F467762
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 264 | 592 | 339 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100210892|Ga0068859_1002108922 |
| Length | 386 |
| Sequence | MSELVDGTGTAGVPACYKTTKIIVGYRAGEDDCVPSNSDIIMTNCFNNWNWQPPSLWQKITTIEMHTGGEPLRVFVFGLPPIEGNTVLEKRRYFREHYDHIRKGTMWEPRGHADMYGAVVTQSRDADLDVFFLHNEGYSTMCGHAIIALTKLAIETGLVGKPLERRQLTINVPAGRIKAEARVANGKVCETSFHNVASFLYLRDQEVDVPGIGLVRFDVSYGGAFYAFVDAASVGVRLVAEDLPRLIDYGRRIKHAVMENFPIKHPFEDDLSFLYGTIFTGPALDLAHHSRNVCIFADGEVDRSATGSGVSARAALHHAKSELNVGEKITIESIVGSTMGVKVVELTRFGPYDAVIPEVSGTASFTGRNEFWFDPEDEFGNGFILR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 2 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 3 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 4 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 175 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 176 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 188 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 189 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 190 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 210 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 229 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 232 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 233 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 235 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 236 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 237 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 239 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 240 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 244 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 245 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 258 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 259 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 260 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 264 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.51 |
| Nodule | 0.67 |
| Rhizoplane | 1.17 |
| Rhizosphere | 94.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000222 | 3300002459 | Bacteria | 23862 |
| 2 | Ga0065714_10064524 | 3300005288 | Bacteria | 41924 |
| 3 | Ga0065704_10006628 | 3300005289 | Unclassified | 3966 |
| 4 | Ga0065712_10003097 | 3300005290 | Bacteria | 5385 |
| 5 | Ga0065715_10092098 | 3300005293 | Bacteria | 5337 |
| 6 | Ga0065707_10003075 | 3300005295 | Bacteria | 6028 |
| 7 | Ga0065707_10084860 | 3300005295 | Bacteria | 6702 |
| 8 | Ga0065707_10110044 | 3300005295 | Unclassified | 2446 |
| 9 | Ga0070676_10163523 | 3300005328 | Bacteria | 1434 |
| 10 | Ga0070690_100000760 | 3300005330 | Bacteria | 16501 |
| 11 | Ga0070690_100006762 | 3300005330 | Bacteria | 6516 |
| 12 | Ga0070690_100130591 | 3300005330 | Unclassified | 1696 |
| 13 | Ga0070670_100001195 | 3300005331 | Bacteria | 20613 |
| 14 | Ga0070670_100018076 | 3300005331 | Bacteria | 6051 |
| 15 | Ga0070670_100030144 | 3300005331 | Unclassified | 4672 |
| 16 | Ga0070670_100285265 | 3300005331 | Bacteria | 1442 |
| 17 | Ga0068869_100003816 | 3300005334 | Bacteria | 9292 |
| 18 | Ga0068869_100150773 | 3300005334 | Bacteria | 1803 |
| 19 | Ga0068869_100234814 | 3300005334 | Bacteria | 1458 |
| 20 | Ga0070666_10010982 | 3300005335 | Bacteria | 5675 |
| 21 | Ga0070680_100004282 | 3300005336 | Bacteria | 10720 |
| 22 | Ga0070680_100140926 | 3300005336 | Bacteria | 2022 |
| 23 | Ga0070682_100012841 | 3300005337 | Bacteria | 4807 |
| 24 | Ga0070682_100042271 | 3300005337 | Bacteria | 2812 |
| 25 | Ga0070682_100075823 | 3300005337 | Bacteria | 2164 |
| 26 | Ga0070689_100000404 | 3300005340 | Bacteria | 25404 |
| 27 | Ga0070689_100007201 | 3300005340 | Bacteria | 7756 |
| 28 | Ga0070687_100002878 | 3300005343 | Bacteria | 6577 |
| 29 | Ga0070687_100003900 | 3300005343 | Bacteria | 5865 |
| 30 | Ga0070687_100014864 | 3300005343 | Unclassified | 3506 |
| 31 | Ga0070687_100039038 | 3300005343 | Unclassified | 2383 |
| 32 | Ga0070661_100001230 | 3300005344 | Bacteria | 18024 |
| 33 | Ga0070692_10029218 | 3300005345 | Bacteria | 2746 |
| 34 | Ga0070692_10112942 | 3300005345 | Bacteria | 1505 |
| 35 | Ga0070692_10162640 | 3300005345 | Unclassified | 1280 |
| 36 | Ga0070668_100190783 | 3300005347 | Bacteria | 1678 |
| 37 | Ga0070669_100004587 | 3300005353 | Bacteria | 9976 |
| 38 | Ga0070675_100001429 | 3300005354 | Bacteria | 17548 |
| 39 | Ga0070671_100003274 | 3300005355 | Bacteria | 12633 |
| 40 | Ga0070671_100012305 | 3300005355 | Bacteria | 6889 |
| 41 | Ga0070671_100021163 | 3300005355 | Bacteria | 5311 |
| 42 | Ga0070674_100068546 | 3300005356 | Bacteria | 2500 |
| 43 | Ga0070673_100020327 | 3300005364 | Bacteria | 4788 |
| 44 | Ga0070673_100021702 | 3300005364 | Bacteria | 4663 |
| 45 | Ga0070673_100024258 | 3300005364 | Bacteria | 4444 |
| 46 | Ga0070673_100094861 | 3300005364 | Bacteria | 2446 |
| 47 | Ga0070673_100241716 | 3300005364 | Bacteria | 1570 |
| 48 | Ga0070688_100035449 | 3300005365 | Bacteria | 3031 |
| 49 | Ga0070667_100012250 | 3300005367 | Bacteria | 7094 |
| 50 | Ga0070667_100040393 | 3300005367 | Bacteria | 3912 |
| 51 | Ga0070667_100086764 | 3300005367 | Bacteria | 2685 |
| 52 | Ga0070667_100128215 | 3300005367 | Unclassified | 2213 |
| 53 | Ga0070703_10000303 | 3300005406 | Bacteria | 22520 |
| 54 | Ga0070703_10003997 | 3300005406 | Bacteria | 4168 |
| 55 | Ga0070709_10194063 | 3300005434 | Bacteria | 1434 |
| 56 | Ga0070705_100007443 | 3300005440 | Bacteria | 5387 |
| 57 | Ga0070700_100000101 | 3300005441 | Bacteria | 53894 |
| 58 | Ga0070700_100006078 | 3300005441 | Bacteria | 6429 |
| 59 | Ga0070700_100020541 | 3300005441 | Unclassified | 3827 |
| 60 | Ga0070700_100035285 | 3300005441 | Bacteria | 3026 |
| 61 | Ga0070700_100044878 | 3300005441 | Bacteria | 2724 |
| 62 | Ga0070694_100009983 | 3300005444 | Bacteria | 5836 |
| 63 | Ga0070694_100016632 | 3300005444 | Unclassified | 4632 |
| 64 | Ga0070694_100019151 | 3300005444 | Bacteria | 4353 |
| 65 | Ga0070694_100075578 | 3300005444 | Bacteria | 2330 |
| 66 | Ga0070694_100079753 | 3300005444 | Bacteria | 2273 |
| 67 | Ga0070694_100182738 | 3300005444 | Bacteria | 1552 |
| 68 | Ga0070694_100270238 | 3300005444 | Unclassified | 1293 |
| 69 | Ga0070708_100016668 | 3300005445 | Bacteria | 6105 |
| 70 | Ga0070708_100151474 | 3300005445 | Bacteria | 2157 |
| 71 | Ga0070678_100034748 | 3300005456 | Bacteria | 3513 |
| 72 | Ga0070678_100105237 | 3300005456 | Bacteria | 2196 |
| 73 | Ga0070681_10001279 | 3300005458 | Bacteria | 21955 |
| 74 | Ga0068867_100012328 | 3300005459 | Bacteria | 6048 |
| 75 | Ga0068867_100118406 | 3300005459 | Unclassified | 2043 |
| 76 | Ga0068867_100134260 | 3300005459 | Bacteria | 1927 |
| 77 | Ga0068867_100247547 | 3300005459 | Bacteria | 1448 |
| 78 | Ga0070685_10020641 | 3300005466 | Bacteria | 3566 |
| 79 | Ga0070706_100000436 | 3300005467 | Bacteria | 50128 |
| 80 | Ga0070707_100037385 | 3300005468 | Bacteria | 4633 |
| 81 | Ga0070698_100033518 | 3300005471 | Bacteria | 5318 |
| 82 | Ga0070698_100042506 | 3300005471 | Bacteria | 4662 |
| 83 | Ga0070699_100004454 | 3300005518 | Bacteria | 12385 |
| 84 | Ga0070699_100015657 | 3300005518 | Bacteria | 6513 |
| 85 | Ga0070699_100080573 | 3300005518 | Bacteria | 2837 |
| 86 | Ga0070679_100002107 | 3300005530 | Bacteria | 17921 |
| 87 | Ga0070684_100094857 | 3300005535 | Bacteria | 2658 |
| 88 | Ga0070697_100054555 | 3300005536 | Bacteria | 3249 |
| 89 | Ga0070697_100360136 | 3300005536 | Unclassified | 1257 |
| 90 | Ga0070672_100004458 | 3300005543 | Bacteria | 9168 |
| 91 | Ga0070672_100063823 | 3300005543 | Unclassified | 2908 |
| 92 | Ga0070686_100000900 | 3300005544 | Bacteria | 17298 |
| 93 | Ga0070686_100007985 | 3300005544 | Bacteria | 5914 |
| 94 | Ga0070695_100114680 | 3300005545 | Bacteria | 1835 |
| 95 | Ga0070696_100103444 | 3300005546 | Bacteria | 2043 |
| 96 | Ga0070696_100157438 | 3300005546 | Bacteria | 1671 |
| 97 | Ga0070693_100008726 | 3300005547 | Bacteria | 5017 |
| 98 | Ga0070693_100167270 | 3300005547 | Bacteria | 1405 |
| 99 | Ga0070665_100062296 | 3300005548 | Bacteria | 3740 |
| 100 | Ga0070704_100018543 | 3300005549 | Unclassified | 4453 |
| 101 | Ga0070704_100076016 | 3300005549 | Bacteria | 2455 |
| 102 | Ga0070704_100097516 | 3300005549 | Bacteria | 2206 |
| 103 | Ga0070664_100020875 | 3300005564 | Bacteria | 5396 |
| 104 | Ga0070664_100100011 | 3300005564 | Bacteria | 2521 |
| 105 | Ga0070664_100165228 | 3300005564 | Unclassified | 1961 |
| 106 | Ga0068857_100022400 | 3300005577 | Bacteria | 5558 |
| 107 | Ga0068857_100036219 | 3300005577 | Unclassified | 4372 |
| 108 | Ga0068857_100244710 | 3300005577 | Bacteria | 1643 |
| 109 | Ga0068856_100161748 | 3300005614 | Bacteria | 2249 |
| 110 | Ga0070702_100011809 | 3300005615 | Bacteria | 4355 |
| 111 | Ga0070702_100081775 | 3300005615 | Bacteria | 1936 |
| 112 | Ga0068852_100263243 | 3300005616 | Bacteria | 1656 |
| 113 | Ga0068859_100002785 | 3300005617 | Bacteria | 17712 |
| 114 | Ga0068859_100006017 | 3300005617 | Bacteria | 12326 |
| 115 | Ga0068859_100007186 | 3300005617 | Bacteria | 11302 |
| 116 | Ga0068859_100062185 | 3300005617 | Bacteria | 3763 |
| 117 | Ga0068859_100145597 | 3300005617 | Bacteria | 2444 |
| 118 | Ga0068859_100210892 | 3300005617 | Bacteria | 2029 |
| 119 | Ga0068859_100251331 | 3300005617 | Bacteria | 1859 |
| 120 | Ga0068859_100317888 | 3300005617 | Unclassified | 1651 |
| 121 | Ga0068859_100399897 | 3300005617 | Bacteria | 1469 |
| 122 | Ga0068864_100001368 | 3300005618 | Bacteria | 20233 |
| 123 | Ga0068864_100007715 | 3300005618 | Bacteria | 8866 |
| 124 | Ga0068864_100009934 | 3300005618 | Bacteria | 7851 |
| 125 | Ga0068864_100071213 | 3300005618 | Bacteria | 3027 |
| 126 | Ga0068864_100084805 | 3300005618 | Bacteria | 2784 |
| 127 | Ga0068864_100176981 | 3300005618 | Bacteria | 1948 |
| 128 | Ga0068861_100003244 | 3300005719 | Bacteria | 10768 |
| 129 | Ga0068861_100121115 | 3300005719 | Bacteria | 2111 |
| 130 | Ga0068861_100166908 | 3300005719 | Bacteria | 1821 |
| 131 | Ga0068851_10005347 | 3300005834 | Bacteria | 5827 |
| 132 | Ga0068870_10091198 | 3300005840 | Bacteria | 1704 |
| 133 | Ga0068863_100005547 | 3300005841 | Bacteria | 12408 |
| 134 | Ga0068863_100009090 | 3300005841 | Bacteria | 9701 |
| 135 | Ga0068863_100154464 | 3300005841 | Bacteria | 2197 |
| 136 | Ga0068863_100156741 | 3300005841 | Bacteria | 2180 |
| 137 | Ga0068863_100275398 | 3300005841 | Unclassified | 1629 |
| 138 | Ga0068858_100016740 | 3300005842 | Bacteria | 6884 |
| 139 | Ga0068858_100039467 | 3300005842 | Bacteria | 4378 |
| 140 | Ga0068858_100045584 | 3300005842 | Bacteria | 4064 |
| 141 | Ga0068858_100060987 | 3300005842 | Bacteria | 3486 |
| 142 | Ga0068858_100066611 | 3300005842 | Bacteria | 3335 |
| 143 | Ga0068858_100070487 | 3300005842 | Bacteria | 3240 |
| 144 | Ga0068858_100073163 | 3300005842 | Bacteria | 3182 |
| 145 | Ga0068858_100198419 | 3300005842 | Bacteria | 1897 |
| 146 | Ga0068858_100213771 | 3300005842 | Bacteria | 1825 |
| 147 | Ga0068858_100300085 | 3300005842 | Unclassified | 1532 |
| 148 | Ga0068860_100005318 | 3300005843 | Bacteria | 13066 |
| 149 | Ga0068860_100045095 | 3300005843 | Bacteria | 4203 |
| 150 | Ga0068860_100052868 | 3300005843 | Bacteria | 3863 |
| 151 | Ga0068860_100118906 | 3300005843 | Bacteria | 2529 |
| 152 | Ga0068860_100198094 | 3300005843 | Bacteria | 1946 |
| 153 | Ga0068860_100213011 | 3300005843 | Bacteria | 1874 |
| 154 | Ga0068860_100335372 | 3300005843 | Bacteria | 1486 |
| 155 | Ga0068860_100460824 | 3300005843 | Bacteria | 1265 |
| 156 | Ga0068862_100007725 | 3300005844 | Bacteria | 8894 |
| 157 | Ga0068862_100028146 | 3300005844 | Bacteria | 4732 |
| 158 | Ga0068862_100158407 | 3300005844 | Unclassified | 2019 |
| 159 | Ga0081539_10000823 | 3300005985 | Bacteria | 59946 |
| 160 | Ga0070717_10168182 | 3300006028 | Bacteria | 1905 |
| 161 | Ga0070716_100012811 | 3300006173 | Bacteria | 4261 |
| 162 | Ga0075366_10002853 | 3300006195 | Bacteria | 8954 |
| 163 | Ga0097621_100020521 | 3300006237 | Bacteria | 5091 |
| 164 | Ga0097621_100092632 | 3300006237 | Bacteria | 2531 |
| 165 | Ga0068871_100010186 | 3300006358 | Bacteria | 6846 |
| 166 | Ga0068871_100043948 | 3300006358 | Bacteria | 3591 |
| 167 | Ga0068871_100059410 | 3300006358 | Bacteria | 3115 |
| 168 | Ga0068871_100346142 | 3300006358 | Bacteria | 1314 |
| 169 | Ga0068871_100354876 | 3300006358 | Bacteria | 1298 |
| 170 | Ga0075428_100004837 | 3300006844 | Bacteria | 14943 |
| 171 | Ga0075430_100005043 | 3300006846 | Bacteria | 11116 |
| 172 | Ga0075430_100049830 | 3300006846 | Bacteria | 3533 |
| 173 | Ga0075430_100075849 | 3300006846 | Bacteria | 2818 |
| 174 | Ga0075431_100000095 | 3300006847 | Bacteria | 54629 |
| 175 | Ga0075431_100002478 | 3300006847 | Bacteria | 17790 |
| 176 | Ga0075431_100166157 | 3300006847 | Bacteria | 2268 |
| 177 | Ga0075433_10011156 | 3300006852 | Bacteria | 7228 |
| 178 | Ga0075433_10053421 | 3300006852 | Bacteria | 3522 |
| 179 | Ga0075433_10092171 | 3300006852 | Bacteria | 2679 |
| 180 | Ga0075434_100018537 | 3300006871 | Bacteria | 6725 |
| 181 | Ga0075429_100002344 | 3300006880 | Bacteria | 15924 |
| 182 | Ga0068865_100152371 | 3300006881 | Unclassified | 1755 |
| 183 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 184 | Ga0097620_100002785 | 3300006931 | Bacteria | 17712 |
| 185 | Ga0097620_100006017 | 3300006931 | Bacteria | 12326 |
| 186 | Ga0097620_100007186 | 3300006931 | Bacteria | 11302 |
| 187 | Ga0097620_100062182 | 3300006931 | Bacteria | 3763 |
| 188 | Ga0097620_100145604 | 3300006931 | Bacteria | 2444 |
| 189 | Ga0097620_100210890 | 3300006931 | Bacteria | 2029 |
| 190 | Ga0097620_100251327 | 3300006931 | Bacteria | 1859 |
| 191 | Ga0097620_100317871 | 3300006931 | Unclassified | 1651 |
| 192 | Ga0097620_100399902 | 3300006931 | Bacteria | 1469 |
| 193 | Ga0075435_100002835 | 3300007076 | Bacteria | 11598 |
| 194 | Ga0105251_10023950 | 3300009011 | Bacteria | 3142 |
| 195 | Ga0105240_10008440 | 3300009093 | Bacteria | 14735 |
| 196 | Ga0105240_10143601 | 3300009093 | Bacteria | 2851 |
| 197 | Ga0111539_10010910 | 3300009094 | Bacteria | 11435 |
| 198 | Ga0111539_10020646 | 3300009094 | Bacteria | 8113 |
| 199 | Ga0111539_10032213 | 3300009094 | Bacteria | 6368 |
| 200 | Ga0111539_10045777 | 3300009094 | Bacteria | 5236 |
| 201 | Ga0111539_10102358 | 3300009094 | Unclassified | 3361 |
| 202 | Ga0105245_10015309 | 3300009098 | Bacteria | 6684 |
| 203 | Ga0105245_10193661 | 3300009098 | Unclassified | 1949 |
| 204 | Ga0105247_10000534 | 3300009101 | Bacteria | 30844 |
| 205 | Ga0105247_10061468 | 3300009101 | Archaea | 2329 |
| 206 | Ga0114129_10009220 | 3300009147 | Bacteria | 14074 |
| 207 | Ga0114129_10030392 | 3300009147 | Bacteria | 7643 |
| 208 | Ga0114129_10038702 | 3300009147 | Bacteria | 6725 |
| 209 | Ga0114129_10044005 | 3300009147 | Bacteria | 6282 |
| 210 | Ga0114129_10102717 | 3300009147 | Bacteria | 3953 |
| 211 | Ga0114129_10192692 | 3300009147 | Bacteria | 2766 |
| 212 | Ga0114129_10203575 | 3300009147 | Unclassified | 2679 |
| 213 | Ga0105243_10000073 | 3300009148 | Bacteria | 114756 |
| 214 | Ga0105243_10004691 | 3300009148 | Bacteria | 10759 |
| 215 | Ga0105243_10005357 | 3300009148 | Bacteria | 10013 |
| 216 | Ga0105243_10014886 | 3300009148 | Bacteria | 5887 |
| 217 | Ga0105243_10071906 | 3300009148 | Unclassified | 2798 |
| 218 | Ga0105243_10098567 | 3300009148 | Unclassified | 2421 |
| 219 | Ga0105243_10122166 | 3300009148 | Bacteria | 2197 |
| 220 | Ga0105243_10218827 | 3300009148 | Bacteria | 1682 |
| 221 | Ga0105241_10069393 | 3300009174 | Bacteria | 2733 |
| 222 | Ga0105241_10071258 | 3300009174 | Bacteria | 2698 |
| 223 | Ga0105241_10337664 | 3300009174 | Bacteria | 1304 |
| 224 | Ga0105242_10000043 | 3300009176 | Bacteria | 85748 |
| 225 | Ga0105242_10001013 | 3300009176 | Bacteria | 22070 |
| 226 | Ga0105242_10001366 | 3300009176 | Bacteria | 19252 |
| 227 | Ga0105242_10043521 | 3300009176 | Bacteria | 3632 |
| 228 | Ga0105242_10059252 | 3300009176 | Bacteria | 3140 |
| 229 | Ga0105242_10157672 | 3300009176 | Bacteria | 1984 |
| 230 | Ga0105248_10008504 | 3300009177 | Bacteria | 11269 |
| 231 | Ga0105248_10011822 | 3300009177 | Bacteria | 9629 |
| 232 | Ga0105248_10027618 | 3300009177 | Bacteria | 6321 |
| 233 | Ga0105248_10140567 | 3300009177 | Bacteria | 2724 |
| 234 | Ga0105248_10200507 | 3300009177 | Bacteria | 2248 |
| 235 | Ga0105248_10244075 | 3300009177 | Bacteria | 2022 |
| 236 | Ga0105248_10448996 | 3300009177 | Bacteria | 1453 |
| 237 | Ga0105248_10526360 | 3300009177 | Bacteria | 1333 |
| 238 | Ga0105237_10002093 | 3300009545 | Bacteria | 25200 |
| 239 | Ga0105237_10039930 | 3300009545 | Bacteria | 4734 |
| 240 | Ga0105237_10103967 | 3300009545 | Bacteria | 2832 |
| 241 | Ga0105237_10617311 | 3300009545 | Bacteria | 1091 |
| 242 | Ga0105238_10018882 | 3300009551 | Bacteria | 7020 |
| 243 | Ga0105238_10036299 | 3300009551 | Bacteria | 5009 |
| 244 | Ga0105238_10415066 | 3300009551 | Bacteria | 1340 |
| 245 | Ga0105249_10001548 | 3300009553 | Bacteria | 20182 |
| 246 | Ga0105249_10002234 | 3300009553 | Bacteria | 16788 |
| 247 | Ga0105249_10020889 | 3300009553 | Bacteria | 5855 |
| 248 | Ga0105249_10048983 | 3300009553 | Bacteria | 3853 |
| 249 | Ga0105249_10184919 | 3300009553 | Unclassified | 2030 |
| 250 | Ga0105249_10320377 | 3300009553 | Bacteria | 1561 |
| 251 | Ga0105239_10526102 | 3300010375 | Unclassified | 1346 |
| 252 | Ga0105246_10102704 | 3300011119 | Bacteria | 2085 |
| 253 | Ga0105246_10174908 | 3300011119 | Bacteria | 1648 |
| 254 | Ga0105246_10203807 | 3300011119 | Bacteria | 1540 |
| 255 | Ga0105246_10207796 | 3300011119 | Bacteria | 1526 |
| 256 | Ga0105246_10296807 | 3300011119 | Unclassified | 1303 |
| 257 | Ga0105246_10315591 | 3300011119 | Bacteria | 1268 |
| 258 | Ga0157373_10009657 | 3300013100 | Bacteria | 7121 |
| 259 | Ga0157373_10022445 | 3300013100 | Bacteria | 4579 |
| 260 | Ga0157374_10004256 | 3300013296 | Bacteria | 12033 |
| 261 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 262 | Ga0157378_10001387 | 3300013297 | Bacteria | 21775 |
| 263 | Ga0157378_10026327 | 3300013297 | Bacteria | 5127 |
| 264 | Ga0157378_10502157 | 3300013297 | Bacteria | 1212 |
| 265 | Ga0163162_10000230 | 3300013306 | Bacteria | 51221 |
| 266 | Ga0163162_10000831 | 3300013306 | Bacteria | 28720 |
| 267 | Ga0163162_10020638 | 3300013306 | Bacteria | 6475 |
| 268 | Ga0163162_10023513 | 3300013306 | Bacteria | 6082 |
| 269 | Ga0163162_10030430 | 3300013306 | Bacteria | 5349 |
| 270 | Ga0163162_10031277 | 3300013306 | Bacteria | 5279 |
| 271 | Ga0163162_10100598 | 3300013306 | Bacteria | 2982 |
| 272 | Ga0163162_10176740 | 3300013306 | Bacteria | 2260 |
| 273 | Ga0163162_10609380 | 3300013306 | Bacteria | 1218 |
| 274 | Ga0157372_10422493 | 3300013307 | Bacteria | 1553 |
| 275 | Ga0157375_10000479 | 3300013308 | Bacteria | 36426 |
| 276 | Ga0157375_10089504 | 3300013308 | Bacteria | 3134 |
| 277 | Ga0157375_10297341 | 3300013308 | Bacteria | 1778 |
| 278 | Ga0157375_10300590 | 3300013308 | Unclassified | 1768 |
| 279 | Ga0157375_10516599 | 3300013308 | Bacteria | 1358 |
| 280 | Ga0163163_10000334 | 3300014325 | Bacteria | 45303 |
| 281 | Ga0163163_10004205 | 3300014325 | Bacteria | 12269 |
| 282 | Ga0163163_10041815 | 3300014325 | Unclassified | 4485 |
| 283 | Ga0163163_10079064 | 3300014325 | Bacteria | 3286 |
| 284 | Ga0163163_10232652 | 3300014325 | Bacteria | 1892 |
| 285 | Ga0163163_10331353 | 3300014325 | Unclassified | 1577 |
| 286 | Ga0157380_10002594 | 3300014326 | Bacteria | 12217 |
| 287 | Ga0157380_10014474 | 3300014326 | Bacteria | 5772 |
| 288 | Ga0157380_10185470 | 3300014326 | Bacteria | 1832 |
| 289 | Ga0157377_10000885 | 3300014745 | Bacteria | 12487 |
| 290 | Ga0157377_10042076 | 3300014745 | Unclassified | 2537 |
| 291 | Ga0157377_10144320 | 3300014745 | Bacteria | 1466 |
| 292 | Ga0157379_10058097 | 3300014968 | Bacteria | 3458 |
| 293 | Ga0157379_10093518 | 3300014968 | Unclassified | 2697 |
| 294 | Ga0157376_10008430 | 3300014969 | Bacteria | 7438 |
| 295 | Ga0157376_10010721 | 3300014969 | Bacteria | 6721 |
| 296 | Ga0163161_10171230 | 3300017792 | Bacteria | 1660 |
| 297 | Ga0209050_1001226 | 3300025298 | Bacteria | 29774 |
| 298 | Ga0209051_1003672 | 3300025303 | Bacteria | 9929 |
| 299 | Ga0207697_10010603 | 3300025315 | Bacteria | 3933 |
| 300 | Ga0207697_10013386 | 3300025315 | Unclassified | 3423 |
| 301 | Ga0207656_10002909 | 3300025321 | Bacteria | 5839 |
| 302 | Ga0207653_10000210 | 3300025885 | Bacteria | 39415 |
| 303 | Ga0207653_10002366 | 3300025885 | Bacteria | 6010 |
| 304 | Ga0207710_10001728 | 3300025900 | Bacteria | 10568 |
| 305 | Ga0207710_10019201 | 3300025900 | Bacteria | 2916 |
| 306 | Ga0207680_10013599 | 3300025903 | Bacteria | 4187 |
| 307 | Ga0207680_10241315 | 3300025903 | Bacteria | 1245 |
| 308 | Ga0207699_10117782 | 3300025906 | Bacteria | 1713 |
| 309 | Ga0207643_10003313 | 3300025908 | Bacteria | 8689 |
| 310 | Ga0207684_10003948 | 3300025910 | Bacteria | 14197 |
| 311 | Ga0207684_10013297 | 3300025910 | Bacteria | 7120 |
| 312 | Ga0207707_10000080 | 3300025912 | Bacteria | 96693 |
| 313 | Ga0207695_10149201 | 3300025913 | Bacteria | 2278 |
| 314 | Ga0207660_10026610 | 3300025917 | Bacteria | 3940 |
| 315 | Ga0207660_10204403 | 3300025917 | Bacteria | 1544 |
| 316 | Ga0207662_10001395 | 3300025918 | Bacteria | 11673 |
| 317 | Ga0207662_10011021 | 3300025918 | Bacteria | 5003 |
| 318 | Ga0207662_10052912 | 3300025918 | Bacteria | 2417 |
| 319 | Ga0207662_10075686 | 3300025918 | Bacteria | 2045 |
| 320 | Ga0207662_10234836 | 3300025918 | Bacteria | 1199 |
| 321 | Ga0207649_10003552 | 3300025920 | Bacteria | 8522 |
| 322 | Ga0207652_10001974 | 3300025921 | Bacteria | 17736 |
| 323 | Ga0207646_10043228 | 3300025922 | Unclassified | 4047 |
| 324 | Ga0207646_10111341 | 3300025922 | Bacteria | 2457 |
| 325 | Ga0207681_10016336 | 3300025923 | Bacteria | 4642 |
| 326 | Ga0207694_10013885 | 3300025924 | Bacteria | 6073 |
| 327 | Ga0207650_10000332 | 3300025925 | Bacteria | 45789 |
| 328 | Ga0207650_10005284 | 3300025925 | Bacteria | 8808 |
| 329 | Ga0207650_10014749 | 3300025925 | Bacteria | 5432 |
| 330 | Ga0207659_10022335 | 3300025926 | Bacteria | 4212 |
| 331 | Ga0207659_10157273 | 3300025926 | Bacteria | 1781 |
| 332 | Ga0207687_10229876 | 3300025927 | Unclassified | 1465 |
| 333 | Ga0207644_10009250 | 3300025931 | Bacteria | 6464 |
| 334 | Ga0207644_10018001 | 3300025931 | Bacteria | 4777 |
| 335 | Ga0207644_10049981 | 3300025931 | Bacteria | 2995 |
| 336 | Ga0207644_10065054 | 3300025931 | Unclassified | 2651 |
| 337 | Ga0207706_10047799 | 3300025933 | Bacteria | 3785 |
| 338 | Ga0207706_10102676 | 3300025933 | Bacteria | 2515 |
| 339 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 340 | Ga0207686_10000244 | 3300025934 | Bacteria | 41692 |
| 341 | Ga0207686_10000965 | 3300025934 | Bacteria | 17144 |
| 342 | Ga0207686_10047545 | 3300025934 | Bacteria | 2653 |
| 343 | Ga0207709_10000124 | 3300025935 | Bacteria | 114743 |
| 344 | Ga0207709_10000469 | 3300025935 | Bacteria | 37165 |
| 345 | Ga0207709_10002901 | 3300025935 | Bacteria | 10475 |
| 346 | Ga0207669_10159107 | 3300025937 | Unclassified | 1593 |
| 347 | Ga0207704_10046703 | 3300025938 | Bacteria | 2583 |
| 348 | Ga0207704_10394546 | 3300025938 | Bacteria | 1090 |
| 349 | Ga0207691_10021136 | 3300025940 | Bacteria | 6150 |
| 350 | Ga0207691_10035152 | 3300025940 | Unclassified | 4655 |
| 351 | Ga0207711_10002023 | 3300025941 | Bacteria | 18347 |
| 352 | Ga0207711_10022643 | 3300025941 | Bacteria | 5255 |
| 353 | Ga0207711_10032331 | 3300025941 | Unclassified | 4424 |
| 354 | Ga0207711_10245037 | 3300025941 | Bacteria | 1644 |
| 355 | Ga0207689_10000898 | 3300025942 | Bacteria | 28576 |
| 356 | Ga0207689_10031409 | 3300025942 | Unclassified | 4422 |
| 357 | Ga0207689_10093643 | 3300025942 | Bacteria | 2468 |
| 358 | Ga0207689_10240501 | 3300025942 | Unclassified | 1496 |
| 359 | Ga0207679_10054013 | 3300025945 | Bacteria | 2955 |
| 360 | Ga0207679_10122782 | 3300025945 | Bacteria | 2071 |
| 361 | Ga0207679_10289176 | 3300025945 | Bacteria | 1408 |
| 362 | Ga0207651_10008743 | 3300025960 | Bacteria | 5492 |
| 363 | Ga0207651_10032278 | 3300025960 | Bacteria | 3362 |
| 364 | Ga0207651_10067130 | 3300025960 | Bacteria | 2523 |
| 365 | Ga0207712_10003879 | 3300025961 | Bacteria | 9448 |
| 366 | Ga0207712_10030357 | 3300025961 | Unclassified | 3633 |
| 367 | Ga0207712_10110532 | 3300025961 | Bacteria | 2061 |
| 368 | Ga0207640_10110678 | 3300025981 | Unclassified | 1946 |
| 369 | Ga0207640_10264528 | 3300025981 | Unclassified | 1342 |
| 370 | Ga0207658_10011740 | 3300025986 | Bacteria | 5966 |
| 371 | Ga0207658_10028959 | 3300025986 | Bacteria | 3905 |
| 372 | Ga0207658_10173235 | 3300025986 | Bacteria | 1780 |
| 373 | Ga0207677_10330032 | 3300026023 | Bacteria | 1271 |
| 374 | Ga0207703_10026355 | 3300026035 | Bacteria | 4574 |
| 375 | Ga0207703_10043076 | 3300026035 | Bacteria | 3621 |
| 376 | Ga0207703_10048692 | 3300026035 | Bacteria | 3422 |
| 377 | Ga0207703_10074709 | 3300026035 | Bacteria | 2807 |
| 378 | Ga0207703_10121190 | 3300026035 | Bacteria | 2245 |
| 379 | Ga0207703_10202594 | 3300026035 | Bacteria | 1764 |
| 380 | Ga0207678_10106147 | 3300026067 | Bacteria | 2396 |
| 381 | Ga0207708_10000092 | 3300026075 | Bacteria | 70135 |
| 382 | Ga0207708_10004335 | 3300026075 | Bacteria | 10447 |
| 383 | Ga0207708_10009835 | 3300026075 | Bacteria | 7097 |
| 384 | Ga0207708_10013747 | 3300026075 | Bacteria | 6048 |
| 385 | Ga0207708_10033292 | 3300026075 | Bacteria | 3915 |
| 386 | Ga0207708_10057712 | 3300026075 | Bacteria | 2962 |
| 387 | Ga0207708_10277542 | 3300026075 | Bacteria | 1357 |
| 388 | Ga0207702_10024513 | 3300026078 | Bacteria | 5006 |
| 389 | Ga0207641_10004482 | 3300026088 | Bacteria | 12084 |
| 390 | Ga0207641_10038653 | 3300026088 | Bacteria | 3990 |
| 391 | Ga0207641_10039452 | 3300026088 | Bacteria | 3949 |
| 392 | Ga0207648_10010332 | 3300026089 | Bacteria | 8853 |
| 393 | Ga0207648_10025948 | 3300026089 | Bacteria | 5211 |
| 394 | Ga0207648_10029644 | 3300026089 | Bacteria | 4852 |
| 395 | Ga0207648_10114316 | 3300026089 | Bacteria | 2371 |
| 396 | Ga0207648_10147978 | 3300026089 | Unclassified | 2072 |
| 397 | Ga0207676_10005442 | 3300026095 | Bacteria | 9010 |
| 398 | Ga0207676_10149182 | 3300026095 | Unclassified | 2012 |
| 399 | Ga0207676_10246594 | 3300026095 | Bacteria | 1605 |
| 400 | Ga0207674_10048560 | 3300026116 | Bacteria | 4344 |
| 401 | Ga0207674_10107892 | 3300026116 | Bacteria | 2761 |
| 402 | Ga0207674_10257850 | 3300026116 | Bacteria | 1691 |
| 403 | Ga0207675_100006813 | 3300026118 | Bacteria | 10819 |
| 404 | Ga0207675_100012394 | 3300026118 | Bacteria | 7963 |
| 405 | Ga0207675_100016678 | 3300026118 | Bacteria | 6858 |
| 406 | Ga0207675_100045648 | 3300026118 | Bacteria | 4094 |
| 407 | Ga0207675_100049721 | 3300026118 | Unclassified | 3912 |
| 408 | Ga0207675_100191250 | 3300026118 | Bacteria | 1963 |
| 409 | Ga0207683_10053712 | 3300026121 | Bacteria | 3533 |
| 410 | Ga0207683_10071650 | 3300026121 | Bacteria | 3064 |
| 411 | Ga0207698_10123894 | 3300026142 | Bacteria | 2194 |
| 412 | Ga0207428_10012870 | 3300027907 | Bacteria | 7335 |
| 413 | Ga0207428_10028144 | 3300027907 | Bacteria | 4672 |
| 414 | Ga0268265_10024680 | 3300028380 | Bacteria | 4257 |
| 415 | Ga0268265_10152937 | 3300028380 | Bacteria | 1948 |
| 416 | Ga0268264_10016000 | 3300028381 | Bacteria | 6146 |
| 417 | Ga0268264_10105726 | 3300028381 | Bacteria | 2456 |
| 418 | Ga0268264_10120699 | 3300028381 | Bacteria | 2309 |
| 419 | Ga0268264_10144275 | 3300028381 | Bacteria | 2127 |
| 420 | Ga0268264_10223307 | 3300028381 | Bacteria | 1735 |
| 421 | Ga0268264_10303970 | 3300028381 | Bacteria | 1503 |
| 422 | Ga0265338_10013553 | 3300028800 | Bacteria | 9189 |
| 423 | Ga0265340_10031906 | 3300031247 | Bacteria | 2632 |
| 424 | Ga0307408_100003078 | 3300031548 | Bacteria | 11500 |
| 425 | Ga0307408_100056807 | 3300031548 | Bacteria | 2839 |
| 426 | Ga0307408_100204927 | 3300031548 | Bacteria | 1599 |
| 427 | Ga0316579_10001379 | 3300031691 | Bacteria | 8793 |
| 428 | Ga0316579_10022190 | 3300031691 | Bacteria | 2837 |
| 429 | Ga0316576_10000499 | 3300031727 | Bacteria | 18426 |
| 430 | Ga0316576_10004155 | 3300031727 | Bacteria | 8638 |
| 431 | Ga0316576_10011843 | 3300031727 | Bacteria | 5736 |
| 432 | Ga0316576_10100318 | 3300031727 | Bacteria | 2163 |
| 433 | Ga0316578_10000285 | 3300031728 | Bacteria | 15362 |
| 434 | Ga0316578_10002190 | 3300031728 | Bacteria | 8444 |
| 435 | Ga0316578_10100201 | 3300031728 | Bacteria | 1736 |
| 436 | Ga0307405_10024814 | 3300031731 | Bacteria | 3432 |
| 437 | Ga0307405_10110334 | 3300031731 | Bacteria | 1863 |
| 438 | Ga0316577_10000341 | 3300031733 | Bacteria | 17356 |
| 439 | Ga0316577_10005012 | 3300031733 | Bacteria | 6904 |
| 440 | Ga0316577_10035269 | 3300031733 | Unclassified | 2795 |
| 441 | Ga0316577_10105499 | 3300031733 | Unclassified | 1581 |
| 442 | Ga0316577_10161984 | 3300031733 | Bacteria | 1262 |
| 443 | Ga0307407_10292251 | 3300031903 | Bacteria | 1133 |
| 444 | Ga0307416_100087318 | 3300032002 | Bacteria | 2662 |
| 445 | Ga0307416_100087579 | 3300032002 | Unclassified | 2659 |
| 446 | Ga0307411_10024372 | 3300032005 | Bacteria | 3606 |
| 447 | Ga0307415_100006724 | 3300032126 | Bacteria | 6229 |
| 448 | Ga0316583_10004147 | 3300032133 | Bacteria | 5155 |
| 449 | Ga0316583_10032646 | 3300032133 | Unclassified | 1850 |
| 450 | Ga0316585_10000177 | 3300032137 | Bacteria | 13026 |
| 451 | Ga0316580_10000346 | 3300032139 | Bacteria | 10228 |
| 452 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 453 | Ga0307510_10007486 | 3300033180 | Bacteria | 13003 |
| 454 | Ga0316596_1004572 | 3300033541 | Bacteria | 3115 |
| 455 | Ga0373951_0000742 | 3300035091 | Bacteria | 8927 |
| 456 | Ga0373942_0008109 | 3300035207 | Unclassified | 2443 |
| 457 | Ga0316574_0003621 | 3300035398 | Bacteria | 7989 |
| 458 | Ga0316574_0031157 | 3300035398 | Unclassified | 3234 |
| 459 | Ga0316574_0094424 | 3300035398 | Unclassified | 1910 |
| 460 | Ga0373937_0132051 | 3300036401 | Bacteria | 2332 |
| 461 | Ga0316582_0001638 | 3300036647 | Bacteria | 10003 |
| 462 | Ga0316582_0018492 | 3300036647 | Bacteria | 4058 |
| 463 | Ga0316582_0069431 | 3300036647 | Unclassified | 2277 |
| 464 | Ga0316584_0003162 | 3300036712 | Bacteria | 10640 |
| 465 | Ga0316584_0005033 | 3300036712 | Bacteria | 8810 |
| 466 | Ga0316584_0045925 | 3300036712 | Unclassified | 3261 |
| 467 | Ga0316584_0048895 | 3300036712 | Unclassified | 3160 |
| 468 | Ga0316584_0125102 | 3300036712 | Bacteria | 1920 |
| 469 | Ga0316581_0000287 | 3300037588 | Bacteria | 8894 |
| 470 | Ga0316581_0005973 | 3300037588 | Unclassified | 3202 |
| 471 | Ga0316581_0021432 | 3300037588 | Unclassified | 1899 |
| 472 | Ga0436364_0031979 | 3300037853 | Bacteria | 1118 |
| 473 | Ga0242422_01793 | 3300038699 | Bacteria | 1481 |
| 474 | Ga0400484_31965 | 3300038725 | Bacteria | 21409 |
| 475 | Ga0400490_33134 | 3300038726 | Bacteria | 59693 |
| 476 | Ga0400490_38810 | 3300038726 | Bacteria | 5234 |
| 477 | Ga0242420_002873 | 3300038996 | Bacteria | 2499 |
| 478 | Ga0453684_0125662 | 3300044712 | Unclassified | 3088 |
| 479 | Ga0451576_0006280 | 3300045051 | Bacteria | 14621 |
| 480 | Ga0451576_0301864 | 3300045051 | Bacteria | 1675 |
| 481 | Ga0451576_0341651 | 3300045051 | Bacteria | 1567 |
| 482 | Ga0495590_0010781 | 3300046457 | Bacteria | 3425 |
| 483 | Ga0495662_0013675 | 3300046476 | Unclassified | 3953 |
| 484 | Ga0495625_0030579 | 3300046660 | Bacteria | 4016 |
| 485 | Ga0495659_0002750 | 3300046664 | Bacteria | 5657 |
| 486 | Ga0495669_0045581 | 3300046684 | Bacteria | 1956 |
| 487 | Ga0495613_0187058 | 3300046689 | Unclassified | 1465 |
| 488 | Ga0495670_0054795 | 3300046691 | Bacteria | 1999 |
| 489 | Ga0495600_0144909 | 3300046809 | Bacteria | 1540 |
| 490 | Ga0495673_0002660 | 3300047469 | Bacteria | 12345 |
| 491 | Ga0495684_0275059 | 3300047471 | Bacteria | 1217 |
| 492 | Ga0496101_0274862 | 3300048904 | Archaea | 1316 |
| 493 | Ga0496106_0008837 | 3300048909 | Bacteria | 7445 |
| 494 | Ga0496106_0090303 | 3300048909 | Bacteria | 2364 |
| 495 | Ga0496109_0345642 | 3300048912 | Bacteria | 1405 |
| 496 | Ga0496110_0368208 | 3300048913 | Bacteria | 1309 |
| 497 | Ga0496112_0121793 | 3300048915 | Bacteria | 2579 |
| 498 | Ga0496112_0285811 | 3300048915 | Bacteria | 1596 |
| 499 | Ga0496118_0261597 | 3300048921 | Bacteria | 976 |
| 500 | Ga0496120_0104523 | 3300048923 | Bacteria | 1490 |
| 501 | Ga0496121_0125202 | 3300048924 | Bacteria | 1933 |
| 502 | Ga0496124_0001839 | 3300048927 | Bacteria | 29294 |
| 503 | Ga0496124_0087708 | 3300048927 | Bacteria | 2545 |
| 504 | Ga0501031_0003062 | 3300049568 | Bacteria | 10693 |
| 505 | Ga0501036_0001227 | 3300049572 | Bacteria | 19579 |
| 506 | Ga0501038_0013637 | 3300049574 | Bacteria | 7407 |
| 507 | Ga0501039_0001977 | 3300049575 | Bacteria | 15188 |
| 508 | Ga0501040_0001102 | 3300049576 | Bacteria | 17098 |
| 509 | Ga0501040_0049411 | 3300049576 | Unclassified | 2876 |
| 510 | Ga0501041_0020449 | 3300049577 | Bacteria | 3958 |
| 511 | Ga0501041_0136075 | 3300049577 | Unclassified | 1531 |
| 512 | Ga0501042_0001096 | 3300049578 | Bacteria | 15570 |
| 513 | Ga0501046_0001328 | 3300049580 | Bacteria | 23960 |
| 514 | Ga0501048_0009298 | 3300049582 | Bacteria | 7381 |
| 515 | Ga0501068_0010095 | 3300049584 | Bacteria | 5299 |
| 516 | Ga0501068_0195917 | 3300049584 | Unclassified | 1281 |
| 517 | Ga0501071_0000741 | 3300049587 | Bacteria | 17237 |
| 518 | Ga0501071_0060318 | 3300049587 | Bacteria | 2746 |
| 519 | Ga0501072_0000879 | 3300049588 | Bacteria | 22004 |
| 520 | Ga0501072_0010271 | 3300049588 | Bacteria | 7133 |
| 521 | Ga0501072_0010575 | 3300049588 | Bacteria | 7027 |
| 522 | Ga0501072_0114173 | 3300049588 | Unclassified | 2150 |
| 523 | Ga0501074_0037818 | 3300049590 | Bacteria | 3497 |
| 524 | Ga0501075_0001981 | 3300049591 | Bacteria | 13529 |
| 525 | Ga0501075_0003149 | 3300049591 | Bacteria | 11044 |
| 526 | Ga0501075_0031840 | 3300049591 | Bacteria | 3917 |
| 527 | Ga0501076_0000609 | 3300049592 | Bacteria | 22844 |
| 528 | Ga0501076_0009507 | 3300049592 | Bacteria | 7181 |
| 529 | Ga0501077_0018750 | 3300049593 | Bacteria | 4377 |
| 530 | Ga0501217_004205 | 3300049661 | Bacteria | 2952 |
| 531 | Ga0501217_053726 | 3300049661 | Bacteria | 1059 |
| 532 | Ga0501224_005947 | 3300049664 | Bacteria | 1761 |
| 533 | Ga0501227_001316 | 3300049665 | Bacteria | 5565 |
| 534 | Ga0501227_009038 | 3300049665 | Bacteria | 2142 |
| 535 | Ga0501239_006377 | 3300049672 | Bacteria | 1212 |
| 536 | Ga0501243_001192 | 3300049675 | Unclassified | 3714 |
| 537 | Ga0501243_017986 | 3300049675 | Bacteria | 1149 |
| 538 | Ga0501251_001823 | 3300049681 | Bacteria | 2008 |
| 539 | Ga0501253_027712 | 3300049683 | Bacteria | 1055 |
| 540 | Ga0501257_020454 | 3300049686 | Bacteria | 1554 |
| 541 | Ga0501259_005305 | 3300049688 | Unclassified | 2039 |
| 542 | Ga0501225_0001009 | 3300049705 | Bacteria | 8834 |
| 543 | Ga0501225_0012602 | 3300049705 | Bacteria | 2373 |
| 544 | Ga0501229_008058 | 3300049706 | Bacteria | 1314 |
| 545 | Ga0501234_016749 | 3300049707 | Bacteria | 1157 |
| 546 | Ga0501079_0001881 | 3300049741 | Bacteria | 15039 |
| 547 | Ga0501079_0108705 | 3300049741 | Unclassified | 2153 |
| 548 | Ga0501079_0275911 | 3300049741 | Bacteria | 1314 |
| 549 | Ga0501081_0000226 | 3300049743 | Bacteria | 28295 |
| 550 | Ga0501081_0050029 | 3300049743 | Bacteria | 2879 |
| 551 | Ga0501083_0193246 | 3300049744 | Bacteria | 1328 |
| 552 | Ga0501268_010107 | 3300049765 | Bacteria | 1463 |
| 553 | Ga0501273_006720 | 3300049770 | Bacteria | 1339 |
| 554 | Ga0501045_0003374 | 3300049824 | Bacteria | 10930 |
| 555 | Ga0501226_002191 | 3300049853 | Bacteria | 2415 |
| 556 | nmdc:mga0k408_22871_c1 | 3300050493 | Bacteria | 3522 |
| 557 | nmdc:mga05p37_146994_c1 | 3300050507 | Bacteria | 2885 |
| 558 | nmdc:mga05p37_26820_c1 | 3300050507 | Bacteria | 7008 |
| 559 | nmdc:mga05p37_424234_c1 | 3300050507 | Bacteria | 1547 |
| 560 | nmdc:mga05p37_467284_c1 | 3300050507 | Bacteria | 1456 |
| 561 | nmdc:mga05p37_63388_c2 | 3300050507 | Bacteria | 3328 |
| 562 | nmdc:mga09592_471273_c1 | 3300050508 | Bacteria | 1082 |
| 563 | nmdc:mga09592_69447_c1 | 3300050508 | Bacteria | 2989 |
| 564 | nmdc:mga0qj67_15015_c1 | 3300050509 | Bacteria | 5859 |
| 565 | nmdc:mga0qj67_32311_c1 | 3300050509 | Bacteria | 4080 |
| 566 | nmdc:mga0qj67_8504_c1 | 3300050509 | Bacteria | 7615 |
| 567 | nmdc:mga06r32_100437_c1 | 3300050510 | Bacteria | 2838 |
| 568 | nmdc:mga06r32_1004_c1 | 3300050510 | Bacteria | 25303 |
| 569 | nmdc:mga06r32_2409_c1 | 3300050510 | Bacteria | 16731 |
| 570 | nmdc:mga06r32_99271_c1 | 3300050510 | Bacteria | 2855 |
| 571 | nmdc:mga08y16_14577_c1 | 3300050511 | Bacteria | 8267 |
| 572 | nmdc:mga08y16_167088_c1 | 3300050511 | Unclassified | 2286 |
| 573 | nmdc:mga08y16_679506_c1 | 3300050511 | Bacteria | 1031 |
| 574 | nmdc:mga0n895_31203_c1 | 3300050512 | Bacteria | 5099 |
| 575 | nmdc:mga0rr50_1698_c1 | 3300050513 | Bacteria | 12165 |
| 576 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 577 | nmdc:mga0a205_414961_c1 | 3300050515 | Bacteria | 1209 |
| 578 | nmdc:mga0a205_574319_c1 | 3300050515 | Bacteria | 982 |
| 579 | nmdc:mga0a205_97266_c1 | 3300050515 | Bacteria | 2842 |
| 580 | Ga0500568_0006578 | 3300053139 | Bacteria | 5815 |
| 581 | Ga0500568_0010599 | 3300053139 | Bacteria | 4303 |
| 582 | Ga0500588_0003036 | 3300053146 | Unclassified | 3502 |
| 583 | Ga0500604_0005744 | 3300053151 | Bacteria | 3277 |
| 584 | Ga0500622_0000360 | 3300053156 | Bacteria | 44258 |
| 585 | Ga0501084_0002870 | 3300054114 | Bacteria | 13937 |
| 586 | Ga0501084_0044987 | 3300054114 | Bacteria | 3697 |
| 587 | Ga0501082_0028172 | 3300060353 | Bacteria | 4840 |
| 588 | Ga0530510_0007043 | 3300061734 | Bacteria | 7830 |
| 589 | Ga0530510_0024894 | 3300061734 | Unclassified | 4277 |
| 590 | Ga0530510_0028936 | 3300061734 | Unclassified | 3974 |
| 591 | Ga0530510_0033335 | 3300061734 | Bacteria | 3709 |
| 592 | Ga0530510_0087764 | 3300061734 | Unclassified | 2266 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2937972304 | 2937976801 | 273 |
| 2 | iso_pu_bacteria | 2968016561 | 2968021446 | 273 |
| 3 | iso_pu_bacteria | 2970469710 | 2970476550 | 273 |
| 4 | 3300009545 | Ga0105237_10617311 | Ga0105237_106173112 | 276 |
| 5 | 3300048921 | Ga0496118_0261597 | Ga0496118_0261597_103_966 | 277 |
| 6 | 3300050515 | nmdc:mga0a205_574319_c1 | nmdc:mga0a205_574319_c1_11_844 | 277 |
| 7 | 3300049577 | Ga0501041_0136075 | Ga0501041_0136075_74_982 | 296 |
| 8 | 3300005468 | Ga0070707_100037385 | Ga0070707_1000373852 | 304 |
| 9 | 3300049664 | Ga0501224_005947 | Ga0501224_005947_261_1181 | 305 |
| 10 | 3300026118 | Ga0207675_100049721 | Ga0207675_1000497212 | 309 |
| 11 | 3300061734 | Ga0530510_0033335 | Ga0530510_0033335_2196_3143 | 309 |
| 12 | 3300005471 | Ga0070698_100042506 | Ga0070698_1000425064 | 312 |
| 13 | 3300026121 | Ga0207683_10053712 | Ga0207683_100537124 | 314 |
| 14 | 3300049568 | Ga0501031_0003062 | Ga0501031_0003062_2215_3294 | 315 |
| 15 | 3300049572 | Ga0501036_0001227 | Ga0501036_0001227_7163_8242 | 315 |
| 16 | 3300049574 | Ga0501038_0013637 | Ga0501038_0013637_6151_7230 | 315 |
| 17 | 3300049575 | Ga0501039_0001977 | Ga0501039_0001977_11897_12976 | 315 |
| 18 | 3300049576 | Ga0501040_0001102 | Ga0501040_0001102_5457_6536 | 315 |
| 19 | 3300049578 | Ga0501042_0001096 | Ga0501042_0001096_9615_10694 | 315 |
| 20 | 3300049582 | Ga0501048_0009298 | Ga0501048_0009298_5364_6443 | 315 |
| 21 | 3300049584 | Ga0501068_0010095 | Ga0501068_0010095_842_1921 | 315 |
| 22 | 3300049587 | Ga0501071_0000741 | Ga0501071_0000741_6989_8068 | 315 |
| 23 | 3300049588 | Ga0501072_0000879 | Ga0501072_0000879_5218_6297 | 315 |
| 24 | 3300049590 | Ga0501074_0037818 | Ga0501074_0037818_425_1504 | 315 |
| 25 | 3300049591 | Ga0501075_0001981 | Ga0501075_0001981_11832_12911 | 315 |
| 26 | 3300049593 | Ga0501077_0018750 | Ga0501077_0018750_1271_2350 | 315 |
| 27 | 3300049741 | Ga0501079_0001881 | Ga0501079_0001881_6900_7979 | 315 |
| 28 | 3300049743 | Ga0501081_0000226 | Ga0501081_0000226_9217_10296 | 315 |
| 29 | 3300049744 | Ga0501083_0193246 | Ga0501083_0193246_172_1251 | 315 |
| 30 | 3300049824 | Ga0501045_0003374 | Ga0501045_0003374_6675_7754 | 315 |
| 31 | 3300060353 | Ga0501082_0028172 | Ga0501082_0028172_1718_2797 | 315 |
| 32 | 3300061734 | Ga0530510_0007043 | Ga0530510_0007043_4830_5909 | 315 |
| 33 | 3300009553 | Ga0105249_10048983 | Ga0105249_100489834 | 317 |
| 34 | 3300013306 | Ga0163162_10000230 | Ga0163162_1000023027 | 317 |
| 35 | 3300005334 | Ga0068869_100234814 | Ga0068869_1002348142 | 318 |
| 36 | 3300005337 | Ga0070682_100012841 | Ga0070682_1000128415 | 318 |
| 37 | 3300005367 | Ga0070667_100128215 | Ga0070667_1001282152 | 318 |
| 38 | 3300005406 | Ga0070703_10003997 | Ga0070703_100039974 | 318 |
| 39 | 3300005444 | Ga0070694_100009983 | Ga0070694_1000099833 | 318 |
| 40 | 3300005445 | Ga0070708_100151474 | Ga0070708_1001514741 | 318 |
| 41 | 3300005459 | Ga0068867_100134260 | Ga0068867_1001342602 | 318 |
| 42 | 3300005544 | Ga0070686_100007985 | Ga0070686_1000079853 | 318 |
| 43 | 3300005545 | Ga0070695_100114680 | Ga0070695_1001146802 | 318 |
| 44 | 3300005546 | Ga0070696_100103444 | Ga0070696_1001034442 | 318 |
| 45 | 3300005564 | Ga0070664_100100011 | Ga0070664_1001000112 | 318 |
| 46 | 3300005564 | Ga0070664_100165228 | Ga0070664_1001652282 | 318 |
| 47 | 3300005614 | Ga0068856_100161748 | Ga0068856_1001617483 | 318 |
| 48 | 3300005615 | Ga0070702_100081775 | Ga0070702_1000817752 | 318 |
| 49 | 3300005841 | Ga0068863_100275398 | Ga0068863_1002753981 | 318 |
| 50 | 3300005842 | Ga0068858_100016740 | Ga0068858_1000167404 | 318 |
| 51 | 3300005842 | Ga0068858_100300085 | Ga0068858_1003000851 | 318 |
| 52 | 3300005844 | Ga0068862_100158407 | Ga0068862_1001584073 | 318 |
| 53 | 3300006195 | Ga0075366_10002853 | Ga0075366_100028537 | 318 |
| 54 | 3300006237 | Ga0097621_100092632 | Ga0097621_1000926322 | 318 |
| 55 | 3300009011 | Ga0105251_10023950 | Ga0105251_100239504 | 318 |
| 56 | 3300009148 | Ga0105243_10005357 | Ga0105243_1000535710 | 318 |
| 57 | 3300025903 | Ga0207680_10241315 | Ga0207680_102413152 | 318 |
| 58 | 3300025927 | Ga0207687_10229876 | Ga0207687_102298761 | 318 |
| 59 | 3300025931 | Ga0207644_10065054 | Ga0207644_100650542 | 318 |
| 60 | 3300025935 | Ga0207709_10002901 | Ga0207709_100029019 | 318 |
| 61 | 3300025937 | Ga0207669_10159107 | Ga0207669_101591072 | 318 |
| 62 | 3300025940 | Ga0207691_10035152 | Ga0207691_100351522 | 318 |
| 63 | 3300025941 | Ga0207711_10032331 | Ga0207711_100323314 | 318 |
| 64 | 3300026078 | Ga0207702_10024513 | Ga0207702_100245133 | 318 |
| 65 | 3300026089 | Ga0207648_10147978 | Ga0207648_101479781 | 318 |
| 66 | 3300026116 | Ga0207674_10048560 | Ga0207674_100485604 | 318 |
| 67 | 3300026118 | Ga0207675_100016678 | Ga0207675_1000166782 | 318 |
| 68 | 3300028380 | Ga0268265_10152937 | Ga0268265_101529371 | 318 |
| 69 | 3300047471 | Ga0495684_0275059 | Ga0495684_0275059_184_1152 | 318 |
| 70 | 3300049672 | Ga0501239_006377 | Ga0501239_006377_221_1177 | 318 |
| 71 | 3300049683 | Ga0501253_027712 | Ga0501253_027712_27_983 | 318 |
| 72 | 3300049706 | Ga0501229_008058 | Ga0501229_008058_307_1263 | 318 |
| 73 | 3300049707 | Ga0501234_016749 | Ga0501234_016749_13_969 | 318 |
| 74 | 3300050510 | nmdc:mga06r32_100437_c1 | nmdc:mga06r32_100437_c1_69_1025 | 318 |
| 75 | 3300050511 | nmdc:mga08y16_679506_c1 | nmdc:mga08y16_679506_c1_54_1010 | 318 |
| 76 | 3300005617 | Ga0068859_100251331 | Ga0068859_1002513312 | 320 |
| 77 | 3300006931 | Ga0097620_100251327 | Ga0097620_1002513272 | 320 |
| 78 | 3300014969 | Ga0157376_10010721 | Ga0157376_100107214 | 321 |
| 79 | 3300050493 | nmdc:mga0k408_22871_c1 | nmdc:mga0k408_22871_c1_76_1053 | 321 |
| 80 | 3300049681 | Ga0501251_001823 | Ga0501251_001823_115_1098 | 323 |
| 81 | 3300005617 | Ga0068859_100062185 | Ga0068859_1000621854 | 324 |
| 82 | 3300006931 | Ga0097620_100062182 | Ga0097620_1000621822 | 324 |
| 83 | 3300033180 | Ga0307510_10007486 | Ga0307510_100074867 | 324 |
| 84 | 3300005343 | Ga0070687_100002878 | Ga0070687_1000028786 | 325 |
| 85 | 3300005549 | Ga0070704_100076016 | Ga0070704_1000760161 | 325 |
| 86 | 3300013100 | Ga0157373_10022445 | Ga0157373_100224456 | 325 |
| 87 | 3300013306 | Ga0163162_10023513 | Ga0163162_100235135 | 325 |
| 88 | 3300014326 | Ga0157380_10014474 | Ga0157380_100144743 | 325 |
| 89 | 3300025918 | Ga0207662_10001395 | Ga0207662_100013955 | 325 |
| 90 | 3300025961 | Ga0207712_10003879 | Ga0207712_100038792 | 325 |
| 91 | 3300049580 | Ga0501046_0001328 | Ga0501046_0001328_8829_9908 | 325 |
| 92 | 3300049592 | Ga0501076_0000609 | Ga0501076_0000609_7283_8362 | 325 |
| 93 | 3300054114 | Ga0501084_0002870 | Ga0501084_0002870_5236_6315 | 325 |
| 94 | iso_pu_bacteria | 2511231012 | 2511304257 | 325 |
| 95 | iso_pu_bacteria | 8056177738 | 8056181600 | 325 |
| 96 | 3300005843 | Ga0068860_100213011 | Ga0068860_1002130112 | 327 |
| 97 | 3300006852 | Ga0075433_10011156 | Ga0075433_100111564 | 327 |
| 98 | 3300009148 | Ga0105243_10071906 | Ga0105243_100719062 | 327 |
| 99 | 3300025938 | Ga0207704_10394546 | Ga0207704_103945461 | 327 |
| 100 | 3300025961 | Ga0207712_10110532 | Ga0207712_101105322 | 327 |
| 101 | 3300005288 | Ga0065714_10064524 | Ga0065714_1006452414 | 328 |
| 102 | 3300005288 | Ga0065714_10064524 | Ga0065714_100645247 | 328 |
| 103 | 3300005841 | Ga0068863_100156741 | Ga0068863_1001567412 | 328 |
| 104 | 3300025298 | Ga0209050_1001226 | Ga0209050_10012266 | 328 |
| 105 | 3300025303 | Ga0209051_1003672 | Ga0209051_100367210 | 328 |
| 106 | 3300046457 | Ga0495590_0010781 | Ga0495590_0010781_941_1948 | 328 |
| 107 | 3300047469 | Ga0495673_0002660 | Ga0495673_0002660_4174_5181 | 328 |
| 108 | 3300048913 | Ga0496110_0368208 | Ga0496110_0368208_144_1151 | 328 |
| 109 | 3300005441 | Ga0070700_100000101 | Ga0070700_10000010128 | 329 |
| 110 | 3300009147 | Ga0114129_10192692 | Ga0114129_101926923 | 329 |
| 111 | 3300026075 | Ga0207708_10000092 | Ga0207708_1000009242 | 329 |
| 112 | 3300031548 | Ga0307408_100003078 | Ga0307408_1000030789 | 329 |
| 113 | 3300031731 | Ga0307405_10024814 | Ga0307405_100248142 | 329 |
| 114 | 3300031903 | Ga0307407_10292251 | Ga0307407_102922511 | 329 |
| 115 | 3300032002 | Ga0307416_100087579 | Ga0307416_1000875792 | 329 |
| 116 | 3300032126 | Ga0307415_100006724 | Ga0307415_1000067243 | 329 |
| 117 | 3300049661 | Ga0501217_004205 | Ga0501217_004205_328_1320 | 329 |
| 118 | 3300049665 | Ga0501227_001316 | Ga0501227_001316_801_1793 | 329 |
| 119 | 3300049675 | Ga0501243_001192 | Ga0501243_001192_1817_2809 | 329 |
| 120 | 3300049688 | Ga0501259_005305 | Ga0501259_005305_869_1861 | 329 |
| 121 | 3300049705 | Ga0501225_0001009 | Ga0501225_0001009_6778_7770 | 329 |
| 122 | 3300005518 | Ga0070699_100080573 | Ga0070699_1000805732 | 332 |
| 123 | 3300005536 | Ga0070697_100054555 | Ga0070697_1000545551 | 332 |
| 124 | 3300031548 | Ga0307408_100204927 | Ga0307408_1002049272 | 333 |
| 125 | 3300005290 | Ga0065712_10003097 | Ga0065712_100030971 | 334 |
| 126 | 3300005293 | Ga0065715_10092098 | Ga0065715_100920985 | 334 |
| 127 | 3300005328 | Ga0070676_10163523 | Ga0070676_101635232 | 334 |
| 128 | 3300005330 | Ga0070690_100000760 | Ga0070690_1000007604 | 334 |
| 129 | 3300005331 | Ga0070670_100018076 | Ga0070670_1000180762 | 334 |
| 130 | 3300005334 | Ga0068869_100003816 | Ga0068869_1000038162 | 334 |
| 131 | 3300005335 | Ga0070666_10010982 | Ga0070666_100109823 | 334 |
| 132 | 3300005336 | Ga0070680_100004282 | Ga0070680_1000042824 | 334 |
| 133 | 3300005337 | Ga0070682_100075823 | Ga0070682_1000758232 | 334 |
| 134 | 3300005340 | Ga0070689_100007201 | Ga0070689_1000072014 | 334 |
| 135 | 3300005344 | Ga0070661_100001230 | Ga0070661_1000012308 | 334 |
| 136 | 3300005345 | Ga0070692_10112942 | Ga0070692_101129422 | 334 |
| 137 | 3300005347 | Ga0070668_100190783 | Ga0070668_1001907832 | 334 |
| 138 | 3300005354 | Ga0070675_100001429 | Ga0070675_1000014295 | 334 |
| 139 | 3300005355 | Ga0070671_100012305 | Ga0070671_1000123055 | 334 |
| 140 | 3300005364 | Ga0070673_100020327 | Ga0070673_1000203273 | 334 |
| 141 | 3300005367 | Ga0070667_100012250 | Ga0070667_1000122504 | 334 |
| 142 | 3300005440 | Ga0070705_100007443 | Ga0070705_1000074434 | 334 |
| 143 | 3300005441 | Ga0070700_100044878 | Ga0070700_1000448784 | 334 |
| 144 | 3300005456 | Ga0070678_100034748 | Ga0070678_1000347484 | 334 |
| 145 | 3300005458 | Ga0070681_10001279 | Ga0070681_1000127915 | 334 |
| 146 | 3300005459 | Ga0068867_100012328 | Ga0068867_1000123285 | 334 |
| 147 | 3300005466 | Ga0070685_10020641 | Ga0070685_100206414 | 334 |
| 148 | 3300005530 | Ga0070679_100002107 | Ga0070679_1000021075 | 334 |
| 149 | 3300005535 | Ga0070684_100094857 | Ga0070684_1000948571 | 334 |
| 150 | 3300005543 | Ga0070672_100004458 | Ga0070672_1000044587 | 334 |
| 151 | 3300005544 | Ga0070686_100000900 | Ga0070686_1000009006 | 334 |
| 152 | 3300005548 | Ga0070665_100062296 | Ga0070665_1000622964 | 334 |
| 153 | 3300005564 | Ga0070664_100020875 | Ga0070664_1000208755 | 334 |
| 154 | 3300005577 | Ga0068857_100022400 | Ga0068857_1000224002 | 334 |
| 155 | 3300005617 | Ga0068859_100007186 | Ga0068859_1000071868 | 334 |
| 156 | 3300005618 | Ga0068864_100001368 | Ga0068864_1000013686 | 334 |
| 157 | 3300005719 | Ga0068861_100003244 | Ga0068861_1000032446 | 334 |
| 158 | 3300005841 | Ga0068863_100005547 | Ga0068863_1000055477 | 334 |
| 159 | 3300005842 | Ga0068858_100039467 | Ga0068858_1000394673 | 334 |
| 160 | 3300005843 | Ga0068860_100005318 | Ga0068860_1000053187 | 334 |
| 161 | 3300005844 | Ga0068862_100007725 | Ga0068862_1000077251 | 334 |
| 162 | 3300006358 | Ga0068871_100059410 | Ga0068871_1000594103 | 334 |
| 163 | 3300006844 | Ga0075428_100004837 | Ga0075428_1000048375 | 334 |
| 164 | 3300006846 | Ga0075430_100005043 | Ga0075430_1000050435 | 334 |
| 165 | 3300006847 | Ga0075431_100000095 | Ga0075431_1000000955 | 334 |
| 166 | 3300006847 | Ga0075431_100002478 | Ga0075431_10000247816 | 334 |
| 167 | 3300006852 | Ga0075433_10053421 | Ga0075433_100534213 | 334 |
| 168 | 3300006871 | Ga0075434_100018537 | Ga0075434_1000185376 | 334 |
| 169 | 3300006880 | Ga0075429_100002344 | Ga0075429_10000234412 | 334 |
| 170 | 3300006931 | Ga0097620_100007186 | Ga0097620_1000071868 | 334 |
| 171 | 3300009147 | Ga0114129_10009220 | Ga0114129_100092202 | 334 |
| 172 | 3300009147 | Ga0114129_10038702 | Ga0114129_100387022 | 334 |
| 173 | 3300009148 | Ga0105243_10122166 | Ga0105243_101221663 | 334 |
| 174 | 3300009174 | Ga0105241_10071258 | Ga0105241_100712582 | 334 |
| 175 | 3300009174 | Ga0105241_10337664 | Ga0105241_103376641 | 334 |
| 176 | 3300009176 | Ga0105242_10157672 | Ga0105242_101576722 | 334 |
| 177 | 3300009177 | Ga0105248_10200507 | Ga0105248_102005073 | 334 |
| 178 | 3300009545 | Ga0105237_10039930 | Ga0105237_100399303 | 334 |
| 179 | 3300009553 | Ga0105249_10002234 | Ga0105249_1000223411 | 334 |
| 180 | 3300013297 | Ga0157378_10502157 | Ga0157378_105021572 | 334 |
| 181 | 3300013306 | Ga0163162_10020638 | Ga0163162_100206384 | 334 |
| 182 | 3300013307 | Ga0157372_10422493 | Ga0157372_104224932 | 334 |
| 183 | 3300013308 | Ga0157375_10089504 | Ga0157375_100895043 | 334 |
| 184 | 3300014325 | Ga0163163_10079064 | Ga0163163_100790643 | 334 |
| 185 | 3300014745 | Ga0157377_10000885 | Ga0157377_100008856 | 334 |
| 186 | 3300017792 | Ga0163161_10171230 | Ga0163161_101712302 | 334 |
| 187 | 3300025912 | Ga0207707_10000080 | Ga0207707_1000008086 | 334 |
| 188 | 3300025917 | Ga0207660_10026610 | Ga0207660_100266104 | 334 |
| 189 | 3300025920 | Ga0207649_10003552 | Ga0207649_100035525 | 334 |
| 190 | 3300025921 | Ga0207652_10001974 | Ga0207652_1000197410 | 334 |
| 191 | 3300025925 | Ga0207650_10005284 | Ga0207650_100052845 | 334 |
| 192 | 3300025926 | Ga0207659_10022335 | Ga0207659_100223355 | 334 |
| 193 | 3300025931 | Ga0207644_10009250 | Ga0207644_100092505 | 334 |
| 194 | 3300025940 | Ga0207691_10021136 | Ga0207691_100211364 | 334 |
| 195 | 3300025941 | Ga0207711_10022643 | Ga0207711_100226435 | 334 |
| 196 | 3300025942 | Ga0207689_10000898 | Ga0207689_1000089818 | 334 |
| 197 | 3300025945 | Ga0207679_10054013 | Ga0207679_100540132 | 334 |
| 198 | 3300025960 | Ga0207651_10008743 | Ga0207651_100087435 | 334 |
| 199 | 3300025986 | Ga0207658_10028959 | Ga0207658_100289593 | 334 |
| 200 | 3300026067 | Ga0207678_10106147 | Ga0207678_101061472 | 334 |
| 201 | 3300026075 | Ga0207708_10013747 | Ga0207708_100137475 | 334 |
| 202 | 3300026088 | Ga0207641_10039452 | Ga0207641_100394521 | 334 |
| 203 | 3300026095 | Ga0207676_10246594 | Ga0207676_102465942 | 334 |
| 204 | 3300026118 | Ga0207675_100006813 | Ga0207675_1000068136 | 334 |
| 205 | 3300028380 | Ga0268265_10024680 | Ga0268265_100246801 | 334 |
| 206 | 3300028381 | Ga0268264_10144275 | Ga0268264_101442752 | 334 |
| 207 | 3300048909 | Ga0496106_0008837 | Ga0496106_0008837_6028_7044 | 334 |
| 208 | 3300050507 | nmdc:mga05p37_26820_c1 | nmdc:mga05p37_26820_c1_1195_2199 | 334 |
| 209 | 3300050507 | nmdc:mga05p37_467284_c1 | nmdc:mga05p37_467284_c1_421_1443 | 334 |
| 210 | 3300050507 | nmdc:mga05p37_63388_c2 | nmdc:mga05p37_63388_c2_1313_2320 | 334 |
| 211 | 3300050508 | nmdc:mga09592_69447_c1 | nmdc:mga09592_69447_c1_932_1939 | 334 |
| 212 | 3300050509 | nmdc:mga0qj67_15015_c1 | nmdc:mga0qj67_15015_c1_2647_3687 | 334 |
| 213 | 3300050509 | nmdc:mga0qj67_32311_c1 | nmdc:mga0qj67_32311_c1_2079_3092 | 334 |
| 214 | 3300050510 | nmdc:mga06r32_1004_c1 | nmdc:mga06r32_1004_c1_4740_5780 | 334 |
| 215 | 3300050510 | nmdc:mga06r32_2409_c1 | nmdc:mga06r32_2409_c1_14447_15454 | 334 |
| 216 | 3300050512 | nmdc:mga0n895_31203_c1 | nmdc:mga0n895_31203_c1_3669_4673 | 334 |
| 217 | 3300050515 | nmdc:mga0a205_414961_c1 | nmdc:mga0a205_414961_c1_23_1027 | 334 |
| 218 | 3300005330 | Ga0070690_100006762 | Ga0070690_1000067622 | 335 |
| 219 | 3300005467 | Ga0070706_100000436 | Ga0070706_1000004365 | 335 |
| 220 | 3300005518 | Ga0070699_100015657 | Ga0070699_1000156573 | 335 |
| 221 | 3300009148 | Ga0105243_10218827 | Ga0105243_102188271 | 335 |
| 222 | 3300009177 | Ga0105248_10008504 | Ga0105248_100085046 | 335 |
| 223 | 3300009177 | Ga0105248_10140567 | Ga0105248_101405674 | 335 |
| 224 | 3300009545 | Ga0105237_10103967 | Ga0105237_101039672 | 335 |
| 225 | 3300013297 | Ga0157378_10026327 | Ga0157378_100263271 | 335 |
| 226 | 3300025910 | Ga0207684_10003948 | Ga0207684_100039486 | 335 |
| 227 | 3300025910 | Ga0207684_10013297 | Ga0207684_100132973 | 335 |
| 228 | 3300025941 | Ga0207711_10002023 | Ga0207711_1000202314 | 335 |
| 229 | 3300028800 | Ga0265338_10013553 | Ga0265338_100135537 | 335 |
| 230 | 3300031247 | Ga0265340_10031906 | Ga0265340_100319062 | 335 |
| 231 | 3300031691 | Ga0316579_10001379 | Ga0316579_100013793 | 335 |
| 232 | 3300031691 | Ga0316579_10022190 | Ga0316579_100221902 | 335 |
| 233 | 3300031727 | Ga0316576_10000499 | Ga0316576_1000049912 | 335 |
| 234 | 3300031727 | Ga0316576_10004155 | Ga0316576_100041557 | 335 |
| 235 | 3300031727 | Ga0316576_10011843 | Ga0316576_100118434 | 335 |
| 236 | 3300031727 | Ga0316576_10100318 | Ga0316576_101003182 | 335 |
| 237 | 3300031728 | Ga0316578_10000285 | Ga0316578_100002859 | 335 |
| 238 | 3300031728 | Ga0316578_10002190 | Ga0316578_1000219010 | 335 |
| 239 | 3300031728 | Ga0316578_10100201 | Ga0316578_101002011 | 335 |
| 240 | 3300031733 | Ga0316577_10000341 | Ga0316577_1000034113 | 335 |
| 241 | 3300031733 | Ga0316577_10005012 | Ga0316577_100050125 | 335 |
| 242 | 3300031733 | Ga0316577_10035269 | Ga0316577_100352692 | 335 |
| 243 | 3300031733 | Ga0316577_10105499 | Ga0316577_101054991 | 335 |
| 244 | 3300031733 | Ga0316577_10161984 | Ga0316577_101619841 | 335 |
| 245 | 3300032133 | Ga0316583_10004147 | Ga0316583_100041471 | 335 |
| 246 | 3300032133 | Ga0316583_10032646 | Ga0316583_100326461 | 335 |
| 247 | 3300032137 | Ga0316585_10000177 | Ga0316585_100001774 | 335 |
| 248 | 3300032139 | Ga0316580_10000346 | Ga0316580_100003463 | 335 |
| 249 | 3300033180 | Ga0307510_10000005 | Ga0307510_10000005262 | 335 |
| 250 | 3300033541 | Ga0316596_1004572 | Ga0316596_10045722 | 335 |
| 251 | 3300035398 | Ga0316574_0003621 | Ga0316574_0003621_2050_3078 | 335 |
| 252 | 3300035398 | Ga0316574_0031157 | Ga0316574_0031157_1528_2568 | 335 |
| 253 | 3300035398 | Ga0316574_0094424 | Ga0316574_0094424_845_1873 | 335 |
| 254 | 3300036647 | Ga0316582_0001638 | Ga0316582_0001638_2954_3982 | 335 |
| 255 | 3300036647 | Ga0316582_0018492 | Ga0316582_0018492_2029_3069 | 335 |
| 256 | 3300036647 | Ga0316582_0069431 | Ga0316582_0069431_1072_2100 | 335 |
| 257 | 3300036712 | Ga0316584_0003162 | Ga0316584_0003162_2108_3136 | 335 |
| 258 | 3300036712 | Ga0316584_0005033 | Ga0316584_0005033_3112_4140 | 335 |
| 259 | 3300036712 | Ga0316584_0045925 | Ga0316584_0045925_2027_3067 | 335 |
| 260 | 3300036712 | Ga0316584_0048895 | Ga0316584_0048895_383_1423 | 335 |
| 261 | 3300036712 | Ga0316584_0125102 | Ga0316584_0125102_435_1463 | 335 |
| 262 | 3300037588 | Ga0316581_0000287 | Ga0316581_0000287_5519_6547 | 335 |
| 263 | 3300037588 | Ga0316581_0005973 | Ga0316581_0005973_2064_3104 | 335 |
| 264 | 3300037588 | Ga0316581_0021432 | Ga0316581_0021432_231_1256 | 335 |
| 265 | 3300037853 | Ga0436364_0031979 | Ga0436364_0031979_24_1088 | 335 |
| 266 | 3300038725 | Ga0400484_31965 | Ga0400484_31965_16438_17466 | 335 |
| 267 | 3300038726 | Ga0400490_38810 | Ga0400490_38810_3339_4367 | 335 |
| 268 | 3300005406 | Ga0070703_10000303 | Ga0070703_100003034 | 336 |
| 269 | 3300005441 | Ga0070700_100006078 | Ga0070700_1000060784 | 336 |
| 270 | 3300025315 | Ga0207697_10010603 | Ga0207697_100106033 | 336 |
| 271 | 3300025885 | Ga0207653_10000210 | Ga0207653_100002104 | 336 |
| 272 | 3300005295 | Ga0065707_10110044 | Ga0065707_101100442 | 337 |
| 273 | 3300005330 | Ga0070690_100130591 | Ga0070690_1001305912 | 337 |
| 274 | 3300005336 | Ga0070680_100140926 | Ga0070680_1001409262 | 337 |
| 275 | 3300005343 | Ga0070687_100039038 | Ga0070687_1000390382 | 337 |
| 276 | 3300005353 | Ga0070669_100004587 | Ga0070669_1000045873 | 337 |
| 277 | 3300005356 | Ga0070674_100068546 | Ga0070674_1000685461 | 337 |
| 278 | 3300005364 | Ga0070673_100024258 | Ga0070673_1000242583 | 337 |
| 279 | 3300005364 | Ga0070673_100094861 | Ga0070673_1000948614 | 337 |
| 280 | 3300005364 | Ga0070673_100241716 | Ga0070673_1002417162 | 337 |
| 281 | 3300005434 | Ga0070709_10194063 | Ga0070709_101940631 | 337 |
| 282 | 3300005444 | Ga0070694_100270238 | Ga0070694_1002702381 | 337 |
| 283 | 3300005459 | Ga0068867_100118406 | Ga0068867_1001184062 | 337 |
| 284 | 3300005618 | Ga0068864_100007715 | Ga0068864_1000077154 | 337 |
| 285 | 3300005719 | Ga0068861_100166908 | Ga0068861_1001669082 | 337 |
| 286 | 3300005844 | Ga0068862_100028146 | Ga0068862_1000281464 | 337 |
| 287 | 3300006173 | Ga0070716_100012811 | Ga0070716_1000128111 | 337 |
| 288 | 3300006881 | Ga0068865_100152371 | Ga0068865_1001523712 | 337 |
| 289 | 3300009093 | Ga0105240_10008440 | Ga0105240_100084406 | 337 |
| 290 | 3300009094 | Ga0111539_10102358 | Ga0111539_101023582 | 337 |
| 291 | 3300009553 | Ga0105249_10020889 | Ga0105249_100208893 | 337 |
| 292 | 3300011119 | Ga0105246_10174908 | Ga0105246_101749082 | 337 |
| 293 | 3300013308 | Ga0157375_10300590 | Ga0157375_103005902 | 337 |
| 294 | 3300014326 | Ga0157380_10002594 | Ga0157380_100025944 | 337 |
| 295 | 3300025906 | Ga0207699_10117782 | Ga0207699_101177822 | 337 |
| 296 | 3300025918 | Ga0207662_10052912 | Ga0207662_100529122 | 337 |
| 297 | 3300025923 | Ga0207681_10016336 | Ga0207681_100163364 | 337 |
| 298 | 3300025933 | Ga0207706_10047799 | Ga0207706_100477993 | 337 |
| 299 | 3300025938 | Ga0207704_10046703 | Ga0207704_100467032 | 337 |
| 300 | 3300025960 | Ga0207651_10032278 | Ga0207651_100322782 | 337 |
| 301 | 3300025961 | Ga0207712_10030357 | Ga0207712_100303572 | 337 |
| 302 | 3300025981 | Ga0207640_10110678 | Ga0207640_101106782 | 337 |
| 303 | 3300026023 | Ga0207677_10330032 | Ga0207677_103300322 | 337 |
| 304 | 3300026075 | Ga0207708_10009835 | Ga0207708_100098353 | 337 |
| 305 | 3300026075 | Ga0207708_10057712 | Ga0207708_100577123 | 337 |
| 306 | 3300026089 | Ga0207648_10025948 | Ga0207648_100259485 | 337 |
| 307 | 3300026095 | Ga0207676_10005442 | Ga0207676_100054424 | 337 |
| 308 | 3300026118 | Ga0207675_100045648 | Ga0207675_1000456482 | 337 |
| 309 | 3300026121 | Ga0207683_10071650 | Ga0207683_100716503 | 337 |
| 310 | 3300046476 | Ga0495662_0013675 | Ga0495662_0013675_2690_3724 | 337 |
| 311 | 3300002459 | JGI24751J29686_10000222 | JGI24751J29686_1000022212 | 338 |
| 312 | 3300005289 | Ga0065704_10006628 | Ga0065704_100066284 | 338 |
| 313 | 3300005295 | Ga0065707_10003075 | Ga0065707_100030755 | 338 |
| 314 | 3300005295 | Ga0065707_10084860 | Ga0065707_100848602 | 338 |
| 315 | 3300005331 | Ga0070670_100001195 | Ga0070670_1000011953 | 338 |
| 316 | 3300005331 | Ga0070670_100030144 | Ga0070670_1000301441 | 338 |
| 317 | 3300005331 | Ga0070670_100285265 | Ga0070670_1002852651 | 338 |
| 318 | 3300005334 | Ga0068869_100150773 | Ga0068869_1001507733 | 338 |
| 319 | 3300005337 | Ga0070682_100042271 | Ga0070682_1000422713 | 338 |
| 320 | 3300005340 | Ga0070689_100000404 | Ga0070689_10000040429 | 338 |
| 321 | 3300005343 | Ga0070687_100003900 | Ga0070687_1000039004 | 338 |
| 322 | 3300005343 | Ga0070687_100014864 | Ga0070687_1000148642 | 338 |
| 323 | 3300005345 | Ga0070692_10029218 | Ga0070692_100292182 | 338 |
| 324 | 3300005345 | Ga0070692_10162640 | Ga0070692_101626401 | 338 |
| 325 | 3300005355 | Ga0070671_100003274 | Ga0070671_1000032746 | 338 |
| 326 | 3300005355 | Ga0070671_100021163 | Ga0070671_1000211633 | 338 |
| 327 | 3300005364 | Ga0070673_100021702 | Ga0070673_1000217022 | 338 |
| 328 | 3300005365 | Ga0070688_100035449 | Ga0070688_1000354492 | 338 |
| 329 | 3300005367 | Ga0070667_100040393 | Ga0070667_1000403932 | 338 |
| 330 | 3300005367 | Ga0070667_100086764 | Ga0070667_1000867642 | 338 |
| 331 | 3300005441 | Ga0070700_100020541 | Ga0070700_1000205414 | 338 |
| 332 | 3300005441 | Ga0070700_100035285 | Ga0070700_1000352852 | 338 |
| 333 | 3300005444 | Ga0070694_100016632 | Ga0070694_1000166322 | 338 |
| 334 | 3300005444 | Ga0070694_100019151 | Ga0070694_1000191513 | 338 |
| 335 | 3300005444 | Ga0070694_100075578 | Ga0070694_1000755781 | 338 |
| 336 | 3300005444 | Ga0070694_100079753 | Ga0070694_1000797532 | 338 |
| 337 | 3300005444 | Ga0070694_100182738 | Ga0070694_1001827381 | 338 |
| 338 | 3300005445 | Ga0070708_100016668 | Ga0070708_1000166686 | 338 |
| 339 | 3300005456 | Ga0070678_100105237 | Ga0070678_1001052371 | 338 |
| 340 | 3300005459 | Ga0068867_100247547 | Ga0068867_1002475471 | 338 |
| 341 | 3300005471 | Ga0070698_100033518 | Ga0070698_1000335183 | 338 |
| 342 | 3300005518 | Ga0070699_100004454 | Ga0070699_10000445411 | 338 |
| 343 | 3300005536 | Ga0070697_100360136 | Ga0070697_1003601361 | 338 |
| 344 | 3300005543 | Ga0070672_100063823 | Ga0070672_1000638232 | 338 |
| 345 | 3300005546 | Ga0070696_100157438 | Ga0070696_1001574381 | 338 |
| 346 | 3300005547 | Ga0070693_100008726 | Ga0070693_1000087261 | 338 |
| 347 | 3300005547 | Ga0070693_100167270 | Ga0070693_1001672702 | 338 |
| 348 | 3300005549 | Ga0070704_100018543 | Ga0070704_1000185432 | 338 |
| 349 | 3300005549 | Ga0070704_100097516 | Ga0070704_1000975162 | 338 |
| 350 | 3300005577 | Ga0068857_100036219 | Ga0068857_1000362196 | 338 |
| 351 | 3300005577 | Ga0068857_100244710 | Ga0068857_1002447102 | 338 |
| 352 | 3300005615 | Ga0070702_100011809 | Ga0070702_1000118094 | 338 |
| 353 | 3300005616 | Ga0068852_100263243 | Ga0068852_1002632432 | 338 |
| 354 | 3300005617 | Ga0068859_100002785 | Ga0068859_10000278511 | 338 |
| 355 | 3300005617 | Ga0068859_100006017 | Ga0068859_1000060174 | 338 |
| 356 | 3300005617 | Ga0068859_100145597 | Ga0068859_1001455973 | 338 |
| 357 | 3300005617 | Ga0068859_100210892 | Ga0068859_1002108922 | 338 |
| 358 | 3300005617 | Ga0068859_100317888 | Ga0068859_1003178882 | 338 |
| 359 | 3300005617 | Ga0068859_100399897 | Ga0068859_1003998972 | 338 |
| 360 | 3300005618 | Ga0068864_100009934 | Ga0068864_1000099346 | 338 |
| 361 | 3300005618 | Ga0068864_100071213 | Ga0068864_1000712132 | 338 |
| 362 | 3300005618 | Ga0068864_100084805 | Ga0068864_1000848053 | 338 |
| 363 | 3300005618 | Ga0068864_100176981 | Ga0068864_1001769812 | 338 |
| 364 | 3300005719 | Ga0068861_100121115 | Ga0068861_1001211152 | 338 |
| 365 | 3300005834 | Ga0068851_10005347 | Ga0068851_100053472 | 338 |
| 366 | 3300005840 | Ga0068870_10091198 | Ga0068870_100911983 | 338 |
| 367 | 3300005841 | Ga0068863_100009090 | Ga0068863_1000090902 | 338 |
| 368 | 3300005841 | Ga0068863_100154464 | Ga0068863_1001544642 | 338 |
| 369 | 3300005842 | Ga0068858_100045584 | Ga0068858_1000455843 | 338 |
| 370 | 3300005842 | Ga0068858_100060987 | Ga0068858_1000609872 | 338 |
| 371 | 3300005842 | Ga0068858_100066611 | Ga0068858_1000666112 | 338 |
| 372 | 3300005842 | Ga0068858_100070487 | Ga0068858_1000704876 | 338 |
| 373 | 3300005842 | Ga0068858_100073163 | Ga0068858_1000731633 | 338 |
| 374 | 3300005842 | Ga0068858_100198419 | Ga0068858_1001984192 | 338 |
| 375 | 3300005842 | Ga0068858_100213771 | Ga0068858_1002137711 | 338 |
| 376 | 3300005843 | Ga0068860_100045095 | Ga0068860_1000450952 | 338 |
| 377 | 3300005843 | Ga0068860_100052868 | Ga0068860_1000528683 | 338 |
| 378 | 3300005843 | Ga0068860_100118906 | Ga0068860_1001189064 | 338 |
| 379 | 3300005843 | Ga0068860_100198094 | Ga0068860_1001980943 | 338 |
| 380 | 3300005843 | Ga0068860_100335372 | Ga0068860_1003353722 | 338 |
| 381 | 3300005843 | Ga0068860_100460824 | Ga0068860_1004608242 | 338 |
| 382 | 3300005985 | Ga0081539_10000823 | Ga0081539_100008236 | 338 |
| 383 | 3300006028 | Ga0070717_10168182 | Ga0070717_101681821 | 338 |
| 384 | 3300006237 | Ga0097621_100020521 | Ga0097621_1000205211 | 338 |
| 385 | 3300006358 | Ga0068871_100010186 | Ga0068871_1000101863 | 338 |
| 386 | 3300006358 | Ga0068871_100043948 | Ga0068871_1000439481 | 338 |
| 387 | 3300006358 | Ga0068871_100346142 | Ga0068871_1003461422 | 338 |
| 388 | 3300006358 | Ga0068871_100354876 | Ga0068871_1003548761 | 338 |
| 389 | 3300006846 | Ga0075430_100049830 | Ga0075430_1000498303 | 338 |
| 390 | 3300006846 | Ga0075430_100075849 | Ga0075430_1000758494 | 338 |
| 391 | 3300006847 | Ga0075431_100166157 | Ga0075431_1001661573 | 338 |
| 392 | 3300006852 | Ga0075433_10092171 | Ga0075433_100921712 | 338 |
| 393 | 3300006914 | Ga0075436_100000002 | Ga0075436_10000000233 | 338 |
| 394 | 3300006931 | Ga0097620_100002785 | Ga0097620_10000278511 | 338 |
| 395 | 3300006931 | Ga0097620_100006017 | Ga0097620_1000060174 | 338 |
| 396 | 3300006931 | Ga0097620_100145604 | Ga0097620_1001456041 | 338 |
| 397 | 3300006931 | Ga0097620_100210890 | Ga0097620_1002108902 | 338 |
| 398 | 3300006931 | Ga0097620_100317871 | Ga0097620_1003178712 | 338 |
| 399 | 3300006931 | Ga0097620_100399902 | Ga0097620_1003999022 | 338 |
| 400 | 3300007076 | Ga0075435_100002835 | Ga0075435_1000028356 | 338 |
| 401 | 3300009093 | Ga0105240_10143601 | Ga0105240_101436012 | 338 |
| 402 | 3300009094 | Ga0111539_10010910 | Ga0111539_1001091010 | 338 |
| 403 | 3300009094 | Ga0111539_10020646 | Ga0111539_100206463 | 338 |
| 404 | 3300009094 | Ga0111539_10032213 | Ga0111539_100322136 | 338 |
| 405 | 3300009094 | Ga0111539_10045777 | Ga0111539_100457772 | 338 |
| 406 | 3300009098 | Ga0105245_10015309 | Ga0105245_100153095 | 338 |
| 407 | 3300009098 | Ga0105245_10193661 | Ga0105245_101936611 | 338 |
| 408 | 3300009101 | Ga0105247_10000534 | Ga0105247_100005344 | 338 |
| 409 | 3300009101 | Ga0105247_10061468 | Ga0105247_100614682 | 338 |
| 410 | 3300009147 | Ga0114129_10030392 | Ga0114129_100303924 | 338 |
| 411 | 3300009147 | Ga0114129_10044005 | Ga0114129_100440053 | 338 |
| 412 | 3300009147 | Ga0114129_10102717 | Ga0114129_101027172 | 338 |
| 413 | 3300009147 | Ga0114129_10203575 | Ga0114129_102035752 | 338 |
| 414 | 3300009148 | Ga0105243_10000073 | Ga0105243_1000007372 | 338 |
| 415 | 3300009148 | Ga0105243_10004691 | Ga0105243_100046912 | 338 |
| 416 | 3300009148 | Ga0105243_10014886 | Ga0105243_100148862 | 338 |
| 417 | 3300009148 | Ga0105243_10098567 | Ga0105243_100985674 | 338 |
| 418 | 3300009174 | Ga0105241_10069393 | Ga0105241_100693933 | 338 |
| 419 | 3300009176 | Ga0105242_10000043 | Ga0105242_1000004312 | 338 |
| 420 | 3300009176 | Ga0105242_10001013 | Ga0105242_100010135 | 338 |
| 421 | 3300009176 | Ga0105242_10001366 | Ga0105242_1000136612 | 338 |
| 422 | 3300009176 | Ga0105242_10043521 | Ga0105242_100435212 | 338 |
| 423 | 3300009176 | Ga0105242_10059252 | Ga0105242_100592524 | 338 |
| 424 | 3300009177 | Ga0105248_10011822 | Ga0105248_100118223 | 338 |
| 425 | 3300009177 | Ga0105248_10027618 | Ga0105248_100276182 | 338 |
| 426 | 3300009177 | Ga0105248_10244075 | Ga0105248_102440752 | 338 |
| 427 | 3300009177 | Ga0105248_10448996 | Ga0105248_104489962 | 338 |
| 428 | 3300009177 | Ga0105248_10526360 | Ga0105248_105263601 | 338 |
| 429 | 3300009545 | Ga0105237_10002093 | Ga0105237_100020937 | 338 |
| 430 | 3300009551 | Ga0105238_10018882 | Ga0105238_100188822 | 338 |
| 431 | 3300009551 | Ga0105238_10036299 | Ga0105238_100362997 | 338 |
| 432 | 3300009551 | Ga0105238_10415066 | Ga0105238_104150662 | 338 |
| 433 | 3300009553 | Ga0105249_10001548 | Ga0105249_1000154814 | 338 |
| 434 | 3300009553 | Ga0105249_10184919 | Ga0105249_101849192 | 338 |
| 435 | 3300009553 | Ga0105249_10320377 | Ga0105249_103203772 | 338 |
| 436 | 3300010375 | Ga0105239_10526102 | Ga0105239_105261021 | 338 |
| 437 | 3300011119 | Ga0105246_10102704 | Ga0105246_101027042 | 338 |
| 438 | 3300011119 | Ga0105246_10203807 | Ga0105246_102038072 | 338 |
| 439 | 3300011119 | Ga0105246_10207796 | Ga0105246_102077962 | 338 |
| 440 | 3300011119 | Ga0105246_10296807 | Ga0105246_102968071 | 338 |
| 441 | 3300011119 | Ga0105246_10315591 | Ga0105246_103155912 | 338 |
| 442 | 3300013100 | Ga0157373_10009657 | Ga0157373_100096573 | 338 |
| 443 | 3300013296 | Ga0157374_10004256 | Ga0157374_100042567 | 338 |
| 444 | 3300013297 | Ga0157378_10000004 | Ga0157378_1000000495 | 338 |
| 445 | 3300013297 | Ga0157378_10001387 | Ga0157378_100013876 | 338 |
| 446 | 3300013306 | Ga0163162_10000831 | Ga0163162_100008313 | 338 |
| 447 | 3300013306 | Ga0163162_10030430 | Ga0163162_100304303 | 338 |
| 448 | 3300013306 | Ga0163162_10031277 | Ga0163162_100312776 | 338 |
| 449 | 3300013306 | Ga0163162_10100598 | Ga0163162_101005982 | 338 |
| 450 | 3300013306 | Ga0163162_10176740 | Ga0163162_101767402 | 338 |
| 451 | 3300013306 | Ga0163162_10609380 | Ga0163162_106093802 | 338 |
| 452 | 3300013308 | Ga0157375_10000479 | Ga0157375_100004796 | 338 |
| 453 | 3300013308 | Ga0157375_10297341 | Ga0157375_102973413 | 338 |
| 454 | 3300013308 | Ga0157375_10516599 | Ga0157375_105165992 | 338 |
| 455 | 3300014325 | Ga0163163_10000334 | Ga0163163_1000033415 | 338 |
| 456 | 3300014325 | Ga0163163_10004205 | Ga0163163_100042056 | 338 |
| 457 | 3300014325 | Ga0163163_10041815 | Ga0163163_100418152 | 338 |
| 458 | 3300014325 | Ga0163163_10232652 | Ga0163163_102326522 | 338 |
| 459 | 3300014325 | Ga0163163_10331353 | Ga0163163_103313532 | 338 |
| 460 | 3300014326 | Ga0157380_10185470 | Ga0157380_101854702 | 338 |
| 461 | 3300014745 | Ga0157377_10042076 | Ga0157377_100420762 | 338 |
| 462 | 3300014745 | Ga0157377_10144320 | Ga0157377_101443202 | 338 |
| 463 | 3300014968 | Ga0157379_10058097 | Ga0157379_100580974 | 338 |
| 464 | 3300014968 | Ga0157379_10093518 | Ga0157379_100935183 | 338 |
| 465 | 3300014969 | Ga0157376_10008430 | Ga0157376_100084305 | 338 |
| 466 | 3300025315 | Ga0207697_10013386 | Ga0207697_100133863 | 338 |
| 467 | 3300025321 | Ga0207656_10002909 | Ga0207656_100029095 | 338 |
| 468 | 3300025885 | Ga0207653_10002366 | Ga0207653_100023662 | 338 |
| 469 | 3300025900 | Ga0207710_10001728 | Ga0207710_1000172810 | 338 |
| 470 | 3300025900 | Ga0207710_10019201 | Ga0207710_100192012 | 338 |
| 471 | 3300025903 | Ga0207680_10013599 | Ga0207680_100135993 | 338 |
| 472 | 3300025908 | Ga0207643_10003313 | Ga0207643_100033138 | 338 |
| 473 | 3300025913 | Ga0207695_10149201 | Ga0207695_101492012 | 338 |
| 474 | 3300025917 | Ga0207660_10204403 | Ga0207660_102044031 | 338 |
| 475 | 3300025918 | Ga0207662_10011021 | Ga0207662_100110213 | 338 |
| 476 | 3300025918 | Ga0207662_10075686 | Ga0207662_100756862 | 338 |
| 477 | 3300025918 | Ga0207662_10234836 | Ga0207662_102348362 | 338 |
| 478 | 3300025922 | Ga0207646_10043228 | Ga0207646_100432282 | 338 |
| 479 | 3300025922 | Ga0207646_10111341 | Ga0207646_101113412 | 338 |
| 480 | 3300025924 | Ga0207694_10013885 | Ga0207694_100138855 | 338 |
| 481 | 3300025925 | Ga0207650_10000332 | Ga0207650_1000033234 | 338 |
| 482 | 3300025925 | Ga0207650_10014749 | Ga0207650_100147495 | 338 |
| 483 | 3300025926 | Ga0207659_10157273 | Ga0207659_101572732 | 338 |
| 484 | 3300025931 | Ga0207644_10018001 | Ga0207644_100180013 | 338 |
| 485 | 3300025931 | Ga0207644_10049981 | Ga0207644_100499812 | 338 |
| 486 | 3300025933 | Ga0207706_10102676 | Ga0207706_101026763 | 338 |
| 487 | 3300025934 | Ga0207686_10000003 | Ga0207686_1000000331 | 338 |
| 488 | 3300025934 | Ga0207686_10000244 | Ga0207686_100002442 | 338 |
| 489 | 3300025934 | Ga0207686_10000965 | Ga0207686_100009655 | 338 |
| 490 | 3300025934 | Ga0207686_10047545 | Ga0207686_100475454 | 338 |
| 491 | 3300025935 | Ga0207709_10000124 | Ga0207709_1000012432 | 338 |
| 492 | 3300025935 | Ga0207709_10000469 | Ga0207709_100004697 | 338 |
| 493 | 3300025941 | Ga0207711_10245037 | Ga0207711_102450371 | 338 |
| 494 | 3300025942 | Ga0207689_10031409 | Ga0207689_100314095 | 338 |
| 495 | 3300025942 | Ga0207689_10093643 | Ga0207689_100936432 | 338 |
| 496 | 3300025942 | Ga0207689_10240501 | Ga0207689_102405012 | 338 |
| 497 | 3300025945 | Ga0207679_10122782 | Ga0207679_101227822 | 338 |
| 498 | 3300025945 | Ga0207679_10289176 | Ga0207679_102891762 | 338 |
| 499 | 3300025960 | Ga0207651_10067130 | Ga0207651_100671303 | 338 |
| 500 | 3300025981 | Ga0207640_10264528 | Ga0207640_102645281 | 338 |
| 501 | 3300025986 | Ga0207658_10011740 | Ga0207658_100117404 | 338 |
| 502 | 3300025986 | Ga0207658_10173235 | Ga0207658_101732352 | 338 |
| 503 | 3300026035 | Ga0207703_10026355 | Ga0207703_100263552 | 338 |
| 504 | 3300026035 | Ga0207703_10043076 | Ga0207703_100430762 | 338 |
| 505 | 3300026035 | Ga0207703_10048692 | Ga0207703_100486922 | 338 |
| 506 | 3300026035 | Ga0207703_10074709 | Ga0207703_100747093 | 338 |
| 507 | 3300026035 | Ga0207703_10121190 | Ga0207703_101211904 | 338 |
| 508 | 3300026035 | Ga0207703_10202594 | Ga0207703_102025942 | 338 |
| 509 | 3300026075 | Ga0207708_10004335 | Ga0207708_100043359 | 338 |
| 510 | 3300026075 | Ga0207708_10033292 | Ga0207708_100332924 | 338 |
| 511 | 3300026075 | Ga0207708_10277542 | Ga0207708_102775422 | 338 |
| 512 | 3300026088 | Ga0207641_10004482 | Ga0207641_1000448212 | 338 |
| 513 | 3300026088 | Ga0207641_10038653 | Ga0207641_100386533 | 338 |
| 514 | 3300026089 | Ga0207648_10010332 | Ga0207648_100103326 | 338 |
| 515 | 3300026089 | Ga0207648_10029644 | Ga0207648_100296442 | 338 |
| 516 | 3300026089 | Ga0207648_10114316 | Ga0207648_101143162 | 338 |
| 517 | 3300026095 | Ga0207676_10149182 | Ga0207676_101491822 | 338 |
| 518 | 3300026116 | Ga0207674_10107892 | Ga0207674_101078922 | 338 |
| 519 | 3300026116 | Ga0207674_10257850 | Ga0207674_102578502 | 338 |
| 520 | 3300026118 | Ga0207675_100012394 | Ga0207675_1000123946 | 338 |
| 521 | 3300026118 | Ga0207675_100191250 | Ga0207675_1001912502 | 338 |
| 522 | 3300026142 | Ga0207698_10123894 | Ga0207698_101238943 | 338 |
| 523 | 3300027907 | Ga0207428_10012870 | Ga0207428_100128707 | 338 |
| 524 | 3300027907 | Ga0207428_10028144 | Ga0207428_100281442 | 338 |
| 525 | 3300028381 | Ga0268264_10016000 | Ga0268264_100160005 | 338 |
| 526 | 3300028381 | Ga0268264_10105726 | Ga0268264_101057262 | 338 |
| 527 | 3300028381 | Ga0268264_10120699 | Ga0268264_101206992 | 338 |
| 528 | 3300028381 | Ga0268264_10223307 | Ga0268264_102233072 | 338 |
| 529 | 3300028381 | Ga0268264_10303970 | Ga0268264_103039702 | 338 |
| 530 | 3300031548 | Ga0307408_100056807 | Ga0307408_1000568072 | 338 |
| 531 | 3300031731 | Ga0307405_10110334 | Ga0307405_101103341 | 338 |
| 532 | 3300032002 | Ga0307416_100087318 | Ga0307416_1000873182 | 338 |
| 533 | 3300032005 | Ga0307411_10024372 | Ga0307411_100243721 | 338 |
| 534 | 3300035091 | Ga0373951_0000742 | Ga0373951_0000742_5619_6635 | 338 |
| 535 | 3300035207 | Ga0373942_0008109 | Ga0373942_0008109_33_1049 | 338 |
| 536 | 3300036401 | Ga0373937_0132051 | Ga0373937_0132051_81_1118 | 338 |
| 537 | 3300038699 | Ga0242422_01793 | Ga0242422_01793_362_1378 | 338 |
| 538 | 3300038726 | Ga0400490_33134 | Ga0400490_33134_2121_3176 | 338 |
| 539 | 3300038996 | Ga0242420_002873 | Ga0242420_002873_17_1033 | 338 |
| 540 | 3300044712 | Ga0453684_0125662 | Ga0453684_0125662_1863_2900 | 338 |
| 541 | 3300045051 | Ga0451576_0006280 | Ga0451576_0006280_11326_12363 | 338 |
| 542 | 3300045051 | Ga0451576_0301864 | Ga0451576_0301864_473_1510 | 338 |
| 543 | 3300045051 | Ga0451576_0341651 | Ga0451576_0341651_475_1491 | 338 |
| 544 | 3300046660 | Ga0495625_0030579 | Ga0495625_0030579_2753_3784 | 338 |
| 545 | 3300046664 | Ga0495659_0002750 | Ga0495659_0002750_3550_4584 | 338 |
| 546 | 3300046684 | Ga0495669_0045581 | Ga0495669_0045581_339_1373 | 338 |
| 547 | 3300046689 | Ga0495613_0187058 | Ga0495613_0187058_118_1155 | 338 |
| 548 | 3300046691 | Ga0495670_0054795 | Ga0495670_0054795_95_1129 | 338 |
| 549 | 3300046809 | Ga0495600_0144909 | Ga0495600_0144909_271_1308 | 338 |
| 550 | 3300048904 | Ga0496101_0274862 | Ga0496101_0274862_78_1115 | 338 |
| 551 | 3300048909 | Ga0496106_0090303 | Ga0496106_0090303_943_1959 | 338 |
| 552 | 3300048912 | Ga0496109_0345642 | Ga0496109_0345642_291_1307 | 338 |
| 553 | 3300048915 | Ga0496112_0121793 | Ga0496112_0121793_1358_2374 | 338 |
| 554 | 3300048915 | Ga0496112_0285811 | Ga0496112_0285811_171_1187 | 338 |
| 555 | 3300048923 | Ga0496120_0104523 | Ga0496120_0104523_251_1294 | 338 |
| 556 | 3300048924 | Ga0496121_0125202 | Ga0496121_0125202_57_1112 | 338 |
| 557 | 3300048927 | Ga0496124_0001839 | Ga0496124_0001839_25802_26845 | 338 |
| 558 | 3300048927 | Ga0496124_0087708 | Ga0496124_0087708_362_1399 | 338 |
| 559 | 3300049576 | Ga0501040_0049411 | Ga0501040_0049411_868_1920 | 338 |
| 560 | 3300049577 | Ga0501041_0020449 | Ga0501041_0020449_2717_3769 | 338 |
| 561 | 3300049584 | Ga0501068_0195917 | Ga0501068_0195917_120_1214 | 338 |
| 562 | 3300049587 | Ga0501071_0060318 | Ga0501071_0060318_399_1451 | 338 |
| 563 | 3300049588 | Ga0501072_0010271 | Ga0501072_0010271_4842_5894 | 338 |
| 564 | 3300049588 | Ga0501072_0010575 | Ga0501072_0010575_1901_2953 | 338 |
| 565 | 3300049588 | Ga0501072_0114173 | Ga0501072_0114173_630_1682 | 338 |
| 566 | 3300049591 | Ga0501075_0003149 | Ga0501075_0003149_5865_6917 | 338 |
| 567 | 3300049591 | Ga0501075_0031840 | Ga0501075_0031840_742_1794 | 338 |
| 568 | 3300049592 | Ga0501076_0009507 | Ga0501076_0009507_873_1925 | 338 |
| 569 | 3300049661 | Ga0501217_053726 | Ga0501217_053726_19_1035 | 338 |
| 570 | 3300049665 | Ga0501227_009038 | Ga0501227_009038_759_1775 | 338 |
| 571 | 3300049675 | Ga0501243_017986 | Ga0501243_017986_89_1117 | 338 |
| 572 | 3300049686 | Ga0501257_020454 | Ga0501257_020454_80_1108 | 338 |
| 573 | 3300049705 | Ga0501225_0012602 | Ga0501225_0012602_902_1930 | 338 |
| 574 | 3300049741 | Ga0501079_0108705 | Ga0501079_0108705_289_1341 | 338 |
| 575 | 3300049741 | Ga0501079_0275911 | Ga0501079_0275911_169_1221 | 338 |
| 576 | 3300049743 | Ga0501081_0050029 | Ga0501081_0050029_1405_2457 | 338 |
| 577 | 3300049765 | Ga0501268_010107 | Ga0501268_010107_431_1447 | 338 |
| 578 | 3300049770 | Ga0501273_006720 | Ga0501273_006720_226_1254 | 338 |
| 579 | 3300049853 | Ga0501226_002191 | Ga0501226_002191_870_1898 | 338 |
| 580 | 3300050507 | nmdc:mga05p37_146994_c1 | nmdc:mga05p37_146994_c1_853_1869 | 338 |
| 581 | 3300050507 | nmdc:mga05p37_424234_c1 | nmdc:mga05p37_424234_c1_302_1318 | 338 |
| 582 | 3300050508 | nmdc:mga09592_471273_c1 | nmdc:mga09592_471273_c1_27_1043 | 338 |
| 583 | 3300050509 | nmdc:mga0qj67_8504_c1 | nmdc:mga0qj67_8504_c1_6106_7122 | 338 |
| 584 | 3300050510 | nmdc:mga06r32_99271_c1 | nmdc:mga06r32_99271_c1_1085_2101 | 338 |
| 585 | 3300050511 | nmdc:mga08y16_14577_c1 | nmdc:mga08y16_14577_c1_5501_6526 | 338 |
| 586 | 3300050511 | nmdc:mga08y16_167088_c1 | nmdc:mga08y16_167088_c1_936_2060 | 338 |
| 587 | 3300050513 | nmdc:mga0rr50_1698_c1 | nmdc:mga0rr50_1698_c1_6438_7475 | 338 |
| 588 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_379133_380170 | 338 |
| 589 | 3300050515 | nmdc:mga0a205_97266_c1 | nmdc:mga0a205_97266_c1_1777_2793 | 338 |
| 590 | 3300053139 | Ga0500568_0006578 | Ga0500568_0006578_1505_2542 | 338 |
| 591 | 3300053139 | Ga0500568_0010599 | Ga0500568_0010599_1763_2800 | 338 |
| 592 | 3300053146 | Ga0500588_0003036 | Ga0500588_0003036_612_1640 | 338 |
| 593 | 3300053151 | Ga0500604_0005744 | Ga0500604_0005744_1399_2436 | 338 |
| 594 | 3300053156 | Ga0500622_0000360 | Ga0500622_0000360_10772_11809 | 338 |
| 595 | 3300054114 | Ga0501084_0044987 | Ga0501084_0044987_1631_2683 | 338 |
| 596 | 3300061734 | Ga0530510_0024894 | Ga0530510_0024894_940_1977 | 338 |
| 597 | 3300061734 | Ga0530510_0028936 | Ga0530510_0028936_798_1850 | 338 |
| 598 | 3300061734 | Ga0530510_0087764 | Ga0530510_0087764_301_1353 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6r76-assembly2.cif.gz_C | crystal structure of trans-3-hydroxy-l-proline dehydratase from thermococcus litoralis - open conformation | 0.9866 | 4 | 338 |
| 6r77-assembly1.cif.gz_B | crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation | 0.983 | 4 | 338 |
| 6r76-assembly2.cif.gz_C | crystal structure of trans-3-hydroxy-l-proline dehydratase from thermococcus litoralis - open conformation | 0.975 | 4 | 338 |
| 8a4r-assembly1.cif.gz_CCC-2 | proline racemase (pror) from the gram-positive bacterium acetoanaerobium sticklandii from isotropic orthorhombic data at 3.59 a | 0.9738 | 14 | 337 |
| 6r77-assembly1.cif.gz_B | crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation | 0.9715 | 4 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q868H8_133_298_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9778 | 147 | 295 | 3.10.310.10 |
| af_A0A0G2L1A2_13_139_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9693 | 16 | 130 | 3.10.310.10 |
| 4q2hB02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9597 | 148 | 313 | 3.10.310.10 |
| af_Q868H8_7_132_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9544 | 18 | 130 | 3.10.310.10 |
| 4q2hB02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.954 | 148 | 313 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662NDC0-F1-model_v4 | deleted | 0.9931 | 176 | 338 |
|
| AF-A0A536IB20-F1-model_v4 | Proline racemase | 0.9911 | 204 | 338 |
GO:0047580
|
| AF-A0A662CZS7-F1-model_v4 | Proline racemase | 0.9904 | 153 | 338 |
GO:0047580
|
| AF-A0A352XV39-F1-model_v4 | Proline racemase | 0.9889 | 108 | 338 |
GO:0047580
|
| AF-A0A7W0A336-F1-model_v4 | Proline racemase family protein | 0.9888 | 178 | 338 |
GO:0047580
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar