga0501243_017986_89_1117 338
572 3300049686 Ga0501257_020454 Ga0501257_020454_80_1108 338
573 3300049705 Ga0501225_0012602 Ga0501225_0012602_902_1930 338
574 3300049741 Ga0501079_0108705 Ga0501079_0108705_289_1341 338
575 3300049741 Ga0501079_0275911 Ga0501079_0275911_169_1221 338
576 3300049743 Ga0501081_0050029 Ga0501081_0050029_1405_2457 338
577 3300049765 Ga0501268_010107 Ga0501268_010107_431_1447 338
578 3300049770 Ga0501273_006720 Ga0501273_006720_226_1254 338
579 3300049853 Ga0501226_002191 Ga0501226_002191_870_1898 338
580 3300050507 nmdc:mga05p37_146994_c1 nmdc:mga05p37_146994_c1_853_1869 338
581 3300050507 nmdc:mga05p37_424234_c1 nmdc:mga05p37_424234_c1_302_1318 338
582 3300050508 nmdc:mga09592_471273_c1 nmdc:mga09592_471273_c1_27_1043 338
583 3300050509 nmdc:mga0qj67_8504_c1 nmdc:mga0qj67_8504_c1_6106_7122 338
584 3300050510 nmdc:mga06r32_99271_c1 nmdc:mga06r32_99271_c1_1085_2101 338
585 3300050511 nmdc:mga08y16_14577_c1 nmdc:mga08y16_14577_c1_5501_6526 338
586 3300050511 nmdc:mga08y16_167088_c1 nmdc:mga08y16_167088_c1_936_2060 338
587 3300050513 nmdc:mga0rr50_1698_c1 nmdc:mga0rr50_1698_c1_6438_7475 338
588 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_379133_380170 338
589 3300050515 nmdc:mga0a205_97266_c1 nmdc:mga0a205_97266_c1_1777_2793 338
590 3300053139 Ga0500568_0006578 Ga0500568_0006578_1505_2542 338
591 3300053139 Ga0500568_0010599 Ga0500568_0010599_1763_2800 338
592 3300053146 Ga0500588_0003036 Ga0500588_0003036_612_1640 338
593 3300053151 Ga0500604_0005744 Ga0500604_0005744_1399_2436 338
594 3300053156 Ga0500622_0000360 Ga0500622_0000360_10772_11809 338
595 3300054114 Ga0501084_0044987 Ga0501084_0044987_1631_2683 338
596 3300061734 Ga0530510_0024894 Ga0530510_0024894_940_1977 338
597 3300061734 Ga0530510_0028936 Ga0530510_0028936_798_1850 338
598 3300061734 Ga0530510_0087764 Ga0530510_0087764_301_1353 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05544

Pro_racemase

Proline racemase

62

384

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r76-assembly2.cif.gz_C crystal structure of trans-3-hydroxy-l-proline dehydratase from thermococcus litoralis - open conformation 0.9866 4 338
6r77-assembly1.cif.gz_B crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation 0.983 4 338
6r76-assembly2.cif.gz_C crystal structure of trans-3-hydroxy-l-proline dehydratase from thermococcus litoralis - open conformation 0.975 4 338
8a4r-assembly1.cif.gz_CCC-2 proline racemase (pror) from the gram-positive bacterium acetoanaerobium sticklandii from isotropic orthorhombic data at 3.59 a 0.9738 14 337
6r77-assembly1.cif.gz_B crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation 0.9715 4 338
ID Description Score Start End Superfamily
af_Q868H8_133_298_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9778 147 295 3.10.310.10
af_A0A0G2L1A2_13_139_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9693 16 130 3.10.310.10
4q2hB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9597 148 313 3.10.310.10
af_Q868H8_7_132_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9544 18 130 3.10.310.10
4q2hB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.954 148 313 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A662NDC0-F1-model_v4 deleted 0.9931 176 338
AF-A0A536IB20-F1-model_v4 Proline racemase 0.9911 204 338 GO:0047580
AF-A0A662CZS7-F1-model_v4 Proline racemase 0.9904 153 338 GO:0047580
AF-A0A352XV39-F1-model_v4 Proline racemase 0.9889 108 338 GO:0047580
AF-A0A7W0A336-F1-model_v4 Proline racemase family protein 0.9888 178 338 GO:0047580

Feature Viewer

pLDDT pTM Quality
94.72 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map