F467713
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 287 | 590 | 609 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0021699|Ga0501070_0021699_713_2689 |
| Length | 640 |
| Sequence | MNRYPLWKYIIIGIAVLVGIVYTLPNFYGEAPAVQISPTHAGVKVDAALEARVGAILKAGKLNPDALTLDAGTNTVRARFDNTDIQLKAKDLIAGKLGDGYVVALNLVSQSPRWLKAIGALPMYLGLDLRGGVYFLMQVDMEAALTKKLDSYVGDIRTTLRDQDIHYTHVAREGDTVVVHLRDAAARDKALTAIGKSMPDLTLKTTQSGNDNLIVAVLSKQSQSRTEELALQQNITTLRNRVNELGVAEPIIQQQGLNRVVVQLPGVQDTARAKEILGRTATLEIHMVDEDHADAASLEAAVKGQIPFGDSLYYNRSGVPLLVKKQVILTGDRINDAQPGFDPQTGQPAVHVNLDGTGARIFGRVTRDNVGKRMAIVLFDQGKGEVITAPVIQQEIDGGRVQISGHMDTREANDIALLLRAGALAAPMNIVEERTVGPSLGAENIKIGFHSTWIGFSAIAVFIISYYVLFGVISITALAINXXXLIALLSMLQATLTLPGMAGIALTVGMAIDANVLINERVREELRAGMTPQAAISAGYEHAWRTILDCNITTLIAGIALFAFGAGPVKGFAVVLCLGLLTSMFSAVMVSRGIVNYIYGRRRRLEKVSIGQIWRPETGAAGRKARGAGAGKTGGVRSKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 4 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 5 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 6 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 217 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 218 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 285 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 287 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 0 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.17 |
| Nodule | 0.17 |
| Rhizoplane | 3.85 |
| Rhizosphere | 93.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002078 | 3300001977 | Bacteria | 3198 |
| 2 | JGI24738J21930_10008049 | 3300002075 | Bacteria | 2407 |
| 3 | JGI24749J21850_1001582 | 3300002076 | Bacteria | 3227 |
| 4 | JGI24744J21845_10006896 | 3300002077 | Bacteria | 2348 |
| 5 | JGI24034J26672_10002490 | 3300002239 | Bacteria | 2529 |
| 6 | JGI25158J39367_1001262 | 3300002739 | Bacteria | 4516 |
| 7 | JGI25150J39212_1004937 | 3300002774 | Bacteria | 2899 |
| 8 | Ga0055524_1003537 | 3300003775 | Bacteria | 7552 |
| 9 | Ga0055528_1009883 | 3300003790 | Bacteria | 3939 |
| 10 | Ga0065715_10099723 | 3300005293 | Bacteria | 3378 |
| 11 | Ga0065715_10106418 | 3300005293 | Bacteria | 2828 |
| 12 | Ga0070676_10010596 | 3300005328 | Bacteria | 5001 |
| 13 | Ga0070676_10030302 | 3300005328 | Bacteria | 3084 |
| 14 | Ga0070683_100011136 | 3300005329 | Bacteria | 7759 |
| 15 | Ga0070683_100012394 | 3300005329 | Bacteria | 7408 |
| 16 | Ga0070690_100001622 | 3300005330 | Bacteria | 11824 |
| 17 | Ga0070690_100005520 | 3300005330 | Bacteria | 7114 |
| 18 | Ga0070670_100008762 | 3300005331 | Bacteria | 8639 |
| 19 | Ga0070670_100014387 | 3300005331 | Bacteria | 6789 |
| 20 | Ga0070670_100058176 | 3300005331 | Bacteria | 3318 |
| 21 | Ga0070670_100072954 | 3300005331 | Bacteria | 2948 |
| 22 | Ga0070677_10001330 | 3300005333 | Bacteria | 7890 |
| 23 | Ga0070677_10004494 | 3300005333 | Bacteria | 4557 |
| 24 | Ga0070677_10019797 | 3300005333 | Bacteria | 2443 |
| 25 | Ga0068869_100001603 | 3300005334 | Bacteria | 13451 |
| 26 | Ga0068869_100003167 | 3300005334 | Bacteria | 10040 |
| 27 | Ga0068869_100020382 | 3300005334 | Bacteria | 4545 |
| 28 | Ga0068869_100034018 | 3300005334 | Bacteria | 3602 |
| 29 | Ga0070666_10003422 | 3300005335 | Bacteria | 9615 |
| 30 | Ga0070666_10025481 | 3300005335 | Bacteria | 3856 |
| 31 | Ga0070680_100009608 | 3300005336 | Bacteria | 7435 |
| 32 | Ga0068868_100007221 | 3300005338 | Bacteria | 7896 |
| 33 | Ga0068868_100035463 | 3300005338 | Bacteria | 3856 |
| 34 | Ga0070660_100005315 | 3300005339 | Bacteria | 8910 |
| 35 | Ga0070660_100006963 | 3300005339 | Bacteria | 7845 |
| 36 | Ga0070660_100010635 | 3300005339 | Bacteria | 6505 |
| 37 | Ga0070660_100017586 | 3300005339 | Bacteria | 5212 |
| 38 | Ga0070660_100027115 | 3300005339 | Bacteria | 4274 |
| 39 | Ga0070689_100001989 | 3300005340 | Bacteria | 13241 |
| 40 | Ga0070689_100004833 | 3300005340 | Bacteria | 9148 |
| 41 | Ga0070689_100019475 | 3300005340 | Bacteria | 5019 |
| 42 | Ga0070687_100024753 | 3300005343 | Bacteria | 2872 |
| 43 | Ga0070687_100051465 | 3300005343 | Bacteria | 2132 |
| 44 | Ga0070661_100002676 | 3300005344 | Bacteria | 12196 |
| 45 | Ga0070692_10003283 | 3300005345 | Bacteria | 6527 |
| 46 | Ga0070668_100012194 | 3300005347 | Bacteria | 6402 |
| 47 | Ga0070668_100016206 | 3300005347 | Bacteria | 5576 |
| 48 | Ga0070668_100023760 | 3300005347 | Bacteria | 4639 |
| 49 | Ga0070668_100081972 | 3300005347 | Bacteria | 2530 |
| 50 | Ga0070669_100001415 | 3300005353 | Bacteria | 17346 |
| 51 | Ga0070669_100030011 | 3300005353 | Bacteria | 3921 |
| 52 | Ga0070669_100053672 | 3300005353 | Bacteria | 2950 |
| 53 | Ga0070669_100068288 | 3300005353 | Bacteria | 2623 |
| 54 | Ga0070675_100002777 | 3300005354 | Bacteria | 13172 |
| 55 | Ga0070675_100004574 | 3300005354 | Bacteria | 10561 |
| 56 | Ga0070675_100017996 | 3300005354 | Bacteria | 5624 |
| 57 | Ga0070671_100010529 | 3300005355 | Bacteria | 7425 |
| 58 | Ga0070671_100025752 | 3300005355 | Bacteria | 4829 |
| 59 | Ga0070671_100038012 | 3300005355 | Bacteria | 3994 |
| 60 | Ga0070671_100064620 | 3300005355 | Bacteria | 3047 |
| 61 | Ga0070671_100080033 | 3300005355 | Bacteria | 2731 |
| 62 | Ga0070671_100085895 | 3300005355 | Bacteria | 2632 |
| 63 | Ga0070673_100000328 | 3300005364 | Bacteria | 24939 |
| 64 | Ga0070673_100001510 | 3300005364 | Bacteria | 13674 |
| 65 | Ga0070673_100015978 | 3300005364 | Bacteria | 5291 |
| 66 | Ga0070673_100051153 | 3300005364 | Bacteria | 3233 |
| 67 | Ga0070688_100001281 | 3300005365 | Bacteria | 12524 |
| 68 | Ga0070688_100008857 | 3300005365 | Bacteria | 5477 |
| 69 | Ga0070659_100000775 | 3300005366 | Bacteria | 23182 |
| 70 | Ga0070659_100008744 | 3300005366 | Bacteria | 7411 |
| 71 | Ga0070659_100011020 | 3300005366 | Bacteria | 6677 |
| 72 | Ga0070659_100013911 | 3300005366 | Bacteria | 6004 |
| 73 | Ga0070659_100053304 | 3300005366 | Bacteria | 3183 |
| 74 | Ga0070667_100002204 | 3300005367 | Bacteria | 17149 |
| 75 | Ga0070667_100010761 | 3300005367 | Bacteria | 7560 |
| 76 | Ga0070667_100011630 | 3300005367 | Bacteria | 7276 |
| 77 | Ga0070667_100050280 | 3300005367 | Bacteria | 3513 |
| 78 | Ga0070714_100023434 | 3300005435 | Bacteria | 5071 |
| 79 | Ga0070714_100105362 | 3300005435 | Bacteria | 2490 |
| 80 | Ga0070710_10010714 | 3300005437 | Bacteria | 4508 |
| 81 | Ga0070710_10051010 | 3300005437 | Bacteria | 2321 |
| 82 | Ga0070701_10011312 | 3300005438 | Bacteria | 3985 |
| 83 | Ga0070711_100002929 | 3300005439 | Bacteria | 9836 |
| 84 | Ga0070700_100000816 | 3300005441 | Bacteria | 15305 |
| 85 | Ga0070700_100012660 | 3300005441 | Bacteria | 4717 |
| 86 | Ga0070694_100009912 | 3300005444 | Bacteria | 5854 |
| 87 | Ga0070694_100075697 | 3300005444 | Bacteria | 2328 |
| 88 | Ga0070708_100005341 | 3300005445 | Bacteria | 10188 |
| 89 | Ga0070708_100050988 | 3300005445 | Bacteria | 3666 |
| 90 | Ga0070663_100018113 | 3300005455 | Bacteria | 4611 |
| 91 | Ga0070678_100001864 | 3300005456 | Bacteria | 11368 |
| 92 | Ga0070678_100003405 | 3300005456 | Bacteria | 8868 |
| 93 | Ga0070662_100006101 | 3300005457 | Bacteria | 7743 |
| 94 | Ga0070662_100029733 | 3300005457 | Bacteria | 3816 |
| 95 | Ga0070681_10001659 | 3300005458 | Bacteria | 19883 |
| 96 | Ga0070681_10009268 | 3300005458 | Bacteria | 9678 |
| 97 | Ga0068867_100001223 | 3300005459 | Bacteria | 17679 |
| 98 | Ga0068867_100002515 | 3300005459 | Bacteria | 12900 |
| 99 | Ga0068867_100002941 | 3300005459 | Bacteria | 11995 |
| 100 | Ga0068867_100011384 | 3300005459 | Bacteria | 6277 |
| 101 | Ga0068867_100013075 | 3300005459 | Bacteria | 5874 |
| 102 | Ga0068867_100018020 | 3300005459 | Bacteria | 5018 |
| 103 | Ga0068867_100018356 | 3300005459 | Bacteria | 4971 |
| 104 | Ga0068867_100054812 | 3300005459 | Bacteria | 2946 |
| 105 | Ga0068867_100079320 | 3300005459 | Bacteria | 2471 |
| 106 | Ga0070685_10002100 | 3300005466 | Bacteria | 10285 |
| 107 | Ga0070685_10007091 | 3300005466 | Bacteria | 5726 |
| 108 | Ga0070706_100012952 | 3300005467 | Bacteria | 7719 |
| 109 | Ga0070706_100019444 | 3300005467 | Bacteria | 6263 |
| 110 | Ga0070707_100057631 | 3300005468 | Bacteria | 3726 |
| 111 | Ga0070699_100010012 | 3300005518 | Bacteria | 8205 |
| 112 | Ga0070699_100032080 | 3300005518 | Bacteria | 4536 |
| 113 | Ga0070699_100045572 | 3300005518 | Bacteria | 3795 |
| 114 | Ga0070679_100081109 | 3300005530 | Bacteria | 3233 |
| 115 | Ga0070679_100117383 | 3300005530 | Bacteria | 2646 |
| 116 | Ga0070684_100008314 | 3300005535 | Bacteria | 8105 |
| 117 | Ga0070684_100013308 | 3300005535 | Bacteria | 6630 |
| 118 | Ga0070684_100024579 | 3300005535 | Bacteria | 5056 |
| 119 | Ga0070684_100024621 | 3300005535 | Bacteria | 5051 |
| 120 | Ga0070697_100001076 | 3300005536 | Bacteria | 20621 |
| 121 | Ga0070697_100058192 | 3300005536 | Bacteria | 3145 |
| 122 | Ga0068853_100031794 | 3300005539 | Bacteria | 4466 |
| 123 | Ga0070672_100000618 | 3300005543 | Bacteria | 20856 |
| 124 | Ga0070672_100001738 | 3300005543 | Bacteria | 13636 |
| 125 | Ga0070672_100010643 | 3300005543 | Bacteria | 6387 |
| 126 | Ga0070686_100007051 | 3300005544 | Bacteria | 6265 |
| 127 | Ga0070696_100009781 | 3300005546 | Bacteria | 6416 |
| 128 | Ga0070696_100084013 | 3300005546 | Bacteria | 2259 |
| 129 | Ga0070693_100000852 | 3300005547 | Bacteria | 13597 |
| 130 | Ga0070665_100002113 | 3300005548 | Bacteria | 22201 |
| 131 | Ga0070665_100016497 | 3300005548 | Bacteria | 7405 |
| 132 | Ga0070665_100016657 | 3300005548 | Bacteria | 7366 |
| 133 | Ga0070665_100020139 | 3300005548 | Bacteria | 6698 |
| 134 | Ga0070665_100032024 | 3300005548 | Bacteria | 5292 |
| 135 | Ga0070704_100106872 | 3300005549 | Bacteria | 2121 |
| 136 | Ga0068855_100002431 | 3300005563 | Bacteria | 22996 |
| 137 | Ga0068855_100026060 | 3300005563 | Bacteria | 6994 |
| 138 | Ga0068855_100138090 | 3300005563 | Bacteria | 2780 |
| 139 | Ga0070664_100000232 | 3300005564 | Bacteria | 39918 |
| 140 | Ga0070664_100002189 | 3300005564 | Bacteria | 15703 |
| 141 | Ga0070664_100006956 | 3300005564 | Bacteria | 9118 |
| 142 | Ga0068857_100000150 | 3300005577 | Bacteria | 43268 |
| 143 | Ga0068857_100003300 | 3300005577 | Bacteria | 13405 |
| 144 | Ga0068854_100003871 | 3300005578 | Bacteria | 9380 |
| 145 | Ga0068854_100036700 | 3300005578 | Bacteria | 3437 |
| 146 | Ga0068856_100000121 | 3300005614 | Bacteria | 78250 |
| 147 | Ga0068856_100015939 | 3300005614 | Bacteria | 7266 |
| 148 | Ga0068856_100022621 | 3300005614 | Bacteria | 6112 |
| 149 | Ga0068856_100063423 | 3300005614 | Bacteria | 3651 |
| 150 | Ga0068856_100076927 | 3300005614 | Bacteria | 3306 |
| 151 | Ga0070702_100004941 | 3300005615 | Bacteria | 6147 |
| 152 | Ga0068852_100002603 | 3300005616 | Bacteria | 12468 |
| 153 | Ga0068852_100002736 | 3300005616 | Bacteria | 12195 |
| 154 | Ga0068852_100023842 | 3300005616 | Bacteria | 4934 |
| 155 | Ga0068852_100154751 | 3300005616 | Bacteria | 2135 |
| 156 | Ga0068859_100005851 | 3300005617 | Bacteria | 12484 |
| 157 | Ga0068859_100007009 | 3300005617 | Bacteria | 11445 |
| 158 | Ga0068859_100011594 | 3300005617 | Bacteria | 8863 |
| 159 | Ga0068859_100018722 | 3300005617 | Bacteria | 6957 |
| 160 | Ga0068859_100080732 | 3300005617 | Bacteria | 3294 |
| 161 | Ga0068864_100001193 | 3300005618 | Bacteria | 21567 |
| 162 | Ga0068864_100002176 | 3300005618 | Bacteria | 16182 |
| 163 | Ga0068864_100004662 | 3300005618 | Bacteria | 11247 |
| 164 | Ga0068864_100021514 | 3300005618 | Bacteria | 5402 |
| 165 | Ga0068864_100021805 | 3300005618 | Bacteria | 5367 |
| 166 | Ga0068864_100059736 | 3300005618 | Bacteria | 3299 |
| 167 | Ga0068866_10001297 | 3300005718 | Bacteria | 10818 |
| 168 | Ga0068861_100012072 | 3300005719 | Bacteria | 6020 |
| 169 | Ga0068861_100048238 | 3300005719 | Bacteria | 3218 |
| 170 | Ga0068861_100087357 | 3300005719 | Bacteria | 2454 |
| 171 | Ga0068851_10005887 | 3300005834 | Bacteria | 5581 |
| 172 | Ga0068851_10006428 | 3300005834 | Bacteria | 5364 |
| 173 | Ga0068851_10024417 | 3300005834 | Bacteria | 2959 |
| 174 | Ga0068870_10001159 | 3300005840 | Bacteria | 10552 |
| 175 | Ga0068870_10006298 | 3300005840 | Bacteria | 5225 |
| 176 | Ga0068863_100005071 | 3300005841 | Bacteria | 12992 |
| 177 | Ga0068863_100022555 | 3300005841 | Bacteria | 6011 |
| 178 | Ga0068863_100024596 | 3300005841 | Bacteria | 5743 |
| 179 | Ga0068863_100031853 | 3300005841 | Bacteria | 5029 |
| 180 | Ga0068863_100032443 | 3300005841 | Bacteria | 4979 |
| 181 | Ga0068863_100076062 | 3300005841 | Bacteria | 3176 |
| 182 | Ga0068858_100002706 | 3300005842 | Bacteria | 17873 |
| 183 | Ga0068858_100007231 | 3300005842 | Bacteria | 10759 |
| 184 | Ga0068858_100009634 | 3300005842 | Bacteria | 9206 |
| 185 | Ga0068858_100011839 | 3300005842 | Bacteria | 8224 |
| 186 | Ga0068858_100021920 | 3300005842 | Bacteria | 5966 |
| 187 | Ga0068860_100006037 | 3300005843 | Bacteria | 12190 |
| 188 | Ga0068860_100011798 | 3300005843 | Bacteria | 8612 |
| 189 | Ga0068860_100035111 | 3300005843 | Bacteria | 4811 |
| 190 | Ga0068860_100036564 | 3300005843 | Bacteria | 4704 |
| 191 | Ga0068860_100041400 | 3300005843 | Bacteria | 4400 |
| 192 | Ga0068862_100008440 | 3300005844 | Bacteria | 8522 |
| 193 | Ga0068862_100016512 | 3300005844 | Bacteria | 6145 |
| 194 | Ga0068862_100030923 | 3300005844 | Bacteria | 4514 |
| 195 | Ga0068862_100092767 | 3300005844 | Bacteria | 2632 |
| 196 | Ga0075364_10007219 | 3300006051 | Bacteria | 6584 |
| 197 | Ga0070716_100012828 | 3300006173 | Bacteria | 4258 |
| 198 | Ga0097621_100004231 | 3300006237 | Bacteria | 9970 |
| 199 | Ga0097621_100005472 | 3300006237 | Bacteria | 8942 |
| 200 | Ga0097621_100069324 | 3300006237 | Bacteria | 2912 |
| 201 | Ga0068871_100003356 | 3300006358 | Bacteria | 11001 |
| 202 | Ga0068871_100006707 | 3300006358 | Bacteria | 8171 |
| 203 | Ga0068871_100057683 | 3300006358 | Bacteria | 3159 |
| 204 | Ga0075428_100004485 | 3300006844 | Bacteria | 15412 |
| 205 | Ga0075428_100030014 | 3300006844 | Bacteria | 6014 |
| 206 | Ga0075430_100012772 | 3300006846 | Bacteria | 7154 |
| 207 | Ga0075430_100079425 | 3300006846 | Bacteria | 2749 |
| 208 | Ga0075431_100064476 | 3300006847 | Bacteria | 3782 |
| 209 | Ga0075434_100027426 | 3300006871 | Bacteria | 5592 |
| 210 | Ga0075434_100075710 | 3300006871 | Bacteria | 3360 |
| 211 | Ga0075429_100013978 | 3300006880 | Bacteria | 6958 |
| 212 | Ga0068865_100000771 | 3300006881 | Bacteria | 17955 |
| 213 | Ga0068865_100041607 | 3300006881 | Bacteria | 3128 |
| 214 | Ga0075436_100038245 | 3300006914 | Bacteria | 3312 |
| 215 | Ga0097620_100005851 | 3300006931 | Bacteria | 12484 |
| 216 | Ga0097620_100007009 | 3300006931 | Bacteria | 11445 |
| 217 | Ga0097620_100011595 | 3300006931 | Bacteria | 8863 |
| 218 | Ga0097620_100018724 | 3300006931 | Bacteria | 6957 |
| 219 | Ga0097620_100080730 | 3300006931 | Bacteria | 3294 |
| 220 | Ga0075435_100006293 | 3300007076 | Bacteria | 8384 |
| 221 | Ga0105240_10012137 | 3300009093 | Bacteria | 11926 |
| 222 | Ga0105240_10113589 | 3300009093 | Bacteria | 3273 |
| 223 | Ga0111539_10019136 | 3300009094 | Bacteria | 8460 |
| 224 | Ga0111539_10036136 | 3300009094 | Bacteria | 5976 |
| 225 | Ga0111539_10162687 | 3300009094 | Bacteria | 2610 |
| 226 | Ga0105245_10100379 | 3300009098 | Bacteria | 2677 |
| 227 | Ga0105243_10050726 | 3300009148 | Bacteria | 3279 |
| 228 | Ga0105242_10018528 | 3300009176 | Bacteria | 5445 |
| 229 | Ga0105248_10001255 | 3300009177 | Bacteria | 28351 |
| 230 | Ga0105248_10008807 | 3300009177 | Bacteria | 11084 |
| 231 | Ga0105248_10018851 | 3300009177 | Bacteria | 7633 |
| 232 | Ga0105248_10031606 | 3300009177 | Bacteria | 5915 |
| 233 | Ga0105248_10066758 | 3300009177 | Bacteria | 4039 |
| 234 | Ga0105248_10151969 | 3300009177 | Bacteria | 2612 |
| 235 | Ga0105237_10031857 | 3300009545 | Bacteria | 5340 |
| 236 | Ga0105237_10051202 | 3300009545 | Bacteria | 4148 |
| 237 | Ga0105238_10004955 | 3300009551 | Bacteria | 13167 |
| 238 | Ga0105238_10015758 | 3300009551 | Bacteria | 7653 |
| 239 | Ga0105249_10042235 | 3300009553 | Bacteria | 4146 |
| 240 | Ga0105239_10016466 | 3300010375 | Bacteria | 8176 |
| 241 | Ga0105246_10052817 | 3300011119 | Bacteria | 2794 |
| 242 | Ga0157373_10000313 | 3300013100 | Bacteria | 39072 |
| 243 | Ga0157373_10011974 | 3300013100 | Bacteria | 6373 |
| 244 | Ga0157373_10034594 | 3300013100 | Bacteria | 3629 |
| 245 | Ga0157373_10044324 | 3300013100 | Bacteria | 3176 |
| 246 | Ga0157371_10001031 | 3300013102 | Bacteria | 30547 |
| 247 | Ga0157371_10056458 | 3300013102 | Bacteria | 2785 |
| 248 | Ga0157370_10002415 | 3300013104 | Bacteria | 22519 |
| 249 | Ga0157370_10007816 | 3300013104 | Bacteria | 11585 |
| 250 | Ga0157369_10010212 | 3300013105 | Bacteria | 10714 |
| 251 | Ga0157369_10010469 | 3300013105 | Bacteria | 10564 |
| 252 | Ga0157369_10071836 | 3300013105 | Bacteria | 3714 |
| 253 | Ga0157374_10001173 | 3300013296 | Bacteria | 22360 |
| 254 | Ga0157374_10005247 | 3300013296 | Bacteria | 10871 |
| 255 | Ga0157374_10016090 | 3300013296 | Bacteria | 6572 |
| 256 | Ga0163162_10005104 | 3300013306 | Bacteria | 12654 |
| 257 | Ga0163162_10063648 | 3300013306 | Bacteria | 3732 |
| 258 | Ga0157372_10000985 | 3300013307 | Bacteria | 31124 |
| 259 | Ga0157372_10188223 | 3300013307 | Bacteria | 2390 |
| 260 | Ga0157375_10006967 | 3300013308 | Bacteria | 9870 |
| 261 | Ga0157375_10008337 | 3300013308 | Bacteria | 9077 |
| 262 | Ga0157375_10012590 | 3300013308 | Bacteria | 7506 |
| 263 | Ga0157375_10060360 | 3300013308 | Bacteria | 3760 |
| 264 | Ga0163163_10004614 | 3300014325 | Bacteria | 11764 |
| 265 | Ga0163163_10041598 | 3300014325 | Bacteria | 4495 |
| 266 | Ga0163163_10055514 | 3300014325 | Bacteria | 3915 |
| 267 | Ga0157380_10005087 | 3300014326 | Bacteria | 9182 |
| 268 | Ga0157380_10056113 | 3300014326 | Bacteria | 3131 |
| 269 | Ga0157377_10004602 | 3300014745 | Bacteria | 6375 |
| 270 | Ga0157377_10010593 | 3300014745 | Bacteria | 4566 |
| 271 | Ga0157379_10005995 | 3300014968 | Bacteria | 10476 |
| 272 | Ga0157379_10012613 | 3300014968 | Bacteria | 7382 |
| 273 | Ga0157379_10049691 | 3300014968 | Bacteria | 3745 |
| 274 | Ga0163161_10050562 | 3300017792 | Bacteria | 3009 |
| 275 | Ga0207666_1000621 | 3300025271 | Bacteria | 4246 |
| 276 | Ga0207656_10006766 | 3300025321 | Bacteria | 4143 |
| 277 | Ga0207682_10000731 | 3300025893 | Bacteria | 15253 |
| 278 | Ga0207682_10001222 | 3300025893 | Bacteria | 11869 |
| 279 | Ga0207692_10022429 | 3300025898 | Bacteria | 2905 |
| 280 | Ga0207642_10024351 | 3300025899 | Bacteria | 2432 |
| 281 | Ga0207680_10021684 | 3300025903 | Bacteria | 3479 |
| 282 | Ga0207645_10000530 | 3300025907 | Bacteria | 31705 |
| 283 | Ga0207645_10003858 | 3300025907 | Bacteria | 11218 |
| 284 | Ga0207645_10038996 | 3300025907 | Bacteria | 3044 |
| 285 | Ga0207643_10000267 | 3300025908 | Bacteria | 36372 |
| 286 | Ga0207643_10005162 | 3300025908 | Bacteria | 6986 |
| 287 | Ga0207643_10009075 | 3300025908 | Bacteria | 5341 |
| 288 | Ga0207684_10041819 | 3300025910 | Bacteria | 3884 |
| 289 | Ga0207707_10002904 | 3300025912 | Bacteria | 15285 |
| 290 | Ga0207707_10050499 | 3300025912 | Bacteria | 3622 |
| 291 | Ga0207695_10011566 | 3300025913 | Bacteria | 10677 |
| 292 | Ga0207695_10030233 | 3300025913 | Bacteria | 5966 |
| 293 | Ga0207693_10000463 | 3300025915 | Bacteria | 37141 |
| 294 | Ga0207693_10008943 | 3300025915 | Bacteria | 8174 |
| 295 | Ga0207663_10011310 | 3300025916 | Bacteria | 4790 |
| 296 | Ga0207662_10006514 | 3300025918 | Bacteria | 6308 |
| 297 | Ga0207657_10000995 | 3300025919 | Bacteria | 30092 |
| 298 | Ga0207657_10002776 | 3300025919 | Bacteria | 18862 |
| 299 | Ga0207657_10009229 | 3300025919 | Bacteria | 9942 |
| 300 | Ga0207657_10012006 | 3300025919 | Bacteria | 8567 |
| 301 | Ga0207657_10023022 | 3300025919 | Bacteria | 5812 |
| 302 | Ga0207657_10026962 | 3300025919 | Bacteria | 5269 |
| 303 | Ga0207649_10001599 | 3300025920 | Bacteria | 13166 |
| 304 | Ga0207649_10010084 | 3300025920 | Bacteria | 5183 |
| 305 | Ga0207649_10021813 | 3300025920 | Bacteria | 3694 |
| 306 | Ga0207652_10159770 | 3300025921 | Bacteria | 2020 |
| 307 | Ga0207646_10062759 | 3300025922 | Bacteria | 3317 |
| 308 | Ga0207681_10009034 | 3300025923 | Bacteria | 6090 |
| 309 | Ga0207681_10016081 | 3300025923 | Bacteria | 4674 |
| 310 | Ga0207681_10045524 | 3300025923 | Bacteria | 2946 |
| 311 | Ga0207694_10006116 | 3300025924 | Bacteria | 9202 |
| 312 | Ga0207694_10045922 | 3300025924 | Bacteria | 3375 |
| 313 | Ga0207650_10002076 | 3300025925 | Bacteria | 14007 |
| 314 | Ga0207650_10005770 | 3300025925 | Bacteria | 8447 |
| 315 | Ga0207650_10032028 | 3300025925 | Bacteria | 3802 |
| 316 | Ga0207650_10034011 | 3300025925 | Bacteria | 3695 |
| 317 | Ga0207650_10050188 | 3300025925 | Bacteria | 3084 |
| 318 | Ga0207659_10001980 | 3300025926 | Bacteria | 12118 |
| 319 | Ga0207659_10005968 | 3300025926 | Bacteria | 7430 |
| 320 | Ga0207659_10019297 | 3300025926 | Bacteria | 4485 |
| 321 | Ga0207687_10040418 | 3300025927 | Bacteria | 3197 |
| 322 | Ga0207687_10041232 | 3300025927 | Bacteria | 3168 |
| 323 | Ga0207700_10000455 | 3300025928 | Bacteria | 23974 |
| 324 | Ga0207664_10004425 | 3300025929 | Bacteria | 9514 |
| 325 | Ga0207644_10003838 | 3300025931 | Bacteria | 9735 |
| 326 | Ga0207644_10004473 | 3300025931 | Bacteria | 9078 |
| 327 | Ga0207644_10024466 | 3300025931 | Bacteria | 4146 |
| 328 | Ga0207644_10026764 | 3300025931 | Bacteria | 3978 |
| 329 | Ga0207644_10042633 | 3300025931 | Bacteria | 3217 |
| 330 | Ga0207644_10051893 | 3300025931 | Bacteria | 2945 |
| 331 | Ga0207690_10002015 | 3300025932 | Bacteria | 12446 |
| 332 | Ga0207690_10002295 | 3300025932 | Bacteria | 11669 |
| 333 | Ga0207706_10000644 | 3300025933 | Bacteria | 37010 |
| 334 | Ga0207706_10077626 | 3300025933 | Bacteria | 2921 |
| 335 | Ga0207686_10000801 | 3300025934 | Bacteria | 19297 |
| 336 | Ga0207670_10019328 | 3300025936 | Bacteria | 4160 |
| 337 | Ga0207670_10023141 | 3300025936 | Bacteria | 3862 |
| 338 | Ga0207669_10000673 | 3300025937 | Bacteria | 14737 |
| 339 | Ga0207669_10001618 | 3300025937 | Bacteria | 9580 |
| 340 | Ga0207704_10019351 | 3300025938 | Bacteria | 3573 |
| 341 | Ga0207665_10016045 | 3300025939 | Bacteria | 4919 |
| 342 | Ga0207665_10031471 | 3300025939 | Bacteria | 3511 |
| 343 | Ga0207665_10032101 | 3300025939 | Bacteria | 3477 |
| 344 | Ga0207691_10001011 | 3300025940 | Bacteria | 27902 |
| 345 | Ga0207691_10002116 | 3300025940 | Bacteria | 19416 |
| 346 | Ga0207691_10006226 | 3300025940 | Bacteria | 11526 |
| 347 | Ga0207691_10007167 | 3300025940 | Bacteria | 10755 |
| 348 | Ga0207691_10012143 | 3300025940 | Bacteria | 8257 |
| 349 | Ga0207691_10028978 | 3300025940 | Bacteria | 5181 |
| 350 | Ga0207711_10005307 | 3300025941 | Bacteria | 10928 |
| 351 | Ga0207711_10023132 | 3300025941 | Bacteria | 5202 |
| 352 | Ga0207711_10028179 | 3300025941 | Bacteria | 4725 |
| 353 | Ga0207711_10055165 | 3300025941 | Bacteria | 3412 |
| 354 | Ga0207711_10065246 | 3300025941 | Bacteria | 3147 |
| 355 | Ga0207689_10000003 | 3300025942 | Bacteria | 175710 |
| 356 | Ga0207689_10001031 | 3300025942 | Bacteria | 26750 |
| 357 | Ga0207689_10001154 | 3300025942 | Bacteria | 25407 |
| 358 | Ga0207689_10007164 | 3300025942 | Bacteria | 9806 |
| 359 | Ga0207689_10015645 | 3300025942 | Bacteria | 6425 |
| 360 | Ga0207689_10103523 | 3300025942 | Bacteria | 2339 |
| 361 | Ga0207661_10020377 | 3300025944 | Bacteria | 4956 |
| 362 | Ga0207661_10035846 | 3300025944 | Bacteria | 3869 |
| 363 | Ga0207661_10097371 | 3300025944 | Bacteria | 2463 |
| 364 | Ga0207679_10006231 | 3300025945 | Bacteria | 7528 |
| 365 | Ga0207679_10014817 | 3300025945 | Bacteria | 5136 |
| 366 | Ga0207679_10018627 | 3300025945 | Bacteria | 4655 |
| 367 | Ga0207679_10072490 | 3300025945 | Bacteria | 2602 |
| 368 | Ga0207679_10094338 | 3300025945 | Bacteria | 2323 |
| 369 | Ga0207667_10001918 | 3300025949 | Bacteria | 26099 |
| 370 | Ga0207667_10003456 | 3300025949 | Bacteria | 19506 |
| 371 | Ga0207667_10009543 | 3300025949 | Bacteria | 11419 |
| 372 | Ga0207667_10087203 | 3300025949 | Bacteria | 3229 |
| 373 | Ga0207651_10003339 | 3300025960 | Bacteria | 7869 |
| 374 | Ga0207651_10008658 | 3300025960 | Bacteria | 5511 |
| 375 | Ga0207651_10020462 | 3300025960 | Bacteria | 3994 |
| 376 | Ga0207651_10033189 | 3300025960 | Bacteria | 3326 |
| 377 | Ga0207712_10077270 | 3300025961 | Bacteria | 2412 |
| 378 | Ga0207668_10022978 | 3300025972 | Bacteria | 3999 |
| 379 | Ga0207668_10079527 | 3300025972 | Bacteria | 2372 |
| 380 | Ga0207640_10022374 | 3300025981 | Bacteria | 3782 |
| 381 | Ga0207658_10002303 | 3300025986 | Bacteria | 14092 |
| 382 | Ga0207658_10005483 | 3300025986 | Bacteria | 8699 |
| 383 | Ga0207658_10035829 | 3300025986 | Bacteria | 3555 |
| 384 | Ga0207677_10004244 | 3300026023 | Bacteria | 7673 |
| 385 | Ga0207677_10015778 | 3300026023 | Bacteria | 4455 |
| 386 | Ga0207703_10000987 | 3300026035 | Bacteria | 27412 |
| 387 | Ga0207703_10006351 | 3300026035 | Bacteria | 9447 |
| 388 | Ga0207703_10021728 | 3300026035 | Bacteria | 5024 |
| 389 | Ga0207703_10029206 | 3300026035 | Bacteria | 4349 |
| 390 | Ga0207703_10062643 | 3300026035 | Bacteria | 3047 |
| 391 | Ga0207703_10071744 | 3300026035 | Bacteria | 2861 |
| 392 | Ga0207639_10087382 | 3300026041 | Bacteria | 2485 |
| 393 | Ga0207678_10002008 | 3300026067 | Bacteria | 18521 |
| 394 | Ga0207678_10005363 | 3300026067 | Bacteria | 11483 |
| 395 | Ga0207708_10002136 | 3300026075 | Bacteria | 14580 |
| 396 | Ga0207708_10013301 | 3300026075 | Bacteria | 6146 |
| 397 | Ga0207708_10013971 | 3300026075 | Bacteria | 5997 |
| 398 | Ga0207702_10001823 | 3300026078 | Bacteria | 20970 |
| 399 | Ga0207702_10001905 | 3300026078 | Bacteria | 20378 |
| 400 | Ga0207702_10002122 | 3300026078 | Bacteria | 19074 |
| 401 | Ga0207702_10004335 | 3300026078 | Bacteria | 12656 |
| 402 | Ga0207702_10013792 | 3300026078 | Bacteria | 6712 |
| 403 | Ga0207641_10001517 | 3300026088 | Bacteria | 22764 |
| 404 | Ga0207641_10001847 | 3300026088 | Bacteria | 20340 |
| 405 | Ga0207641_10004700 | 3300026088 | Bacteria | 11774 |
| 406 | Ga0207641_10044037 | 3300026088 | Bacteria | 3751 |
| 407 | Ga0207648_10000126 | 3300026089 | Bacteria | 75403 |
| 408 | Ga0207648_10000442 | 3300026089 | Bacteria | 45913 |
| 409 | Ga0207648_10000589 | 3300026089 | Bacteria | 40773 |
| 410 | Ga0207648_10007227 | 3300026089 | Bacteria | 10946 |
| 411 | Ga0207648_10010389 | 3300026089 | Bacteria | 8825 |
| 412 | Ga0207648_10035320 | 3300026089 | Bacteria | 4404 |
| 413 | Ga0207648_10040242 | 3300026089 | Bacteria | 4108 |
| 414 | Ga0207648_10043114 | 3300026089 | Bacteria | 3962 |
| 415 | Ga0207648_10056959 | 3300026089 | Bacteria | 3410 |
| 416 | Ga0207648_10082231 | 3300026089 | Bacteria | 2808 |
| 417 | Ga0207676_10000377 | 3300026095 | Bacteria | 37930 |
| 418 | Ga0207676_10011120 | 3300026095 | Bacteria | 6425 |
| 419 | Ga0207676_10022772 | 3300026095 | Bacteria | 4611 |
| 420 | Ga0207676_10032647 | 3300026095 | Bacteria | 3925 |
| 421 | Ga0207674_10000369 | 3300026116 | Bacteria | 58569 |
| 422 | Ga0207674_10003357 | 3300026116 | Bacteria | 19642 |
| 423 | Ga0207674_10019115 | 3300026116 | Bacteria | 7426 |
| 424 | Ga0207674_10038883 | 3300026116 | Bacteria | 4935 |
| 425 | Ga0207674_10063978 | 3300026116 | Bacteria | 3711 |
| 426 | Ga0207674_10128471 | 3300026116 | Bacteria | 2499 |
| 427 | Ga0207675_100002550 | 3300026118 | Bacteria | 18032 |
| 428 | Ga0207675_100003777 | 3300026118 | Bacteria | 14745 |
| 429 | Ga0207675_100028188 | 3300026118 | Bacteria | 5229 |
| 430 | Ga0207675_100062447 | 3300026118 | Bacteria | 3479 |
| 431 | Ga0207683_10000144 | 3300026121 | Bacteria | 59196 |
| 432 | Ga0207683_10000959 | 3300026121 | Bacteria | 26436 |
| 433 | Ga0207683_10004945 | 3300026121 | Bacteria | 11466 |
| 434 | Ga0207683_10008777 | 3300026121 | Bacteria | 8631 |
| 435 | Ga0207698_10002438 | 3300026142 | Bacteria | 11017 |
| 436 | Ga0207698_10012550 | 3300026142 | Bacteria | 5551 |
| 437 | Ga0207698_10113170 | 3300026142 | Bacteria | 2279 |
| 438 | Ga0209996_1002046 | 3300027395 | Bacteria | 2485 |
| 439 | Ga0209998_10003871 | 3300027717 | Bacteria | 3233 |
| 440 | Ga0209974_10000366 | 3300027876 | Bacteria | 14899 |
| 441 | Ga0207428_10018006 | 3300027907 | Bacteria | 6050 |
| 442 | Ga0268266_10010702 | 3300028379 | Bacteria | 7993 |
| 443 | Ga0268266_10041724 | 3300028379 | Bacteria | 3916 |
| 444 | Ga0268265_10000628 | 3300028380 | Bacteria | 35160 |
| 445 | Ga0268265_10002348 | 3300028380 | Bacteria | 14344 |
| 446 | Ga0268265_10009770 | 3300028380 | Bacteria | 6478 |
| 447 | Ga0268265_10043250 | 3300028380 | Bacteria | 3347 |
| 448 | Ga0268265_10083710 | 3300028380 | Bacteria | 2527 |
| 449 | Ga0268265_10134039 | 3300028380 | Bacteria | 2063 |
| 450 | Ga0268264_10001089 | 3300028381 | Bacteria | 26866 |
| 451 | Ga0268264_10011904 | 3300028381 | Bacteria | 7166 |
| 452 | Ga0268264_10073830 | 3300028381 | Bacteria | 2896 |
| 453 | Ga0268264_10116712 | 3300028381 | Bacteria | 2347 |
| 454 | Ga0265330_10002161 | 3300031235 | Bacteria | 10831 |
| 455 | Ga0265332_10000004 | 3300031238 | Bacteria | 426592 |
| 456 | Ga0265332_10000284 | 3300031238 | Bacteria | 39799 |
| 457 | Ga0265329_10009102 | 3300031242 | Bacteria | 3723 |
| 458 | Ga0265331_10000415 | 3300031250 | Bacteria | 43326 |
| 459 | Ga0265327_10002711 | 3300031251 | Bacteria | 18137 |
| 460 | Ga0265316_10011426 | 3300031344 | Bacteria | 8009 |
| 461 | Ga0307509_10000105 | 3300031507 | Bacteria | 119065 |
| 462 | Ga0307408_100025686 | 3300031548 | Bacteria | 4036 |
| 463 | Ga0316575_10008484 | 3300031665 | Bacteria | 3745 |
| 464 | Ga0265314_10003685 | 3300031711 | Bacteria | 14694 |
| 465 | Ga0265314_10042093 | 3300031711 | Bacteria | 3262 |
| 466 | Ga0307405_10009760 | 3300031731 | Bacteria | 4936 |
| 467 | Ga0307405_10017861 | 3300031731 | Bacteria | 3902 |
| 468 | Ga0307413_10003113 | 3300031824 | Bacteria | 6910 |
| 469 | Ga0307410_10000921 | 3300031852 | Bacteria | 12567 |
| 470 | Ga0307410_10004177 | 3300031852 | Bacteria | 7413 |
| 471 | Ga0307406_10006332 | 3300031901 | Bacteria | 6531 |
| 472 | Ga0307406_10010231 | 3300031901 | Bacteria | 5286 |
| 473 | Ga0307407_10002346 | 3300031903 | Bacteria | 7371 |
| 474 | Ga0307412_10014385 | 3300031911 | Bacteria | 4665 |
| 475 | Ga0307409_100014278 | 3300031995 | Bacteria | 5157 |
| 476 | Ga0307416_100008070 | 3300032002 | Bacteria | 6750 |
| 477 | Ga0307416_100011450 | 3300032002 | Bacteria | 5917 |
| 478 | Ga0307411_10026945 | 3300032005 | Bacteria | 3468 |
| 479 | Ga0307415_100008244 | 3300032126 | Bacteria | 5766 |
| 480 | Ga0373934_0000397 | 3300035086 | Bacteria | 15147 |
| 481 | Ga0373934_0004935 | 3300035086 | Bacteria | 4940 |
| 482 | Ga0373923_0007265 | 3300035111 | Bacteria | 3887 |
| 483 | Ga0373953_0000890 | 3300035117 | Bacteria | 8362 |
| 484 | Ga0373953_0027741 | 3300035117 | Bacteria | 2178 |
| 485 | Ga0373954_0000772 | 3300035118 | Bacteria | 12332 |
| 486 | Ga0373956_0000018 | 3300035119 | Bacteria | 50671 |
| 487 | Ga0373956_0002888 | 3300035119 | Bacteria | 6954 |
| 488 | Ga0373946_0021851 | 3300035171 | Bacteria | 2485 |
| 489 | Ga0316574_0009848 | 3300035398 | Bacteria | 5373 |
| 490 | Ga0373924_0006554 | 3300035410 | Bacteria | 4175 |
| 491 | Ga0373931_0057809 | 3300035691 | Bacteria | 2081 |
| 492 | Ga0373927_0010190 | 3300035695 | Bacteria | 6282 |
| 493 | Ga0373933_0000035 | 3300035724 | Bacteria | 82702 |
| 494 | Ga0373937_0048405 | 3300036401 | Bacteria | 3891 |
| 495 | Ga0373937_0095074 | 3300036401 | Bacteria | 2763 |
| 496 | Ga0373937_0102952 | 3300036401 | Bacteria | 2651 |
| 497 | Ga0395900_0067298 | 3300037418 | Bacteria | 3680 |
| 498 | Ga0439441_000155 | 3300042001 | Bacteria | 5942 |
| 499 | Ga0439435_0002367 | 3300042436 | Bacteria | 3727 |
| 500 | Ga0439444_0002677 | 3300042437 | Bacteria | 2459 |
| 501 | Ga0439460_0000735 | 3300042461 | Bacteria | 7333 |
| 502 | Ga0453683_0085703 | 3300044673 | Bacteria | 1974 |
| 503 | Ga0453684_0000331 | 3300044712 | Bacteria | 197952 |
| 504 | Ga0451576_0014607 | 3300045051 | Bacteria | 8729 |
| 505 | Ga0466967_0002332 | 3300045976 | Bacteria | 11744 |
| 506 | Ga0495629_0062757 | 3300046459 | Bacteria | 2595 |
| 507 | Ga0495651_0008636 | 3300046462 | Bacteria | 7813 |
| 508 | Ga0495582_0006387 | 3300046473 | Bacteria | 6551 |
| 509 | Ga0495639_0010997 | 3300046475 | Bacteria | 3897 |
| 510 | Ga0495639_0047009 | 3300046475 | Bacteria | 1954 |
| 511 | Ga0495662_0011055 | 3300046476 | Bacteria | 4413 |
| 512 | Ga0495628_0018175 | 3300046516 | Bacteria | 5830 |
| 513 | Ga0495630_0004891 | 3300046517 | Bacteria | 9413 |
| 514 | Ga0495665_0002238 | 3300046531 | Bacteria | 10474 |
| 515 | Ga0495633_0006065 | 3300046558 | Bacteria | 7246 |
| 516 | Ga0495634_0090566 | 3300046642 | Bacteria | 1986 |
| 517 | Ga0495635_0019989 | 3300046663 | Bacteria | 4666 |
| 518 | Ga0495657_0053334 | 3300046675 | Bacteria | 2706 |
| 519 | Ga0495623_0021169 | 3300046679 | Bacteria | 4202 |
| 520 | Ga0495647_0010361 | 3300046681 | Bacteria | 3171 |
| 521 | Ga0495658_0020909 | 3300046683 | Bacteria | 3443 |
| 522 | Ga0495613_0009879 | 3300046689 | Bacteria | 7094 |
| 523 | Ga0495613_0048397 | 3300046689 | Bacteria | 3139 |
| 524 | Ga0495600_0007282 | 3300046809 | Bacteria | 6759 |
| 525 | Ga0495600_0052366 | 3300046809 | Bacteria | 2665 |
| 526 | Ga0495674_0008982 | 3300047319 | Bacteria | 9496 |
| 527 | Ga0495675_0006190 | 3300047444 | Bacteria | 7323 |
| 528 | Ga0495593_0043140 | 3300047673 | Bacteria | 2419 |
| 529 | Ga0496100_0021004 | 3300048903 | Bacteria | 3925 |
| 530 | Ga0496100_0046877 | 3300048903 | Bacteria | 2782 |
| 531 | Ga0496101_0009002 | 3300048904 | Bacteria | 6545 |
| 532 | Ga0496101_0083339 | 3300048904 | Bacteria | 2367 |
| 533 | Ga0496102_0002745 | 3300048905 | Bacteria | 15008 |
| 534 | Ga0496102_0010791 | 3300048905 | Bacteria | 7868 |
| 535 | Ga0496102_0013617 | 3300048905 | Bacteria | 7050 |
| 536 | Ga0496103_0010149 | 3300048906 | Bacteria | 5569 |
| 537 | Ga0496104_0011927 | 3300048907 | Bacteria | 7796 |
| 538 | Ga0496105_0012325 | 3300048908 | Bacteria | 6769 |
| 539 | Ga0496106_0002746 | 3300048909 | Bacteria | 13028 |
| 540 | Ga0496106_0037319 | 3300048909 | Bacteria | 3635 |
| 541 | Ga0496107_0014219 | 3300048910 | Bacteria | 5573 |
| 542 | Ga0496107_0015023 | 3300048910 | Bacteria | 5424 |
| 543 | Ga0496108_0021197 | 3300048911 | Bacteria | 5341 |
| 544 | Ga0496108_0047549 | 3300048911 | Bacteria | 3586 |
| 545 | Ga0496109_0003042 | 3300048912 | Bacteria | 13979 |
| 546 | Ga0496109_0077449 | 3300048912 | Bacteria | 3060 |
| 547 | Ga0496112_0001624 | 3300048915 | Bacteria | 17413 |
| 548 | Ga0496112_0094268 | 3300048915 | Bacteria | 2964 |
| 549 | Ga0496114_0013013 | 3300048917 | Bacteria | 6667 |
| 550 | Ga0496114_0045159 | 3300048917 | Bacteria | 3659 |
| 551 | Ga0496115_0109956 | 3300048918 | Bacteria | 2264 |
| 552 | Ga0501038_0055372 | 3300049574 | Bacteria | 3407 |
| 553 | Ga0501039_0008726 | 3300049575 | Bacteria | 7719 |
| 554 | Ga0501041_0010354 | 3300049577 | Bacteria | 5495 |
| 555 | Ga0501041_0010484 | 3300049577 | Bacteria | 5461 |
| 556 | Ga0501043_0000058 | 3300049579 | Bacteria | 102030 |
| 557 | Ga0501046_0000051 | 3300049580 | Bacteria | 133545 |
| 558 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 559 | Ga0501048_0001376 | 3300049582 | Bacteria | 18399 |
| 560 | Ga0501070_0021699 | 3300049586 | Bacteria | 5384 |
| 561 | Ga0501071_0050555 | 3300049587 | Bacteria | 2994 |
| 562 | Ga0501072_0024456 | 3300049588 | Bacteria | 4698 |
| 563 | Ga0501074_0005875 | 3300049590 | Bacteria | 8851 |
| 564 | Ga0501075_0005228 | 3300049591 | Bacteria | 8872 |
| 565 | Ga0501075_0067172 | 3300049591 | Bacteria | 2707 |
| 566 | Ga0501076_0001236 | 3300049592 | Bacteria | 17015 |
| 567 | Ga0501076_0005353 | 3300049592 | Bacteria | 9216 |
| 568 | Ga0501077_0012008 | 3300049593 | Bacteria | 5421 |
| 569 | Ga0501079_0085213 | 3300049741 | Bacteria | 2445 |
| 570 | Ga0501081_0014871 | 3300049743 | Bacteria | 5134 |
| 571 | Ga0501045_0032958 | 3300049824 | Bacteria | 3755 |
| 572 | Ga0501045_0085770 | 3300049824 | Bacteria | 2324 |
| 573 | nmdc:mga00v17_12012_c1 | 3300050491 | Bacteria | 4767 |
| 574 | nmdc:mga09592_26986_c2 | 3300050508 | Bacteria | 3194 |
| 575 | nmdc:mga09592_2820_c1 | 3300050508 | Bacteria | 14086 |
| 576 | nmdc:mga0qj67_15349_c1 | 3300050509 | Bacteria | 5800 |
| 577 | nmdc:mga06r32_66281_c1 | 3300050510 | Bacteria | 3484 |
| 578 | nmdc:mga08y16_21040_c1 | 3300050511 | Bacteria | 6888 |
| 579 | nmdc:mga08y16_90495_c1 | 3300050511 | Bacteria | 3190 |
| 580 | nmdc:mga0n895_118898_c1 | 3300050512 | Bacteria | 2663 |
| 581 | nmdc:mga0n895_21867_c1 | 3300050512 | Bacteria | 5989 |
| 582 | nmdc:mga0n895_24771_c1 | 3300050512 | Bacteria | 5659 |
| 583 | nmdc:mga0rr50_35512_c1 | 3300050513 | Bacteria | 3580 |
| 584 | nmdc:mga08x19_13835_c1 | 3300050514 | Bacteria | 4887 |
| 585 | nmdc:mga08x19_25511_c1 | 3300050514 | Bacteria | 3681 |
| 586 | nmdc:mga0a205_33543_c1 | 3300050515 | Bacteria | 4922 |
| 587 | Ga0495619_0034544 | 3300053085 | Bacteria | 3287 |
| 588 | Ga0500636_0000320 | 3300053177 | Bacteria | 26563 |
| 589 | Ga0501082_0048039 | 3300060353 | Bacteria | 3678 |
| 590 | Ga0530510_0009845 | 3300061734 | Bacteria | 6706 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025961 | Ga0207712_10077270 | Ga0207712_100772703 | 474 |
| 2 | 3300048917 | Ga0496114_0045159 | Ga0496114_0045159_2134_3636 | 475 |
| 3 | 3300049743 | Ga0501081_0014871 | Ga0501081_0014871_3490_5100 | 496 |
| 4 | 3300046642 | Ga0495634_0090566 | Ga0495634_0090566_10_1671 | 508 |
| 5 | 3300048907 | Ga0496104_0011927 | Ga0496104_0011927_4972_6654 | 537 |
| 6 | 3300003775 | Ga0055524_1003537 | Ga0055524_10035378 | 547 |
| 7 | 3300044673 | Ga0453683_0085703 | Ga0453683_0085703_34_1809 | 563 |
| 8 | 3300049579 | Ga0501043_0000058 | Ga0501043_0000058_60614_62494 | 565 |
| 9 | 3300049580 | Ga0501046_0000051 | Ga0501046_0000051_39584_41464 | 565 |
| 10 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_466940_468820 | 565 |
| 11 | 3300049582 | Ga0501048_0001376 | Ga0501048_0001376_8783_10663 | 565 |
| 12 | 3300005536 | Ga0070697_100001076 | Ga0070697_10000107619 | 566 |
| 13 | 3300006846 | Ga0075430_100079425 | Ga0075430_1000794253 | 567 |
| 14 | 3300046516 | Ga0495628_0018175 | Ga0495628_0018175_2836_4695 | 567 |
| 15 | 3300050508 | nmdc:mga09592_26986_c2 | nmdc:mga09592_26986_c2_723_2579 | 567 |
| 16 | 3300046517 | Ga0495630_0004891 | Ga0495630_0004891_1589_3448 | 570 |
| 17 | 3300047444 | Ga0495675_0006190 | Ga0495675_0006190_5304_7163 | 570 |
| 18 | 3300005343 | Ga0070687_100051465 | Ga0070687_1000514652 | 573 |
| 19 | 3300005719 | Ga0068861_100087357 | Ga0068861_1000873572 | 573 |
| 20 | 3300009094 | Ga0111539_10162687 | Ga0111539_101626872 | 573 |
| 21 | 3300028380 | Ga0268265_10134039 | Ga0268265_101340392 | 573 |
| 22 | 3300025925 | Ga0207650_10050188 | Ga0207650_100501882 | 574 |
| 23 | 3300035410 | Ga0373924_0006554 | Ga0373924_0006554_825_2678 | 574 |
| 24 | 3300046475 | Ga0495639_0010997 | Ga0495639_0010997_315_2174 | 574 |
| 25 | 3300046675 | Ga0495657_0053334 | Ga0495657_0053334_392_2251 | 574 |
| 26 | 3300046681 | Ga0495647_0010361 | Ga0495647_0010361_252_2111 | 574 |
| 27 | 3300046683 | Ga0495658_0020909 | Ga0495658_0020909_1478_3337 | 574 |
| 28 | 3300046689 | Ga0495613_0048397 | Ga0495613_0048397_190_2049 | 574 |
| 29 | 3300046809 | Ga0495600_0052366 | Ga0495600_0052366_579_2438 | 574 |
| 30 | 3300047319 | Ga0495674_0008982 | Ga0495674_0008982_2312_4171 | 574 |
| 31 | 3300053085 | Ga0495619_0034544 | Ga0495619_0034544_338_2197 | 574 |
| 32 | 3300005333 | Ga0070677_10001330 | Ga0070677_100013303 | 575 |
| 33 | 3300005338 | Ga0068868_100007221 | Ga0068868_1000072212 | 575 |
| 34 | 3300005347 | Ga0070668_100016206 | Ga0070668_1000162063 | 575 |
| 35 | 3300005355 | Ga0070671_100010529 | Ga0070671_1000105293 | 575 |
| 36 | 3300005364 | Ga0070673_100001510 | Ga0070673_10000151013 | 575 |
| 37 | 3300005456 | Ga0070678_100001864 | Ga0070678_1000018648 | 575 |
| 38 | 3300005457 | Ga0070662_100006101 | Ga0070662_1000061013 | 575 |
| 39 | 3300005543 | Ga0070672_100010643 | Ga0070672_1000106433 | 575 |
| 40 | 3300005546 | Ga0070696_100084013 | Ga0070696_1000840131 | 575 |
| 41 | 3300005616 | Ga0068852_100002603 | Ga0068852_10000260312 | 575 |
| 42 | 3300005842 | Ga0068858_100009634 | Ga0068858_1000096344 | 575 |
| 43 | 3300005843 | Ga0068860_100011798 | Ga0068860_1000117988 | 575 |
| 44 | 3300006237 | Ga0097621_100005472 | Ga0097621_1000054721 | 575 |
| 45 | 3300025893 | Ga0207682_10001222 | Ga0207682_100012229 | 575 |
| 46 | 3300025937 | Ga0207669_10001618 | Ga0207669_100016186 | 575 |
| 47 | 3300025960 | Ga0207651_10020462 | Ga0207651_100204624 | 575 |
| 48 | 3300026035 | Ga0207703_10006351 | Ga0207703_100063516 | 575 |
| 49 | 3300026142 | Ga0207698_10012550 | Ga0207698_100125502 | 575 |
| 50 | 3300049824 | Ga0501045_0032958 | Ga0501045_0032958_293_2140 | 576 |
| 51 | 3300006051 | Ga0075364_10007219 | Ga0075364_100072193 | 579 |
| 52 | 3300031711 | Ga0265314_10042093 | Ga0265314_100420932 | 579 |
| 53 | iso_pu_bacteria | 2643221554 | 2643790351 | 582 |
| 54 | 3300049575 | Ga0501039_0008726 | Ga0501039_0008726_3823_5688 | 583 |
| 55 | 3300049577 | Ga0501041_0010484 | Ga0501041_0010484_2309_4174 | 583 |
| 56 | 3300049591 | Ga0501075_0005228 | Ga0501075_0005228_1481_3346 | 583 |
| 57 | 3300049592 | Ga0501076_0005353 | Ga0501076_0005353_2331_4196 | 583 |
| 58 | 3300002739 | JGI25158J39367_1001262 | JGI25158J39367_10012622 | 585 |
| 59 | 3300002774 | JGI25150J39212_1004937 | JGI25150J39212_10049371 | 585 |
| 60 | 3300003790 | Ga0055528_1009883 | Ga0055528_10098832 | 585 |
| 61 | 3300005364 | Ga0070673_100051153 | Ga0070673_1000511532 | 586 |
| 62 | 3300005441 | Ga0070700_100000816 | Ga0070700_10000081615 | 586 |
| 63 | 3300005444 | Ga0070694_100075697 | Ga0070694_1000756972 | 586 |
| 64 | 3300005459 | Ga0068867_100018356 | Ga0068867_1000183564 | 586 |
| 65 | 3300005844 | Ga0068862_100092767 | Ga0068862_1000927672 | 586 |
| 66 | 3300006844 | Ga0075428_100004485 | Ga0075428_10000448512 | 586 |
| 67 | 3300006880 | Ga0075429_100013978 | Ga0075429_1000139784 | 586 |
| 68 | 3300006881 | Ga0068865_100000771 | Ga0068865_1000007715 | 586 |
| 69 | 3300009094 | Ga0111539_10036136 | Ga0111539_100361363 | 586 |
| 70 | 3300014745 | Ga0157377_10010593 | Ga0157377_100105932 | 586 |
| 71 | 3300025940 | Ga0207691_10028978 | Ga0207691_100289785 | 586 |
| 72 | 3300025960 | Ga0207651_10033189 | Ga0207651_100331892 | 586 |
| 73 | 3300026075 | Ga0207708_10002136 | Ga0207708_100021367 | 586 |
| 74 | 3300026089 | Ga0207648_10056959 | Ga0207648_100569592 | 586 |
| 75 | 3300026118 | Ga0207675_100002550 | Ga0207675_10000255015 | 586 |
| 76 | 3300027907 | Ga0207428_10018006 | Ga0207428_100180064 | 586 |
| 77 | 3300028380 | Ga0268265_10000628 | Ga0268265_1000062824 | 586 |
| 78 | 3300028380 | Ga0268265_10002348 | Ga0268265_1000234812 | 586 |
| 79 | 3300035086 | Ga0373934_0000397 | Ga0373934_0000397_12949_14805 | 586 |
| 80 | 3300035117 | Ga0373953_0027741 | Ga0373953_0027741_103_1959 | 586 |
| 81 | 3300035119 | Ga0373956_0000018 | Ga0373956_0000018_48378_50234 | 586 |
| 82 | 3300035724 | Ga0373933_0000035 | Ga0373933_0000035_50223_52079 | 586 |
| 83 | 3300045976 | Ga0466967_0002332 | Ga0466967_0002332_4031_5887 | 586 |
| 84 | 3300046462 | Ga0495651_0008636 | Ga0495651_0008636_441_2297 | 586 |
| 85 | 3300050508 | nmdc:mga09592_2820_c1 | nmdc:mga09592_2820_c1_2395_4260 | 586 |
| 86 | 3300050511 | nmdc:mga08y16_21040_c1 | nmdc:mga08y16_21040_c1_5011_6876 | 586 |
| 87 | 3300006844 | Ga0075428_100030014 | Ga0075428_1000300143 | 587 |
| 88 | 3300006846 | Ga0075430_100012772 | Ga0075430_1000127723 | 587 |
| 89 | 3300006847 | Ga0075431_100064476 | Ga0075431_1000644763 | 587 |
| 90 | 3300027395 | Ga0209996_1002046 | Ga0209996_10020462 | 587 |
| 91 | 3300031665 | Ga0316575_10008484 | Ga0316575_100084843 | 587 |
| 92 | 3300035398 | Ga0316574_0009848 | Ga0316574_0009848_3480_5339 | 587 |
| 93 | 3300042001 | Ga0439441_000155 | Ga0439441_000155_354_2240 | 587 |
| 94 | 3300042436 | Ga0439435_0002367 | Ga0439435_0002367_1640_3526 | 587 |
| 95 | 3300042437 | Ga0439444_0002677 | Ga0439444_0002677_22_1908 | 587 |
| 96 | 3300042461 | Ga0439460_0000735 | Ga0439460_0000735_982_2868 | 587 |
| 97 | 3300049574 | Ga0501038_0055372 | Ga0501038_0055372_882_2768 | 587 |
| 98 | 3300049577 | Ga0501041_0010354 | Ga0501041_0010354_2931_4817 | 587 |
| 99 | 3300049587 | Ga0501071_0050555 | Ga0501071_0050555_288_2174 | 587 |
| 100 | 3300049588 | Ga0501072_0024456 | Ga0501072_0024456_1725_3611 | 587 |
| 101 | 3300049591 | Ga0501075_0067172 | Ga0501075_0067172_645_2531 | 587 |
| 102 | 3300049592 | Ga0501076_0001236 | Ga0501076_0001236_5423_7309 | 587 |
| 103 | 3300049593 | Ga0501077_0012008 | Ga0501077_0012008_2554_4440 | 587 |
| 104 | 3300049741 | Ga0501079_0085213 | Ga0501079_0085213_222_2108 | 587 |
| 105 | 3300049824 | Ga0501045_0085770 | Ga0501045_0085770_349_2235 | 587 |
| 106 | 3300050509 | nmdc:mga0qj67_15349_c1 | nmdc:mga0qj67_15349_c1_3653_5512 | 587 |
| 107 | 3300050510 | nmdc:mga06r32_66281_c1 | nmdc:mga06r32_66281_c1_791_2650 | 587 |
| 108 | 3300060353 | Ga0501082_0048039 | Ga0501082_0048039_1301_3187 | 587 |
| 109 | 3300061734 | Ga0530510_0009845 | Ga0530510_0009845_1127_3013 | 587 |
| 110 | iso_pu_bacteria | 2574179768 | 2574429368 | 587 |
| 111 | iso_pu_bacteria | 2891633521 | 2891635564 | 587 |
| 112 | 3300025942 | Ga0207689_10015645 | Ga0207689_100156452 | 588 |
| 113 | 3300026075 | Ga0207708_10013971 | Ga0207708_100139713 | 588 |
| 114 | 3300026118 | Ga0207675_100028188 | Ga0207675_1000281882 | 588 |
| 115 | 3300031548 | Ga0307408_100025686 | Ga0307408_1000256863 | 588 |
| 116 | 3300031731 | Ga0307405_10017861 | Ga0307405_100178613 | 588 |
| 117 | 3300031852 | Ga0307410_10004177 | Ga0307410_100041772 | 588 |
| 118 | 3300031901 | Ga0307406_10010231 | Ga0307406_100102314 | 588 |
| 119 | 3300031903 | Ga0307407_10002346 | Ga0307407_100023466 | 588 |
| 120 | 3300031911 | Ga0307412_10014385 | Ga0307412_100143853 | 588 |
| 121 | 3300032002 | Ga0307416_100011450 | Ga0307416_1000114504 | 588 |
| 122 | 3300032005 | Ga0307411_10026945 | Ga0307411_100269453 | 588 |
| 123 | 3300050514 | nmdc:mga08x19_25511_c1 | nmdc:mga08x19_25511_c1_482_2320 | 588 |
| 124 | 3300048915 | Ga0496112_0001624 | Ga0496112_0001624_5748_7604 | 589 |
| 125 | 3300050491 | nmdc:mga00v17_12012_c1 | nmdc:mga00v17_12012_c1_1224_3089 | 589 |
| 126 | iso_pu_bacteria | 2547132512 | 2548847615 | 589 |
| 127 | 3300005329 | Ga0070683_100011136 | Ga0070683_1000111364 | 590 |
| 128 | 3300005330 | Ga0070690_100005520 | Ga0070690_1000055206 | 590 |
| 129 | 3300005331 | Ga0070670_100008762 | Ga0070670_1000087627 | 590 |
| 130 | 3300005334 | Ga0068869_100034018 | Ga0068869_1000340183 | 590 |
| 131 | 3300005335 | Ga0070666_10025481 | Ga0070666_100254812 | 590 |
| 132 | 3300005336 | Ga0070680_100009608 | Ga0070680_1000096082 | 590 |
| 133 | 3300005338 | Ga0068868_100035463 | Ga0068868_1000354632 | 590 |
| 134 | 3300005339 | Ga0070660_100005315 | Ga0070660_1000053157 | 590 |
| 135 | 3300005340 | Ga0070689_100001989 | Ga0070689_1000019897 | 590 |
| 136 | 3300005343 | Ga0070687_100024753 | Ga0070687_1000247531 | 590 |
| 137 | 3300005345 | Ga0070692_10003283 | Ga0070692_100032833 | 590 |
| 138 | 3300005355 | Ga0070671_100064620 | Ga0070671_1000646202 | 590 |
| 139 | 3300005364 | Ga0070673_100000328 | Ga0070673_10000032819 | 590 |
| 140 | 3300005365 | Ga0070688_100008857 | Ga0070688_1000088574 | 590 |
| 141 | 3300005366 | Ga0070659_100013911 | Ga0070659_1000139116 | 590 |
| 142 | 3300005437 | Ga0070710_10010714 | Ga0070710_100107143 | 590 |
| 143 | 3300005439 | Ga0070711_100002929 | Ga0070711_1000029295 | 590 |
| 144 | 3300005444 | Ga0070694_100009912 | Ga0070694_1000099124 | 590 |
| 145 | 3300005445 | Ga0070708_100050988 | Ga0070708_1000509882 | 590 |
| 146 | 3300005456 | Ga0070678_100003405 | Ga0070678_1000034056 | 590 |
| 147 | 3300005466 | Ga0070685_10007091 | Ga0070685_100070913 | 590 |
| 148 | 3300005467 | Ga0070706_100019444 | Ga0070706_1000194442 | 590 |
| 149 | 3300005468 | Ga0070707_100057631 | Ga0070707_1000576313 | 590 |
| 150 | 3300005518 | Ga0070699_100010012 | Ga0070699_1000100126 | 590 |
| 151 | 3300005535 | Ga0070684_100013308 | Ga0070684_1000133084 | 590 |
| 152 | 3300005536 | Ga0070697_100058192 | Ga0070697_1000581922 | 590 |
| 153 | 3300005547 | Ga0070693_100000852 | Ga0070693_1000008522 | 590 |
| 154 | 3300005563 | Ga0068855_100138090 | Ga0068855_1001380902 | 590 |
| 155 | 3300005578 | Ga0068854_100036700 | Ga0068854_1000367002 | 590 |
| 156 | 3300005617 | Ga0068859_100007009 | Ga0068859_1000070096 | 590 |
| 157 | 3300005618 | Ga0068864_100021805 | Ga0068864_1000218053 | 590 |
| 158 | 3300005841 | Ga0068863_100022555 | Ga0068863_1000225553 | 590 |
| 159 | 3300005842 | Ga0068858_100007231 | Ga0068858_1000072314 | 590 |
| 160 | 3300006173 | Ga0070716_100012828 | Ga0070716_1000128284 | 590 |
| 161 | 3300006358 | Ga0068871_100057683 | Ga0068871_1000576832 | 590 |
| 162 | 3300006914 | Ga0075436_100038245 | Ga0075436_1000382452 | 590 |
| 163 | 3300006931 | Ga0097620_100007009 | Ga0097620_1000070096 | 590 |
| 164 | 3300007076 | Ga0075435_100006293 | Ga0075435_1000062937 | 590 |
| 165 | 3300009098 | Ga0105245_10100379 | Ga0105245_101003792 | 590 |
| 166 | 3300009545 | Ga0105237_10051202 | Ga0105237_100512022 | 590 |
| 167 | 3300009551 | Ga0105238_10015758 | Ga0105238_100157587 | 590 |
| 168 | 3300010375 | Ga0105239_10016466 | Ga0105239_100164665 | 590 |
| 169 | 3300011119 | Ga0105246_10052817 | Ga0105246_100528171 | 590 |
| 170 | 3300013100 | Ga0157373_10044324 | Ga0157373_100443243 | 590 |
| 171 | 3300013104 | Ga0157370_10007816 | Ga0157370_100078168 | 590 |
| 172 | 3300013105 | Ga0157369_10071836 | Ga0157369_100718362 | 590 |
| 173 | 3300013296 | Ga0157374_10001173 | Ga0157374_1000117316 | 590 |
| 174 | 3300013307 | Ga0157372_10188223 | Ga0157372_101882232 | 590 |
| 175 | 3300013308 | Ga0157375_10008337 | Ga0157375_100083373 | 590 |
| 176 | 3300014325 | Ga0163163_10041598 | Ga0163163_100415982 | 590 |
| 177 | 3300014968 | Ga0157379_10005995 | Ga0157379_100059956 | 590 |
| 178 | 3300025898 | Ga0207692_10022429 | Ga0207692_100224292 | 590 |
| 179 | 3300025912 | Ga0207707_10050499 | Ga0207707_100504993 | 590 |
| 180 | 3300025915 | Ga0207693_10000463 | Ga0207693_1000046318 | 590 |
| 181 | 3300025915 | Ga0207693_10008943 | Ga0207693_100089433 | 590 |
| 182 | 3300025916 | Ga0207663_10011310 | Ga0207663_100113104 | 590 |
| 183 | 3300025919 | Ga0207657_10002776 | Ga0207657_100027762 | 590 |
| 184 | 3300025927 | Ga0207687_10040418 | Ga0207687_100404182 | 590 |
| 185 | 3300025927 | Ga0207687_10041232 | Ga0207687_100412322 | 590 |
| 186 | 3300025931 | Ga0207644_10004473 | Ga0207644_100044736 | 590 |
| 187 | 3300025933 | Ga0207706_10077626 | Ga0207706_100776262 | 590 |
| 188 | 3300025934 | Ga0207686_10000801 | Ga0207686_100008014 | 590 |
| 189 | 3300025939 | Ga0207665_10016045 | Ga0207665_100160454 | 590 |
| 190 | 3300025939 | Ga0207665_10031471 | Ga0207665_100314713 | 590 |
| 191 | 3300025941 | Ga0207711_10005307 | Ga0207711_100053076 | 590 |
| 192 | 3300025942 | Ga0207689_10103523 | Ga0207689_101035232 | 590 |
| 193 | 3300025944 | Ga0207661_10097371 | Ga0207661_100973712 | 590 |
| 194 | 3300025945 | Ga0207679_10094338 | Ga0207679_100943382 | 590 |
| 195 | 3300025949 | Ga0207667_10087203 | Ga0207667_100872032 | 590 |
| 196 | 3300025960 | Ga0207651_10003339 | Ga0207651_100033395 | 590 |
| 197 | 3300026023 | Ga0207677_10004244 | Ga0207677_100042443 | 590 |
| 198 | 3300026035 | Ga0207703_10021728 | Ga0207703_100217284 | 590 |
| 199 | 3300026078 | Ga0207702_10001823 | Ga0207702_1000182310 | 590 |
| 200 | 3300026088 | Ga0207641_10001847 | Ga0207641_100018472 | 590 |
| 201 | 3300026095 | Ga0207676_10000377 | Ga0207676_1000037718 | 590 |
| 202 | 3300026116 | Ga0207674_10063978 | Ga0207674_100639781 | 590 |
| 203 | 3300026121 | Ga0207683_10000144 | Ga0207683_1000014444 | 590 |
| 204 | 3300026142 | Ga0207698_10113170 | Ga0207698_101131702 | 590 |
| 205 | 3300028381 | Ga0268264_10116712 | Ga0268264_101167121 | 590 |
| 206 | 3300035086 | Ga0373934_0004935 | Ga0373934_0004935_2006_3847 | 590 |
| 207 | 3300035111 | Ga0373923_0007265 | Ga0373923_0007265_569_2410 | 590 |
| 208 | 3300035117 | Ga0373953_0000890 | Ga0373953_0000890_1026_2867 | 590 |
| 209 | 3300035118 | Ga0373954_0000772 | Ga0373954_0000772_2904_4745 | 590 |
| 210 | 3300035119 | Ga0373956_0002888 | Ga0373956_0002888_891_2732 | 590 |
| 211 | 3300036401 | Ga0373937_0048405 | Ga0373937_0048405_150_1991 | 590 |
| 212 | 3300046473 | Ga0495582_0006387 | Ga0495582_0006387_3734_5575 | 590 |
| 213 | 3300046475 | Ga0495639_0047009 | Ga0495639_0047009_16_1857 | 590 |
| 214 | 3300046476 | Ga0495662_0011055 | Ga0495662_0011055_1409_3250 | 590 |
| 215 | 3300046531 | Ga0495665_0002238 | Ga0495665_0002238_578_2419 | 590 |
| 216 | 3300046663 | Ga0495635_0019989 | Ga0495635_0019989_856_2697 | 590 |
| 217 | 3300046679 | Ga0495623_0021169 | Ga0495623_0021169_1333_3174 | 590 |
| 218 | 3300046689 | Ga0495613_0009879 | Ga0495613_0009879_2714_4555 | 590 |
| 219 | 3300046809 | Ga0495600_0007282 | Ga0495600_0007282_1413_3254 | 590 |
| 220 | 3300047673 | Ga0495593_0043140 | Ga0495593_0043140_365_2206 | 590 |
| 221 | 3300048903 | Ga0496100_0021004 | Ga0496100_0021004_1203_3044 | 590 |
| 222 | 3300048908 | Ga0496105_0012325 | Ga0496105_0012325_3847_5688 | 590 |
| 223 | 3300048909 | Ga0496106_0037319 | Ga0496106_0037319_469_2310 | 590 |
| 224 | 3300050512 | nmdc:mga0n895_24771_c1 | nmdc:mga0n895_24771_c1_1258_3114 | 590 |
| 225 | 3300050513 | nmdc:mga0rr50_35512_c1 | nmdc:mga0rr50_35512_c1_890_2731 | 590 |
| 226 | 3300050514 | nmdc:mga08x19_13835_c1 | nmdc:mga08x19_13835_c1_28_1884 | 590 |
| 227 | 3300050515 | nmdc:mga0a205_33543_c1 | nmdc:mga0a205_33543_c1_2546_4402 | 590 |
| 228 | iso_pu_bacteria | 639633007 | 639786022 | 590 |
| 229 | 3300005549 | Ga0070704_100106872 | Ga0070704_1001068721 | 591 |
| 230 | 3300025939 | Ga0207665_10032101 | Ga0207665_100321012 | 591 |
| 231 | 3300025940 | Ga0207691_10012143 | Ga0207691_100121433 | 592 |
| 232 | 3300031507 | Ga0307509_10000105 | Ga0307509_1000010523 | 592 |
| 233 | 3300044712 | Ga0453684_0000331 | Ga0453684_0000331_150141_152018 | 592 |
| 234 | 3300005293 | Ga0065715_10106418 | Ga0065715_101064182 | 593 |
| 235 | 3300005328 | Ga0070676_10010596 | Ga0070676_100105965 | 593 |
| 236 | 3300005333 | Ga0070677_10019797 | Ga0070677_100197972 | 593 |
| 237 | 3300005334 | Ga0068869_100001603 | Ga0068869_1000016034 | 593 |
| 238 | 3300005335 | Ga0070666_10003422 | Ga0070666_100034226 | 593 |
| 239 | 3300005353 | Ga0070669_100001415 | Ga0070669_1000014154 | 593 |
| 240 | 3300005355 | Ga0070671_100025752 | Ga0070671_1000257524 | 593 |
| 241 | 3300005364 | Ga0070673_100015978 | Ga0070673_1000159785 | 593 |
| 242 | 3300005367 | Ga0070667_100002204 | Ga0070667_1000022045 | 593 |
| 243 | 3300005445 | Ga0070708_100005341 | Ga0070708_1000053417 | 593 |
| 244 | 3300005459 | Ga0068867_100001223 | Ga0068867_1000012239 | 593 |
| 245 | 3300005467 | Ga0070706_100012952 | Ga0070706_1000129522 | 593 |
| 246 | 3300005518 | Ga0070699_100045572 | Ga0070699_1000455722 | 593 |
| 247 | 3300005543 | Ga0070672_100000618 | Ga0070672_10000061819 | 593 |
| 248 | 3300005548 | Ga0070665_100002113 | Ga0070665_1000021134 | 593 |
| 249 | 3300005617 | Ga0068859_100011594 | Ga0068859_1000115942 | 593 |
| 250 | 3300005617 | Ga0068859_100080732 | Ga0068859_1000807323 | 593 |
| 251 | 3300005618 | Ga0068864_100021514 | Ga0068864_1000215143 | 593 |
| 252 | 3300005841 | Ga0068863_100076062 | Ga0068863_1000760623 | 593 |
| 253 | 3300005842 | Ga0068858_100002706 | Ga0068858_1000027064 | 593 |
| 254 | 3300005843 | Ga0068860_100006037 | Ga0068860_1000060378 | 593 |
| 255 | 3300006237 | Ga0097621_100004231 | Ga0097621_1000042315 | 593 |
| 256 | 3300006931 | Ga0097620_100011595 | Ga0097620_1000115952 | 593 |
| 257 | 3300006931 | Ga0097620_100080730 | Ga0097620_1000807303 | 593 |
| 258 | 3300009177 | Ga0105248_10008807 | Ga0105248_100088073 | 593 |
| 259 | 3300013296 | Ga0157374_10005247 | Ga0157374_100052476 | 593 |
| 260 | 3300013306 | Ga0163162_10005104 | Ga0163162_1000510413 | 593 |
| 261 | 3300013308 | Ga0157375_10012590 | Ga0157375_100125904 | 593 |
| 262 | 3300025907 | Ga0207645_10000530 | Ga0207645_1000053017 | 593 |
| 263 | 3300025910 | Ga0207684_10041819 | Ga0207684_100418193 | 593 |
| 264 | 3300025922 | Ga0207646_10062759 | Ga0207646_100627593 | 593 |
| 265 | 3300025925 | Ga0207650_10005770 | Ga0207650_100057709 | 593 |
| 266 | 3300025926 | Ga0207659_10001980 | Ga0207659_1000198011 | 593 |
| 267 | 3300025940 | Ga0207691_10001011 | Ga0207691_1000101119 | 593 |
| 268 | 3300025942 | Ga0207689_10007164 | Ga0207689_100071645 | 593 |
| 269 | 3300025960 | Ga0207651_10008658 | Ga0207651_100086585 | 593 |
| 270 | 3300025972 | Ga0207668_10079527 | Ga0207668_100795272 | 593 |
| 271 | 3300025986 | Ga0207658_10002303 | Ga0207658_1000230310 | 593 |
| 272 | 3300026035 | Ga0207703_10071744 | Ga0207703_100717443 | 593 |
| 273 | 3300026088 | Ga0207641_10001517 | Ga0207641_100015178 | 593 |
| 274 | 3300026089 | Ga0207648_10000126 | Ga0207648_1000012613 | 593 |
| 275 | 3300026121 | Ga0207683_10000959 | Ga0207683_1000095916 | 593 |
| 276 | 3300028381 | Ga0268264_10011904 | Ga0268264_100119043 | 593 |
| 277 | 3300031238 | Ga0265332_10000004 | Ga0265332_1000000449 | 593 |
| 278 | 3300035695 | Ga0373927_0010190 | Ga0373927_0010190_640_2505 | 593 |
| 279 | 3300048904 | Ga0496101_0083339 | Ga0496101_0083339_143_1999 | 593 |
| 280 | 3300048911 | Ga0496108_0021197 | Ga0496108_0021197_762_2618 | 593 |
| 281 | iso_pu_bacteria | 2932422444 | 2932422510 | 593 |
| 282 | 3300005353 | Ga0070669_100053672 | Ga0070669_1000536722 | 594 |
| 283 | 3300005353 | Ga0070669_100068288 | Ga0070669_1000682882 | 594 |
| 284 | 3300005355 | Ga0070671_100080033 | Ga0070671_1000800332 | 594 |
| 285 | 3300005843 | Ga0068860_100035111 | Ga0068860_1000351113 | 594 |
| 286 | 3300005843 | Ga0068860_100041400 | Ga0068860_1000414004 | 594 |
| 287 | 3300005844 | Ga0068862_100016512 | Ga0068862_1000165126 | 594 |
| 288 | 3300009177 | Ga0105248_10001255 | Ga0105248_1000125530 | 594 |
| 289 | 3300009177 | Ga0105248_10018851 | Ga0105248_100188514 | 594 |
| 290 | 3300025923 | Ga0207681_10009034 | Ga0207681_100090343 | 594 |
| 291 | 3300025928 | Ga0207700_10000455 | Ga0207700_1000045513 | 594 |
| 292 | 3300025931 | Ga0207644_10024466 | Ga0207644_100244663 | 594 |
| 293 | 3300025941 | Ga0207711_10023132 | Ga0207711_100231323 | 594 |
| 294 | 3300025942 | Ga0207689_10001031 | Ga0207689_1000103111 | 594 |
| 295 | 3300026035 | Ga0207703_10062643 | Ga0207703_100626432 | 594 |
| 296 | 3300026089 | Ga0207648_10040242 | Ga0207648_100402425 | 594 |
| 297 | 3300026116 | Ga0207674_10128471 | Ga0207674_101284712 | 594 |
| 298 | 3300028380 | Ga0268265_10043250 | Ga0268265_100432502 | 594 |
| 299 | 3300028380 | Ga0268265_10083710 | Ga0268265_100837101 | 594 |
| 300 | 3300028381 | Ga0268264_10073830 | Ga0268264_100738302 | 594 |
| 301 | 3300031235 | Ga0265330_10002161 | Ga0265330_100021614 | 594 |
| 302 | 3300031238 | Ga0265332_10000284 | Ga0265332_1000028430 | 594 |
| 303 | 3300031242 | Ga0265329_10009102 | Ga0265329_100091023 | 594 |
| 304 | 3300031250 | Ga0265331_10000415 | Ga0265331_1000041526 | 594 |
| 305 | 3300031251 | Ga0265327_10002711 | Ga0265327_1000271113 | 594 |
| 306 | 3300031344 | Ga0265316_10011426 | Ga0265316_100114268 | 594 |
| 307 | 3300031711 | Ga0265314_10003685 | Ga0265314_1000368510 | 594 |
| 308 | 3300035171 | Ga0373946_0021851 | Ga0373946_0021851_18_1892 | 594 |
| 309 | 3300037418 | Ga0395900_0067298 | Ga0395900_0067298_446_2311 | 594 |
| 310 | iso_pu_bacteria | 2894023352 | 2894027794 | 594 |
| 311 | 3300005354 | Ga0070675_100017996 | Ga0070675_1000179962 | 595 |
| 312 | 3300005457 | Ga0070662_100029733 | Ga0070662_1000297333 | 595 |
| 313 | 3300005459 | Ga0068867_100054812 | Ga0068867_1000548122 | 595 |
| 314 | 3300005543 | Ga0070672_100001738 | Ga0070672_1000017384 | 595 |
| 315 | 3300009177 | Ga0105248_10151969 | Ga0105248_101519693 | 595 |
| 316 | 3300013308 | Ga0157375_10060360 | Ga0157375_100603602 | 595 |
| 317 | 3300025926 | Ga0207659_10005968 | Ga0207659_100059682 | 595 |
| 318 | 3300025940 | Ga0207691_10002116 | Ga0207691_100021168 | 595 |
| 319 | 3300026089 | Ga0207648_10035320 | Ga0207648_100353203 | 595 |
| 320 | 3300005328 | Ga0070676_10030302 | Ga0070676_100303023 | 596 |
| 321 | 3300005331 | Ga0070670_100014387 | Ga0070670_1000143875 | 596 |
| 322 | 3300005334 | Ga0068869_100003167 | Ga0068869_1000031677 | 596 |
| 323 | 3300005367 | Ga0070667_100011630 | Ga0070667_1000116304 | 596 |
| 324 | 3300005458 | Ga0070681_10001659 | Ga0070681_1000165911 | 596 |
| 325 | 3300005459 | Ga0068867_100002515 | Ga0068867_1000025156 | 596 |
| 326 | 3300005530 | Ga0070679_100117383 | Ga0070679_1001173831 | 596 |
| 327 | 3300005614 | Ga0068856_100063423 | Ga0068856_1000634232 | 596 |
| 328 | 3300005616 | Ga0068852_100154751 | Ga0068852_1001547511 | 596 |
| 329 | 3300005617 | Ga0068859_100005851 | Ga0068859_1000058513 | 596 |
| 330 | 3300005618 | Ga0068864_100001193 | Ga0068864_10000119313 | 596 |
| 331 | 3300005618 | Ga0068864_100059736 | Ga0068864_1000597362 | 596 |
| 332 | 3300005719 | Ga0068861_100012072 | Ga0068861_1000120721 | 596 |
| 333 | 3300005841 | Ga0068863_100005071 | Ga0068863_1000050718 | 596 |
| 334 | 3300005842 | Ga0068858_100021920 | Ga0068858_1000219201 | 596 |
| 335 | 3300005844 | Ga0068862_100008440 | Ga0068862_1000084406 | 596 |
| 336 | 3300006931 | Ga0097620_100005851 | Ga0097620_1000058513 | 596 |
| 337 | 3300009148 | Ga0105243_10050726 | Ga0105243_100507263 | 596 |
| 338 | 3300009177 | Ga0105248_10031606 | Ga0105248_100316062 | 596 |
| 339 | 3300014968 | Ga0157379_10012613 | Ga0157379_100126134 | 596 |
| 340 | 3300025907 | Ga0207645_10038996 | Ga0207645_100389962 | 596 |
| 341 | 3300025908 | Ga0207643_10005162 | Ga0207643_100051626 | 596 |
| 342 | 3300025921 | Ga0207652_10159770 | Ga0207652_101597701 | 596 |
| 343 | 3300025925 | Ga0207650_10032028 | Ga0207650_100320282 | 596 |
| 344 | 3300025941 | Ga0207711_10055165 | Ga0207711_100551652 | 596 |
| 345 | 3300025942 | Ga0207689_10000003 | Ga0207689_1000000353 | 596 |
| 346 | 3300025986 | Ga0207658_10005483 | Ga0207658_100054833 | 596 |
| 347 | 3300026023 | Ga0207677_10015778 | Ga0207677_100157783 | 596 |
| 348 | 3300026035 | Ga0207703_10000987 | Ga0207703_1000098711 | 596 |
| 349 | 3300026078 | Ga0207702_10013792 | Ga0207702_100137925 | 596 |
| 350 | 3300026088 | Ga0207641_10004700 | Ga0207641_100047006 | 596 |
| 351 | 3300026089 | Ga0207648_10000442 | Ga0207648_1000044231 | 596 |
| 352 | 3300026116 | Ga0207674_10038883 | Ga0207674_100388834 | 596 |
| 353 | 3300028380 | Ga0268265_10009770 | Ga0268265_100097704 | 596 |
| 354 | 3300028381 | Ga0268264_10001089 | Ga0268264_100010899 | 596 |
| 355 | 3300048905 | Ga0496102_0010791 | Ga0496102_0010791_4186_6051 | 596 |
| 356 | 3300048906 | Ga0496103_0010149 | Ga0496103_0010149_590_2455 | 596 |
| 357 | 3300048912 | Ga0496109_0077449 | Ga0496109_0077449_979_2844 | 596 |
| 358 | 3300005340 | Ga0070689_100019475 | Ga0070689_1000194753 | 597 |
| 359 | 3300005347 | Ga0070668_100012194 | Ga0070668_1000121945 | 597 |
| 360 | 3300005347 | Ga0070668_100023760 | Ga0070668_1000237602 | 597 |
| 361 | 3300005354 | Ga0070675_100004574 | Ga0070675_1000045743 | 597 |
| 362 | 3300005459 | Ga0068867_100018020 | Ga0068867_1000180203 | 597 |
| 363 | 3300005548 | Ga0070665_100032024 | Ga0070665_1000320245 | 597 |
| 364 | 3300005841 | Ga0068863_100032443 | Ga0068863_1000324434 | 597 |
| 365 | 3300006871 | Ga0075434_100075710 | Ga0075434_1000757103 | 597 |
| 366 | 3300009176 | Ga0105242_10018528 | Ga0105242_100185284 | 597 |
| 367 | 3300014325 | Ga0163163_10055514 | Ga0163163_100555143 | 597 |
| 368 | 3300014326 | Ga0157380_10056113 | Ga0157380_100561133 | 597 |
| 369 | 3300025923 | Ga0207681_10016081 | Ga0207681_100160812 | 597 |
| 370 | 3300025936 | Ga0207670_10019328 | Ga0207670_100193283 | 597 |
| 371 | 3300025940 | Ga0207691_10006226 | Ga0207691_100062263 | 597 |
| 372 | 3300026089 | Ga0207648_10043114 | Ga0207648_100431143 | 597 |
| 373 | 3300026095 | Ga0207676_10032647 | Ga0207676_100326474 | 597 |
| 374 | 3300026118 | Ga0207675_100062447 | Ga0207675_1000624472 | 597 |
| 375 | 3300028379 | Ga0268266_10010702 | Ga0268266_100107022 | 597 |
| 376 | 3300036401 | Ga0373937_0095074 | Ga0373937_0095074_18_1880 | 597 |
| 377 | 3300046558 | Ga0495633_0006065 | Ga0495633_0006065_3259_5151 | 597 |
| 378 | 3300048915 | Ga0496112_0094268 | Ga0496112_0094268_826_2688 | 597 |
| 379 | 3300048918 | Ga0496115_0109956 | Ga0496115_0109956_390_2252 | 597 |
| 380 | 3300050512 | nmdc:mga0n895_118898_c1 | nmdc:mga0n895_118898_c1_643_2505 | 597 |
| 381 | 3300053177 | Ga0500636_0000320 | Ga0500636_0000320_24637_26541 | 597 |
| 382 | 3300005339 | Ga0070660_100006963 | Ga0070660_1000069633 | 598 |
| 383 | 3300005339 | Ga0070660_100017586 | Ga0070660_1000175863 | 598 |
| 384 | 3300005344 | Ga0070661_100002676 | Ga0070661_1000026764 | 598 |
| 385 | 3300005347 | Ga0070668_100081972 | Ga0070668_1000819722 | 598 |
| 386 | 3300005354 | Ga0070675_100002777 | Ga0070675_1000027772 | 598 |
| 387 | 3300005366 | Ga0070659_100008744 | Ga0070659_1000087446 | 598 |
| 388 | 3300005366 | Ga0070659_100011020 | Ga0070659_1000110203 | 598 |
| 389 | 3300005367 | Ga0070667_100010761 | Ga0070667_1000107615 | 598 |
| 390 | 3300005435 | Ga0070714_100023434 | Ga0070714_1000234343 | 598 |
| 391 | 3300005435 | Ga0070714_100105362 | Ga0070714_1001053621 | 598 |
| 392 | 3300005437 | Ga0070710_10051010 | Ga0070710_100510101 | 598 |
| 393 | 3300005455 | Ga0070663_100018113 | Ga0070663_1000181133 | 598 |
| 394 | 3300005458 | Ga0070681_10009268 | Ga0070681_100092685 | 598 |
| 395 | 3300005459 | Ga0068867_100002941 | Ga0068867_1000029412 | 598 |
| 396 | 3300005518 | Ga0070699_100032080 | Ga0070699_1000320802 | 598 |
| 397 | 3300005530 | Ga0070679_100081109 | Ga0070679_1000811093 | 598 |
| 398 | 3300005535 | Ga0070684_100008314 | Ga0070684_1000083143 | 598 |
| 399 | 3300005535 | Ga0070684_100024621 | Ga0070684_1000246213 | 598 |
| 400 | 3300005546 | Ga0070696_100009781 | Ga0070696_1000097816 | 598 |
| 401 | 3300005548 | Ga0070665_100020139 | Ga0070665_1000201393 | 598 |
| 402 | 3300005563 | Ga0068855_100002431 | Ga0068855_10000243120 | 598 |
| 403 | 3300005564 | Ga0070664_100000232 | Ga0070664_10000023219 | 598 |
| 404 | 3300005577 | Ga0068857_100000150 | Ga0068857_10000015020 | 598 |
| 405 | 3300005614 | Ga0068856_100015939 | Ga0068856_1000159393 | 598 |
| 406 | 3300005614 | Ga0068856_100022621 | Ga0068856_1000226212 | 598 |
| 407 | 3300005614 | Ga0068856_100076927 | Ga0068856_1000769272 | 598 |
| 408 | 3300005616 | Ga0068852_100002736 | Ga0068852_1000027366 | 598 |
| 409 | 3300005618 | Ga0068864_100004662 | Ga0068864_1000046624 | 598 |
| 410 | 3300005834 | Ga0068851_10006428 | Ga0068851_100064283 | 598 |
| 411 | 3300005834 | Ga0068851_10024417 | Ga0068851_100244171 | 598 |
| 412 | 3300005840 | Ga0068870_10006298 | Ga0068870_100062982 | 598 |
| 413 | 3300005841 | Ga0068863_100031853 | Ga0068863_1000318533 | 598 |
| 414 | 3300006358 | Ga0068871_100003356 | Ga0068871_1000033568 | 598 |
| 415 | 3300006358 | Ga0068871_100006707 | Ga0068871_1000067072 | 598 |
| 416 | 3300006871 | Ga0075434_100027426 | Ga0075434_1000274263 | 598 |
| 417 | 3300009093 | Ga0105240_10012137 | Ga0105240_100121372 | 598 |
| 418 | 3300009093 | Ga0105240_10113589 | Ga0105240_101135892 | 598 |
| 419 | 3300009177 | Ga0105248_10066758 | Ga0105248_100667582 | 598 |
| 420 | 3300009545 | Ga0105237_10031857 | Ga0105237_100318574 | 598 |
| 421 | 3300009551 | Ga0105238_10004955 | Ga0105238_100049553 | 598 |
| 422 | 3300013100 | Ga0157373_10011974 | Ga0157373_100119742 | 598 |
| 423 | 3300013100 | Ga0157373_10034594 | Ga0157373_100345943 | 598 |
| 424 | 3300013102 | Ga0157371_10056458 | Ga0157371_100564582 | 598 |
| 425 | 3300013105 | Ga0157369_10010212 | Ga0157369_100102124 | 598 |
| 426 | 3300013105 | Ga0157369_10010469 | Ga0157369_100104695 | 598 |
| 427 | 3300013307 | Ga0157372_10000985 | Ga0157372_1000098529 | 598 |
| 428 | 3300013308 | Ga0157375_10006967 | Ga0157375_100069678 | 598 |
| 429 | 3300025321 | Ga0207656_10006766 | Ga0207656_100067663 | 598 |
| 430 | 3300025908 | Ga0207643_10009075 | Ga0207643_100090754 | 598 |
| 431 | 3300025912 | Ga0207707_10002904 | Ga0207707_1000290410 | 598 |
| 432 | 3300025913 | Ga0207695_10011566 | Ga0207695_100115668 | 598 |
| 433 | 3300025913 | Ga0207695_10030233 | Ga0207695_100302334 | 598 |
| 434 | 3300025919 | Ga0207657_10009229 | Ga0207657_100092295 | 598 |
| 435 | 3300025919 | Ga0207657_10012006 | Ga0207657_100120063 | 598 |
| 436 | 3300025919 | Ga0207657_10026962 | Ga0207657_100269623 | 598 |
| 437 | 3300025920 | Ga0207649_10010084 | Ga0207649_100100843 | 598 |
| 438 | 3300025924 | Ga0207694_10006116 | Ga0207694_100061168 | 598 |
| 439 | 3300025924 | Ga0207694_10045922 | Ga0207694_100459223 | 598 |
| 440 | 3300025929 | Ga0207664_10004425 | Ga0207664_100044258 | 598 |
| 441 | 3300025931 | Ga0207644_10042633 | Ga0207644_100426332 | 598 |
| 442 | 3300025932 | Ga0207690_10002295 | Ga0207690_100022955 | 598 |
| 443 | 3300025941 | Ga0207711_10028179 | Ga0207711_100281794 | 598 |
| 444 | 3300025945 | Ga0207679_10014817 | Ga0207679_100148173 | 598 |
| 445 | 3300025945 | Ga0207679_10072490 | Ga0207679_100724903 | 598 |
| 446 | 3300025949 | Ga0207667_10003456 | Ga0207667_100034566 | 598 |
| 447 | 3300025949 | Ga0207667_10009543 | Ga0207667_100095433 | 598 |
| 448 | 3300026067 | Ga0207678_10005363 | Ga0207678_100053639 | 598 |
| 449 | 3300026078 | Ga0207702_10001905 | Ga0207702_1000190517 | 598 |
| 450 | 3300026078 | Ga0207702_10004335 | Ga0207702_1000433510 | 598 |
| 451 | 3300026088 | Ga0207641_10044037 | Ga0207641_100440372 | 598 |
| 452 | 3300026089 | Ga0207648_10000589 | Ga0207648_1000058939 | 598 |
| 453 | 3300026095 | Ga0207676_10011120 | Ga0207676_100111203 | 598 |
| 454 | 3300026116 | Ga0207674_10000369 | Ga0207674_1000036920 | 598 |
| 455 | 3300026116 | Ga0207674_10019115 | Ga0207674_100191155 | 598 |
| 456 | 3300026142 | Ga0207698_10002438 | Ga0207698_100024386 | 598 |
| 457 | 3300045051 | Ga0451576_0014607 | Ga0451576_0014607_2409_4310 | 598 |
| 458 | 3300050512 | nmdc:mga0n895_21867_c1 | nmdc:mga0n895_21867_c1_575_2440 | 598 |
| 459 | 3300005367 | Ga0070667_100050280 | Ga0070667_1000502801 | 599 |
| 460 | 3300005459 | Ga0068867_100013075 | Ga0068867_1000130753 | 599 |
| 461 | 3300025899 | Ga0207642_10024351 | Ga0207642_100243512 | 599 |
| 462 | 3300026089 | Ga0207648_10010389 | Ga0207648_100103894 | 599 |
| 463 | 3300005459 | Ga0068867_100079320 | Ga0068867_1000793202 | 600 |
| 464 | 3300005548 | Ga0070665_100016497 | Ga0070665_1000164975 | 600 |
| 465 | 3300006237 | Ga0097621_100069324 | Ga0097621_1000693242 | 600 |
| 466 | 3300026089 | Ga0207648_10082231 | Ga0207648_100822313 | 600 |
| 467 | 3300026121 | Ga0207683_10004945 | Ga0207683_100049455 | 600 |
| 468 | 3300027717 | Ga0209998_10003871 | Ga0209998_100038713 | 600 |
| 469 | 3300027876 | Ga0209974_10000366 | Ga0209974_100003666 | 600 |
| 470 | 3300028379 | Ga0268266_10041724 | Ga0268266_100417241 | 600 |
| 471 | 3300049586 | Ga0501070_0021699 | Ga0501070_0021699_713_2689 | 600 |
| 472 | 3300049590 | Ga0501074_0005875 | Ga0501074_0005875_3863_5839 | 600 |
| 473 | 3300001977 | JGI24746J21847_1002078 | JGI24746J21847_10020782 | 601 |
| 474 | 3300002075 | JGI24738J21930_10008049 | JGI24738J21930_100080492 | 601 |
| 475 | 3300002076 | JGI24749J21850_1001582 | JGI24749J21850_10015823 | 601 |
| 476 | 3300002077 | JGI24744J21845_10006896 | JGI24744J21845_100068962 | 601 |
| 477 | 3300002239 | JGI24034J26672_10002490 | JGI24034J26672_100024902 | 601 |
| 478 | 3300005293 | Ga0065715_10099723 | Ga0065715_100997232 | 601 |
| 479 | 3300005329 | Ga0070683_100012394 | Ga0070683_1000123945 | 601 |
| 480 | 3300005330 | Ga0070690_100001622 | Ga0070690_1000016224 | 601 |
| 481 | 3300005331 | Ga0070670_100058176 | Ga0070670_1000581763 | 601 |
| 482 | 3300005331 | Ga0070670_100072954 | Ga0070670_1000729543 | 601 |
| 483 | 3300005333 | Ga0070677_10004494 | Ga0070677_100044943 | 601 |
| 484 | 3300005334 | Ga0068869_100020382 | Ga0068869_1000203822 | 601 |
| 485 | 3300005339 | Ga0070660_100010635 | Ga0070660_1000106355 | 601 |
| 486 | 3300005339 | Ga0070660_100027115 | Ga0070660_1000271153 | 601 |
| 487 | 3300005340 | Ga0070689_100004833 | Ga0070689_1000048334 | 601 |
| 488 | 3300005353 | Ga0070669_100030011 | Ga0070669_1000300113 | 601 |
| 489 | 3300005355 | Ga0070671_100038012 | Ga0070671_1000380122 | 601 |
| 490 | 3300005355 | Ga0070671_100085895 | Ga0070671_1000858952 | 601 |
| 491 | 3300005365 | Ga0070688_100001281 | Ga0070688_1000012815 | 601 |
| 492 | 3300005366 | Ga0070659_100000775 | Ga0070659_1000007759 | 601 |
| 493 | 3300005366 | Ga0070659_100053304 | Ga0070659_1000533043 | 601 |
| 494 | 3300005438 | Ga0070701_10011312 | Ga0070701_100113124 | 601 |
| 495 | 3300005441 | Ga0070700_100012660 | Ga0070700_1000126603 | 601 |
| 496 | 3300005459 | Ga0068867_100011384 | Ga0068867_1000113842 | 601 |
| 497 | 3300005466 | Ga0070685_10002100 | Ga0070685_100021005 | 601 |
| 498 | 3300005535 | Ga0070684_100024579 | Ga0070684_1000245792 | 601 |
| 499 | 3300005539 | Ga0068853_100031794 | Ga0068853_1000317943 | 601 |
| 500 | 3300005544 | Ga0070686_100007051 | Ga0070686_1000070513 | 601 |
| 501 | 3300005548 | Ga0070665_100016657 | Ga0070665_1000166575 | 601 |
| 502 | 3300005563 | Ga0068855_100026060 | Ga0068855_1000260602 | 601 |
| 503 | 3300005564 | Ga0070664_100002189 | Ga0070664_10000218910 | 601 |
| 504 | 3300005564 | Ga0070664_100006956 | Ga0070664_1000069567 | 601 |
| 505 | 3300005577 | Ga0068857_100003300 | Ga0068857_1000033003 | 601 |
| 506 | 3300005578 | Ga0068854_100003871 | Ga0068854_1000038715 | 601 |
| 507 | 3300005614 | Ga0068856_100000121 | Ga0068856_10000012157 | 601 |
| 508 | 3300005615 | Ga0070702_100004941 | Ga0070702_1000049413 | 601 |
| 509 | 3300005616 | Ga0068852_100023842 | Ga0068852_1000238424 | 601 |
| 510 | 3300005617 | Ga0068859_100018722 | Ga0068859_1000187223 | 601 |
| 511 | 3300005618 | Ga0068864_100002176 | Ga0068864_1000021762 | 601 |
| 512 | 3300005718 | Ga0068866_10001297 | Ga0068866_100012978 | 601 |
| 513 | 3300005719 | Ga0068861_100048238 | Ga0068861_1000482382 | 601 |
| 514 | 3300005834 | Ga0068851_10005887 | Ga0068851_100058872 | 601 |
| 515 | 3300005840 | Ga0068870_10001159 | Ga0068870_100011598 | 601 |
| 516 | 3300005841 | Ga0068863_100024596 | Ga0068863_1000245963 | 601 |
| 517 | 3300005842 | Ga0068858_100011839 | Ga0068858_1000118393 | 601 |
| 518 | 3300005843 | Ga0068860_100036564 | Ga0068860_1000365643 | 601 |
| 519 | 3300005844 | Ga0068862_100030923 | Ga0068862_1000309232 | 601 |
| 520 | 3300006881 | Ga0068865_100041607 | Ga0068865_1000416072 | 601 |
| 521 | 3300006931 | Ga0097620_100018724 | Ga0097620_1000187243 | 601 |
| 522 | 3300009094 | Ga0111539_10019136 | Ga0111539_100191363 | 601 |
| 523 | 3300009553 | Ga0105249_10042235 | Ga0105249_100422353 | 601 |
| 524 | 3300013100 | Ga0157373_10000313 | Ga0157373_1000031341 | 601 |
| 525 | 3300013102 | Ga0157371_10001031 | Ga0157371_1000103118 | 601 |
| 526 | 3300013104 | Ga0157370_10002415 | Ga0157370_1000241515 | 601 |
| 527 | 3300013296 | Ga0157374_10016090 | Ga0157374_100160905 | 601 |
| 528 | 3300013306 | Ga0163162_10063648 | Ga0163162_100636482 | 601 |
| 529 | 3300014325 | Ga0163163_10004614 | Ga0163163_100046145 | 601 |
| 530 | 3300014326 | Ga0157380_10005087 | Ga0157380_100050874 | 601 |
| 531 | 3300014745 | Ga0157377_10004602 | Ga0157377_100046023 | 601 |
| 532 | 3300014968 | Ga0157379_10049691 | Ga0157379_100496912 | 601 |
| 533 | 3300017792 | Ga0163161_10050562 | Ga0163161_100505623 | 601 |
| 534 | 3300025271 | Ga0207666_1000621 | Ga0207666_10006213 | 601 |
| 535 | 3300025893 | Ga0207682_10000731 | Ga0207682_100007319 | 601 |
| 536 | 3300025903 | Ga0207680_10021684 | Ga0207680_100216842 | 601 |
| 537 | 3300025907 | Ga0207645_10003858 | Ga0207645_1000385810 | 601 |
| 538 | 3300025908 | Ga0207643_10000267 | Ga0207643_1000026712 | 601 |
| 539 | 3300025918 | Ga0207662_10006514 | Ga0207662_100065142 | 601 |
| 540 | 3300025919 | Ga0207657_10000995 | Ga0207657_100009953 | 601 |
| 541 | 3300025919 | Ga0207657_10023022 | Ga0207657_100230222 | 601 |
| 542 | 3300025920 | Ga0207649_10001599 | Ga0207649_1000159910 | 601 |
| 543 | 3300025920 | Ga0207649_10021813 | Ga0207649_100218132 | 601 |
| 544 | 3300025923 | Ga0207681_10045524 | Ga0207681_100455242 | 601 |
| 545 | 3300025925 | Ga0207650_10002076 | Ga0207650_1000207611 | 601 |
| 546 | 3300025925 | Ga0207650_10034011 | Ga0207650_100340112 | 601 |
| 547 | 3300025926 | Ga0207659_10019297 | Ga0207659_100192972 | 601 |
| 548 | 3300025931 | Ga0207644_10003838 | Ga0207644_100038384 | 601 |
| 549 | 3300025931 | Ga0207644_10026764 | Ga0207644_100267642 | 601 |
| 550 | 3300025931 | Ga0207644_10051893 | Ga0207644_100518932 | 601 |
| 551 | 3300025932 | Ga0207690_10002015 | Ga0207690_100020153 | 601 |
| 552 | 3300025933 | Ga0207706_10000644 | Ga0207706_1000064413 | 601 |
| 553 | 3300025936 | Ga0207670_10023141 | Ga0207670_100231412 | 601 |
| 554 | 3300025937 | Ga0207669_10000673 | Ga0207669_100006733 | 601 |
| 555 | 3300025938 | Ga0207704_10019351 | Ga0207704_100193513 | 601 |
| 556 | 3300025940 | Ga0207691_10007167 | Ga0207691_100071675 | 601 |
| 557 | 3300025941 | Ga0207711_10065246 | Ga0207711_100652463 | 601 |
| 558 | 3300025942 | Ga0207689_10001154 | Ga0207689_1000115419 | 601 |
| 559 | 3300025944 | Ga0207661_10020377 | Ga0207661_100203773 | 601 |
| 560 | 3300025944 | Ga0207661_10035846 | Ga0207661_100358462 | 601 |
| 561 | 3300025945 | Ga0207679_10006231 | Ga0207679_100062316 | 601 |
| 562 | 3300025945 | Ga0207679_10018627 | Ga0207679_100186272 | 601 |
| 563 | 3300025949 | Ga0207667_10001918 | Ga0207667_1000191815 | 601 |
| 564 | 3300025972 | Ga0207668_10022978 | Ga0207668_100229783 | 601 |
| 565 | 3300025981 | Ga0207640_10022374 | Ga0207640_100223742 | 601 |
| 566 | 3300025986 | Ga0207658_10035829 | Ga0207658_100358292 | 601 |
| 567 | 3300026035 | Ga0207703_10029206 | Ga0207703_100292063 | 601 |
| 568 | 3300026041 | Ga0207639_10087382 | Ga0207639_100873822 | 601 |
| 569 | 3300026067 | Ga0207678_10002008 | Ga0207678_1000200810 | 601 |
| 570 | 3300026075 | Ga0207708_10013301 | Ga0207708_100133013 | 601 |
| 571 | 3300026078 | Ga0207702_10002122 | Ga0207702_1000212215 | 601 |
| 572 | 3300026089 | Ga0207648_10007227 | Ga0207648_100072278 | 601 |
| 573 | 3300026095 | Ga0207676_10022772 | Ga0207676_100227724 | 601 |
| 574 | 3300026116 | Ga0207674_10003357 | Ga0207674_1000335716 | 601 |
| 575 | 3300026118 | Ga0207675_100003777 | Ga0207675_1000037779 | 601 |
| 576 | 3300026121 | Ga0207683_10008777 | Ga0207683_100087778 | 601 |
| 577 | 3300031731 | Ga0307405_10009760 | Ga0307405_100097604 | 601 |
| 578 | 3300031824 | Ga0307413_10003113 | Ga0307413_100031134 | 601 |
| 579 | 3300031852 | Ga0307410_10000921 | Ga0307410_100009216 | 601 |
| 580 | 3300031901 | Ga0307406_10006332 | Ga0307406_100063323 | 601 |
| 581 | 3300031995 | Ga0307409_100014278 | Ga0307409_1000142784 | 601 |
| 582 | 3300032002 | Ga0307416_100008070 | Ga0307416_1000080706 | 601 |
| 583 | 3300032126 | Ga0307415_100008244 | Ga0307415_1000082443 | 601 |
| 584 | 3300035691 | Ga0373931_0057809 | Ga0373931_0057809_131_2008 | 601 |
| 585 | 3300036401 | Ga0373937_0102952 | Ga0373937_0102952_706_2580 | 601 |
| 586 | 3300046459 | Ga0495629_0062757 | Ga0495629_0062757_220_2094 | 601 |
| 587 | 3300048903 | Ga0496100_0046877 | Ga0496100_0046877_676_2550 | 601 |
| 588 | 3300048904 | Ga0496101_0009002 | Ga0496101_0009002_614_2488 | 601 |
| 589 | 3300048905 | Ga0496102_0002745 | Ga0496102_0002745_4543_6420 | 601 |
| 590 | 3300048905 | Ga0496102_0013617 | Ga0496102_0013617_4698_6572 | 601 |
| 591 | 3300048909 | Ga0496106_0002746 | Ga0496106_0002746_510_2387 | 601 |
| 592 | 3300048910 | Ga0496107_0014219 | Ga0496107_0014219_2726_4600 | 601 |
| 593 | 3300048910 | Ga0496107_0015023 | Ga0496107_0015023_3143_5020 | 601 |
| 594 | 3300048911 | Ga0496108_0047549 | Ga0496108_0047549_1296_3170 | 601 |
| 595 | 3300048912 | Ga0496109_0003042 | Ga0496109_0003042_8780_10654 | 601 |
| 596 | 3300048917 | Ga0496114_0013013 | Ga0496114_0013013_729_2603 | 601 |
| 597 | 3300050511 | nmdc:mga08y16_90495_c1 | nmdc:mga08y16_90495_c1_1017_2891 | 601 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar