F467713

General Info

Members Datasets Scaffolds Average Seq Length
597 287 590 609

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0021699|Ga0501070_0021699_713_2689
Length 640
Sequence MNRYPLWKYIIIGIAVLVGIVYTLPNFYGEAPAVQISPTHAGVKVDAALEARVGAILKAGKLNPDALTLDAGTNTVRARFDNTDIQLKAKDLIAGKLGDGYVVALNLVSQSPRWLKAIGALPMYLGLDLRGGVYFLMQVDMEAALTKKLDSYVGDIRTTLRDQDIHYTHVAREGDTVVVHLRDAAARDKALTAIGKSMPDLTLKTTQSGNDNLIVAVLSKQSQSRTEELALQQNITTLRNRVNELGVAEPIIQQQGLNRVVVQLPGVQDTARAKEILGRTATLEIHMVDEDHADAASLEAAVKGQIPFGDSLYYNRSGVPLLVKKQVILTGDRINDAQPGFDPQTGQPAVHVNLDGTGARIFGRVTRDNVGKRMAIVLFDQGKGEVITAPVIQQEIDGGRVQISGHMDTREANDIALLLRAGALAAPMNIVEERTVGPSLGAENIKIGFHSTWIGFSAIAVFIISYYVLFGVISITALAINXXXLIALLSMLQATLTLPGMAGIALTVGMAIDANVLINERVREELRAGMTPQAAISAGYEHAWRTILDCNITTLIAGIALFAFGAGPVKGFAVVLCLGLLTSMFSAVMVSRGIVNYIYGRRRRLEKVSIGQIWRPETGAAGRKARGAGAGKTGGVRSKA

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
5 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
6 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0.17
Rhizoplane 3.85
Rhizosphere 93.97
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002078 3300001977 Bacteria 3198
2 JGI24738J21930_10008049 3300002075 Bacteria 2407
3 JGI24749J21850_1001582 3300002076 Bacteria 3227
4 JGI24744J21845_10006896 3300002077 Bacteria 2348
5 JGI24034J26672_10002490 3300002239 Bacteria 2529
6 JGI25158J39367_1001262 3300002739 Bacteria 4516
7 JGI25150J39212_1004937 3300002774 Bacteria 2899
8 Ga0055524_1003537 3300003775 Bacteria 7552
9 Ga0055528_1009883 3300003790 Bacteria 3939
10 Ga0065715_10099723 3300005293 Bacteria 3378
11 Ga0065715_10106418 3300005293 Bacteria 2828
12 Ga0070676_10010596 3300005328 Bacteria 5001
13 Ga0070676_10030302 3300005328 Bacteria 3084
14 Ga0070683_100011136 3300005329 Bacteria 7759
15 Ga0070683_100012394 3300005329 Bacteria 7408
16 Ga0070690_100001622 3300005330 Bacteria 11824
17 Ga0070690_100005520 3300005330 Bacteria 7114
18 Ga0070670_100008762 3300005331 Bacteria 8639
19 Ga0070670_100014387 3300005331 Bacteria 6789
20 Ga0070670_100058176 3300005331 Bacteria 3318
21 Ga0070670_100072954 3300005331 Bacteria 2948
22 Ga0070677_10001330 3300005333 Bacteria 7890
23 Ga0070677_10004494 3300005333 Bacteria 4557
24 Ga0070677_10019797 3300005333 Bacteria 2443
25 Ga0068869_100001603 3300005334 Bacteria 13451
26 Ga0068869_100003167 3300005334 Bacteria 10040
27 Ga0068869_100020382 3300005334 Bacteria 4545
28 Ga0068869_100034018 3300005334 Bacteria 3602
29 Ga0070666_10003422 3300005335 Bacteria 9615
30 Ga0070666_10025481 3300005335 Bacteria 3856
31 Ga0070680_100009608 3300005336 Bacteria 7435
32 Ga0068868_100007221 3300005338 Bacteria 7896
33 Ga0068868_100035463 3300005338 Bacteria 3856
34 Ga0070660_100005315 3300005339 Bacteria 8910
35 Ga0070660_100006963 3300005339 Bacteria 7845
36 Ga0070660_100010635 3300005339 Bacteria 6505
37 Ga0070660_100017586 3300005339 Bacteria 5212
38 Ga0070660_100027115 3300005339 Bacteria 4274
39 Ga0070689_100001989 3300005340 Bacteria 13241
40 Ga0070689_100004833 3300005340 Bacteria 9148
41 Ga0070689_100019475 3300005340 Bacteria 5019
42 Ga0070687_100024753 3300005343 Bacteria 2872
43 Ga0070687_100051465 3300005343 Bacteria 2132
44 Ga0070661_100002676 3300005344 Bacteria 12196
45 Ga0070692_10003283 3300005345 Bacteria 6527
46 Ga0070668_100012194 3300005347 Bacteria 6402
47 Ga0070668_100016206 3300005347 Bacteria 5576
48 Ga0070668_100023760 3300005347 Bacteria 4639
49 Ga0070668_100081972 3300005347 Bacteria 2530
50 Ga0070669_100001415 3300005353 Bacteria 17346
51 Ga0070669_100030011 3300005353 Bacteria 3921
52 Ga0070669_100053672 3300005353 Bacteria 2950
53 Ga0070669_100068288 3300005353 Bacteria 2623
54 Ga0070675_100002777 3300005354 Bacteria 13172
55 Ga0070675_100004574 3300005354 Bacteria 10561
56 Ga0070675_100017996 3300005354 Bacteria 5624
57 Ga0070671_100010529 3300005355 Bacteria 7425
58 Ga0070671_100025752 3300005355 Bacteria 4829
59 Ga0070671_100038012 3300005355 Bacteria 3994
60 Ga0070671_100064620 3300005355 Bacteria 3047
61 Ga0070671_100080033 3300005355 Bacteria 2731
62 Ga0070671_100085895 3300005355 Bacteria 2632
63 Ga0070673_100000328 3300005364 Bacteria 24939
64 Ga0070673_100001510 3300005364 Bacteria 13674
65 Ga0070673_100015978 3300005364 Bacteria 5291
66 Ga0070673_100051153 3300005364 Bacteria 3233
67 Ga0070688_100001281 3300005365 Bacteria 12524
68 Ga0070688_100008857 3300005365 Bacteria 5477
69 Ga0070659_100000775 3300005366 Bacteria 23182
70 Ga0070659_100008744 3300005366 Bacteria 7411
71 Ga0070659_100011020 3300005366 Bacteria 6677
72 Ga0070659_100013911 3300005366 Bacteria 6004
73 Ga0070659_100053304 3300005366 Bacteria 3183
74 Ga0070667_100002204 3300005367 Bacteria 17149
75 Ga0070667_100010761 3300005367 Bacteria 7560
76 Ga0070667_100011630 3300005367 Bacteria 7276
77 Ga0070667_100050280 3300005367 Bacteria 3513
78 Ga0070714_100023434 3300005435 Bacteria 5071
79 Ga0070714_100105362 3300005435 Bacteria 2490
80 Ga0070710_10010714 3300005437 Bacteria 4508
81 Ga0070710_10051010 3300005437 Bacteria 2321
82 Ga0070701_10011312 3300005438 Bacteria 3985
83 Ga0070711_100002929 3300005439 Bacteria 9836
84 Ga0070700_100000816 3300005441 Bacteria 15305
85 Ga0070700_100012660 3300005441 Bacteria 4717
86 Ga0070694_100009912 3300005444 Bacteria 5854
87 Ga0070694_100075697 3300005444 Bacteria 2328
88 Ga0070708_100005341 3300005445 Bacteria 10188
89 Ga0070708_100050988 3300005445 Bacteria 3666
90 Ga0070663_100018113 3300005455 Bacteria 4611
91 Ga0070678_100001864 3300005456 Bacteria 11368
92 Ga0070678_100003405 3300005456 Bacteria 8868
93 Ga0070662_100006101 3300005457 Bacteria 7743
94 Ga0070662_100029733 3300005457 Bacteria 3816
95 Ga0070681_10001659 3300005458 Bacteria 19883
96 Ga0070681_10009268 3300005458 Bacteria 9678
97 Ga0068867_100001223 3300005459 Bacteria 17679
98 Ga0068867_100002515 3300005459 Bacteria 12900
99 Ga0068867_100002941 3300005459 Bacteria 11995
100 Ga0068867_100011384 3300005459 Bacteria 6277
101 Ga0068867_100013075 3300005459 Bacteria 5874
102 Ga0068867_100018020 3300005459 Bacteria 5018
103 Ga0068867_100018356 3300005459 Bacteria 4971
104 Ga0068867_100054812 3300005459 Bacteria 2946
105 Ga0068867_100079320 3300005459 Bacteria 2471
106 Ga0070685_10002100 3300005466 Bacteria 10285
107 Ga0070685_10007091 3300005466 Bacteria 5726
108 Ga0070706_100012952 3300005467 Bacteria 7719
109 Ga0070706_100019444 3300005467 Bacteria 6263
110 Ga0070707_100057631 3300005468 Bacteria 3726
111 Ga0070699_100010012 3300005518 Bacteria 8205
112 Ga0070699_100032080 3300005518 Bacteria 4536
113 Ga0070699_100045572 3300005518 Bacteria 3795
114 Ga0070679_100081109 3300005530 Bacteria 3233
115 Ga0070679_100117383 3300005530 Bacteria 2646
116 Ga0070684_100008314 3300005535 Bacteria 8105
117 Ga0070684_100013308 3300005535 Bacteria 6630
118 Ga0070684_100024579 3300005535 Bacteria 5056
119 Ga0070684_100024621 3300005535 Bacteria 5051
120 Ga0070697_100001076 3300005536 Bacteria 20621
121 Ga0070697_100058192 3300005536 Bacteria 3145
122 Ga0068853_100031794 3300005539 Bacteria 4466
123 Ga0070672_100000618 3300005543 Bacteria 20856
124 Ga0070672_100001738 3300005543 Bacteria 13636
125 Ga0070672_100010643 3300005543 Bacteria 6387
126 Ga0070686_100007051 3300005544 Bacteria 6265
127 Ga0070696_100009781 3300005546 Bacteria 6416
128 Ga0070696_100084013 3300005546 Bacteria 2259
129 Ga0070693_100000852 3300005547 Bacteria 13597
130 Ga0070665_100002113 3300005548 Bacteria 22201
131 Ga0070665_100016497 3300005548 Bacteria 7405
132 Ga0070665_100016657 3300005548 Bacteria 7366
133 Ga0070665_100020139 3300005548 Bacteria 6698
134 Ga0070665_100032024 3300005548 Bacteria 5292
135 Ga0070704_100106872 3300005549 Bacteria 2121
136 Ga0068855_100002431 3300005563 Bacteria 22996
137 Ga0068855_100026060 3300005563 Bacteria 6994
138 Ga0068855_100138090 3300005563 Bacteria 2780
139 Ga0070664_100000232 3300005564 Bacteria 39918
140 Ga0070664_100002189 3300005564 Bacteria 15703
141 Ga0070664_100006956 3300005564 Bacteria 9118
142 Ga0068857_100000150 3300005577 Bacteria 43268
143 Ga0068857_100003300 3300005577 Bacteria 13405
144 Ga0068854_100003871 3300005578 Bacteria 9380
145 Ga0068854_100036700 3300005578 Bacteria 3437
146 Ga0068856_100000121 3300005614 Bacteria 78250
147 Ga0068856_100015939 3300005614 Bacteria 7266
148 Ga0068856_100022621 3300005614 Bacteria 6112
149 Ga0068856_100063423 3300005614 Bacteria 3651
150 Ga0068856_100076927 3300005614 Bacteria 3306
151 Ga0070702_100004941 3300005615 Bacteria 6147
152 Ga0068852_100002603 3300005616 Bacteria 12468
153 Ga0068852_100002736 3300005616 Bacteria 12195
154 Ga0068852_100023842 3300005616 Bacteria 4934
155 Ga0068852_100154751 3300005616 Bacteria 2135
156 Ga0068859_100005851 3300005617 Bacteria 12484
157 Ga0068859_100007009 3300005617 Bacteria 11445
158 Ga0068859_100011594 3300005617 Bacteria 8863
159 Ga0068859_100018722 3300005617 Bacteria 6957
160 Ga0068859_100080732 3300005617 Bacteria 3294
161 Ga0068864_100001193 3300005618 Bacteria 21567
162 Ga0068864_100002176 3300005618 Bacteria 16182
163 Ga0068864_100004662 3300005618 Bacteria 11247
164 Ga0068864_100021514 3300005618 Bacteria 5402
165 Ga0068864_100021805 3300005618 Bacteria 5367
166 Ga0068864_100059736 3300005618 Bacteria 3299
167 Ga0068866_10001297 3300005718 Bacteria 10818
168 Ga0068861_100012072 3300005719 Bacteria 6020
169 Ga0068861_100048238 3300005719 Bacteria 3218
170 Ga0068861_100087357 3300005719 Bacteria 2454
171 Ga0068851_10005887 3300005834 Bacteria 5581
172 Ga0068851_10006428 3300005834 Bacteria 5364
173 Ga0068851_10024417 3300005834 Bacteria 2959
174 Ga0068870_10001159 3300005840 Bacteria 10552
175 Ga0068870_10006298 3300005840 Bacteria 5225
176 Ga0068863_100005071 3300005841 Bacteria 12992
177 Ga0068863_100022555 3300005841 Bacteria 6011
178 Ga0068863_100024596 3300005841 Bacteria 5743
179 Ga0068863_100031853 3300005841 Bacteria 5029
180 Ga0068863_100032443 3300005841 Bacteria 4979
181 Ga0068863_100076062 3300005841 Bacteria 3176
182 Ga0068858_100002706 3300005842 Bacteria 17873
183 Ga0068858_100007231 3300005842 Bacteria 10759
184 Ga0068858_100009634 3300005842 Bacteria 9206
185 Ga0068858_100011839 3300005842 Bacteria 8224
186 Ga0068858_100021920 3300005842 Bacteria 5966
187 Ga0068860_100006037 3300005843 Bacteria 12190
188 Ga0068860_100011798 3300005843 Bacteria 8612
189 Ga0068860_100035111 3300005843 Bacteria 4811
190 Ga0068860_100036564 3300005843 Bacteria 4704
191 Ga0068860_100041400 3300005843 Bacteria 4400
192 Ga0068862_100008440 3300005844 Bacteria 8522
193 Ga0068862_100016512 3300005844 Bacteria 6145
194 Ga0068862_100030923 3300005844 Bacteria 4514
195 Ga0068862_100092767 3300005844 Bacteria 2632
196 Ga0075364_10007219 3300006051 Bacteria 6584
197 Ga0070716_100012828 3300006173 Bacteria 4258
198 Ga0097621_100004231 3300006237 Bacteria 9970
199 Ga0097621_100005472 3300006237 Bacteria 8942
200 Ga0097621_100069324 3300006237 Bacteria 2912
201 Ga0068871_100003356 3300006358 Bacteria 11001
202 Ga0068871_100006707 3300006358 Bacteria 8171
203 Ga0068871_100057683 3300006358 Bacteria 3159
204 Ga0075428_100004485 3300006844 Bacteria 15412
205 Ga0075428_100030014 3300006844 Bacteria 6014
206 Ga0075430_100012772 3300006846 Bacteria 7154
207 Ga0075430_100079425 3300006846 Bacteria 2749
208 Ga0075431_100064476 3300006847 Bacteria 3782
209 Ga0075434_100027426 3300006871 Bacteria 5592
210 Ga0075434_100075710 3300006871 Bacteria 3360
211 Ga0075429_100013978 3300006880 Bacteria 6958
212 Ga0068865_100000771 3300006881 Bacteria 17955
213 Ga0068865_100041607 3300006881 Bacteria 3128
214 Ga0075436_100038245 3300006914 Bacteria 3312
215 Ga0097620_100005851 3300006931 Bacteria 12484
216 Ga0097620_100007009 3300006931 Bacteria 11445
217 Ga0097620_100011595 3300006931 Bacteria 8863
218 Ga0097620_100018724 3300006931 Bacteria 6957
219 Ga0097620_100080730 3300006931 Bacteria 3294
220 Ga0075435_100006293 3300007076 Bacteria 8384
221 Ga0105240_10012137 3300009093 Bacteria 11926
222 Ga0105240_10113589 3300009093 Bacteria 3273
223 Ga0111539_10019136 3300009094 Bacteria 8460
224 Ga0111539_10036136 3300009094 Bacteria 5976
225 Ga0111539_10162687 3300009094 Bacteria 2610
226 Ga0105245_10100379 3300009098 Bacteria 2677
227 Ga0105243_10050726 3300009148 Bacteria 3279
228 Ga0105242_10018528 3300009176 Bacteria 5445
229 Ga0105248_10001255 3300009177 Bacteria 28351
230 Ga0105248_10008807 3300009177 Bacteria 11084
231 Ga0105248_10018851 3300009177 Bacteria 7633
232 Ga0105248_10031606 3300009177 Bacteria 5915
233 Ga0105248_10066758 3300009177 Bacteria 4039
234 Ga0105248_10151969 3300009177 Bacteria 2612
235 Ga0105237_10031857 3300009545 Bacteria 5340
236 Ga0105237_10051202 3300009545 Bacteria 4148
237 Ga0105238_10004955 3300009551 Bacteria 13167
238 Ga0105238_10015758 3300009551 Bacteria 7653
239 Ga0105249_10042235 3300009553 Bacteria 4146
240 Ga0105239_10016466 3300010375 Bacteria 8176
241 Ga0105246_10052817 3300011119 Bacteria 2794
242 Ga0157373_10000313 3300013100 Bacteria 39072
243 Ga0157373_10011974 3300013100 Bacteria 6373
244 Ga0157373_10034594 3300013100 Bacteria 3629
245 Ga0157373_10044324 3300013100 Bacteria 3176
246 Ga0157371_10001031 3300013102 Bacteria 30547
247 Ga0157371_10056458 3300013102 Bacteria 2785
248 Ga0157370_10002415 3300013104 Bacteria 22519
249 Ga0157370_10007816 3300013104 Bacteria 11585
250 Ga0157369_10010212 3300013105 Bacteria 10714
251 Ga0157369_10010469 3300013105 Bacteria 10564
252 Ga0157369_10071836 3300013105 Bacteria 3714
253 Ga0157374_10001173 3300013296 Bacteria 22360
254 Ga0157374_10005247 3300013296 Bacteria 10871
255 Ga0157374_10016090 3300013296 Bacteria 6572
256 Ga0163162_10005104 3300013306 Bacteria 12654
257 Ga0163162_10063648 3300013306 Bacteria 3732
258 Ga0157372_10000985 3300013307 Bacteria 31124
259 Ga0157372_10188223 3300013307 Bacteria 2390
260 Ga0157375_10006967 3300013308 Bacteria 9870
261 Ga0157375_10008337 3300013308 Bacteria 9077
262 Ga0157375_10012590 3300013308 Bacteria 7506
263 Ga0157375_10060360 3300013308 Bacteria 3760
264 Ga0163163_10004614 3300014325 Bacteria 11764
265 Ga0163163_10041598 3300014325 Bacteria 4495
266 Ga0163163_10055514 3300014325 Bacteria 3915
267 Ga0157380_10005087 3300014326 Bacteria 9182
268 Ga0157380_10056113 3300014326 Bacteria 3131
269 Ga0157377_10004602 3300014745 Bacteria 6375
270 Ga0157377_10010593 3300014745 Bacteria 4566
271 Ga0157379_10005995 3300014968 Bacteria 10476
272 Ga0157379_10012613 3300014968 Bacteria 7382
273 Ga0157379_10049691 3300014968 Bacteria 3745
274 Ga0163161_10050562 3300017792 Bacteria 3009
275 Ga0207666_1000621 3300025271 Bacteria 4246
276 Ga0207656_10006766 3300025321 Bacteria 4143
277 Ga0207682_10000731 3300025893 Bacteria 15253
278 Ga0207682_10001222 3300025893 Bacteria 11869
279 Ga0207692_10022429 3300025898 Bacteria 2905
280 Ga0207642_10024351 3300025899 Bacteria 2432
281 Ga0207680_10021684 3300025903 Bacteria 3479
282 Ga0207645_10000530 3300025907 Bacteria 31705
283 Ga0207645_10003858 3300025907 Bacteria 11218
284 Ga0207645_10038996 3300025907 Bacteria 3044
285 Ga0207643_10000267 3300025908 Bacteria 36372
286 Ga0207643_10005162 3300025908 Bacteria 6986
287 Ga0207643_10009075 3300025908 Bacteria 5341
288 Ga0207684_10041819 3300025910 Bacteria 3884
289 Ga0207707_10002904 3300025912 Bacteria 15285
290 Ga0207707_10050499 3300025912 Bacteria 3622
291 Ga0207695_10011566 3300025913 Bacteria 10677
292 Ga0207695_10030233 3300025913 Bacteria 5966
293 Ga0207693_10000463 3300025915 Bacteria 37141
294 Ga0207693_10008943 3300025915 Bacteria 8174
295 Ga0207663_10011310 3300025916 Bacteria 4790
296 Ga0207662_10006514 3300025918 Bacteria 6308
297 Ga0207657_10000995 3300025919 Bacteria 30092
298 Ga0207657_10002776 3300025919 Bacteria 18862
299 Ga0207657_10009229 3300025919 Bacteria 9942
300 Ga0207657_10012006 3300025919 Bacteria 8567
301 Ga0207657_10023022 3300025919 Bacteria 5812
302 Ga0207657_10026962 3300025919 Bacteria 5269
303 Ga0207649_10001599 3300025920 Bacteria 13166
304 Ga0207649_10010084 3300025920 Bacteria 5183
305 Ga0207649_10021813 3300025920 Bacteria 3694
306 Ga0207652_10159770 3300025921 Bacteria 2020
307 Ga0207646_10062759 3300025922 Bacteria 3317
308 Ga0207681_10009034 3300025923 Bacteria 6090
309 Ga0207681_10016081 3300025923 Bacteria 4674
310 Ga0207681_10045524 3300025923 Bacteria 2946
311 Ga0207694_10006116 3300025924 Bacteria 9202
312 Ga0207694_10045922 3300025924 Bacteria 3375
313 Ga0207650_10002076 3300025925 Bacteria 14007
314 Ga0207650_10005770 3300025925 Bacteria 8447
315 Ga0207650_10032028 3300025925 Bacteria 3802
316 Ga0207650_10034011 3300025925 Bacteria 3695
317 Ga0207650_10050188 3300025925 Bacteria 3084
318 Ga0207659_10001980 3300025926 Bacteria 12118
319 Ga0207659_10005968 3300025926 Bacteria 7430
320 Ga0207659_10019297 3300025926 Bacteria 4485
321 Ga0207687_10040418 3300025927 Bacteria 3197
322 Ga0207687_10041232 3300025927 Bacteria 3168
323 Ga0207700_10000455 3300025928 Bacteria 23974
324 Ga0207664_10004425 3300025929 Bacteria 9514
325 Ga0207644_10003838 3300025931 Bacteria 9735
326 Ga0207644_10004473 3300025931 Bacteria 9078
327 Ga0207644_10024466 3300025931 Bacteria 4146
328 Ga0207644_10026764 3300025931 Bacteria 3978
329 Ga0207644_10042633 3300025931 Bacteria 3217
330 Ga0207644_10051893 3300025931 Bacteria 2945
331 Ga0207690_10002015 3300025932 Bacteria 12446
332 Ga0207690_10002295 3300025932 Bacteria 11669
333 Ga0207706_10000644 3300025933 Bacteria 37010
334 Ga0207706_10077626 3300025933 Bacteria 2921
335 Ga0207686_10000801 3300025934 Bacteria 19297
336 Ga0207670_10019328 3300025936 Bacteria 4160
337 Ga0207670_10023141 3300025936 Bacteria 3862
338 Ga0207669_10000673 3300025937 Bacteria 14737
339 Ga0207669_10001618 3300025937 Bacteria 9580
340 Ga0207704_10019351 3300025938 Bacteria 3573
341 Ga0207665_10016045 3300025939 Bacteria 4919
342 Ga0207665_10031471 3300025939 Bacteria 3511
343 Ga0207665_10032101 3300025939 Bacteria 3477
344 Ga0207691_10001011 3300025940 Bacteria 27902
345 Ga0207691_10002116 3300025940 Bacteria 19416
346 Ga0207691_10006226 3300025940 Bacteria 11526
347 Ga0207691_10007167 3300025940 Bacteria 10755
348 Ga0207691_10012143 3300025940 Bacteria 8257
349 Ga0207691_10028978 3300025940 Bacteria 5181
350 Ga0207711_10005307 3300025941 Bacteria 10928
351 Ga0207711_10023132 3300025941 Bacteria 5202
352 Ga0207711_10028179 3300025941 Bacteria 4725
353 Ga0207711_10055165 3300025941 Bacteria 3412
354 Ga0207711_10065246 3300025941 Bacteria 3147
355 Ga0207689_10000003 3300025942 Bacteria 175710
356 Ga0207689_10001031 3300025942 Bacteria 26750
357 Ga0207689_10001154 3300025942 Bacteria 25407
358 Ga0207689_10007164 3300025942 Bacteria 9806
359 Ga0207689_10015645 3300025942 Bacteria 6425
360 Ga0207689_10103523 3300025942 Bacteria 2339
361 Ga0207661_10020377 3300025944 Bacteria 4956
362 Ga0207661_10035846 3300025944 Bacteria 3869
363 Ga0207661_10097371 3300025944 Bacteria 2463
364 Ga0207679_10006231 3300025945 Bacteria 7528
365 Ga0207679_10014817 3300025945 Bacteria 5136
366 Ga0207679_10018627 3300025945 Bacteria 4655
367 Ga0207679_10072490 3300025945 Bacteria 2602
368 Ga0207679_10094338 3300025945 Bacteria 2323
369 Ga0207667_10001918 3300025949 Bacteria 26099
370 Ga0207667_10003456 3300025949 Bacteria 19506
371 Ga0207667_10009543 3300025949 Bacteria 11419
372 Ga0207667_10087203 3300025949 Bacteria 3229
373 Ga0207651_10003339 3300025960 Bacteria 7869
374 Ga0207651_10008658 3300025960 Bacteria 5511
375 Ga0207651_10020462 3300025960 Bacteria 3994
376 Ga0207651_10033189 3300025960 Bacteria 3326
377 Ga0207712_10077270 3300025961 Bacteria 2412
378 Ga0207668_10022978 3300025972 Bacteria 3999
379 Ga0207668_10079527 3300025972 Bacteria 2372
380 Ga0207640_10022374 3300025981 Bacteria 3782
381 Ga0207658_10002303 3300025986 Bacteria 14092
382 Ga0207658_10005483 3300025986 Bacteria 8699
383 Ga0207658_10035829 3300025986 Bacteria 3555
384 Ga0207677_10004244 3300026023 Bacteria 7673
385 Ga0207677_10015778 3300026023 Bacteria 4455
386 Ga0207703_10000987 3300026035 Bacteria 27412
387 Ga0207703_10006351 3300026035 Bacteria 9447
388 Ga0207703_10021728 3300026035 Bacteria 5024
389 Ga0207703_10029206 3300026035 Bacteria 4349
390 Ga0207703_10062643 3300026035 Bacteria 3047
391 Ga0207703_10071744 3300026035 Bacteria 2861
392 Ga0207639_10087382 3300026041 Bacteria 2485
393 Ga0207678_10002008 3300026067 Bacteria 18521
394 Ga0207678_10005363 3300026067 Bacteria 11483
395 Ga0207708_10002136 3300026075 Bacteria 14580
396 Ga0207708_10013301 3300026075 Bacteria 6146
397 Ga0207708_10013971 3300026075 Bacteria 5997
398 Ga0207702_10001823 3300026078 Bacteria 20970
399 Ga0207702_10001905 3300026078 Bacteria 20378
400 Ga0207702_10002122 3300026078 Bacteria 19074
401 Ga0207702_10004335 3300026078 Bacteria 12656
402 Ga0207702_10013792 3300026078 Bacteria 6712
403 Ga0207641_10001517 3300026088 Bacteria 22764
404 Ga0207641_10001847 3300026088 Bacteria 20340
405 Ga0207641_10004700 3300026088 Bacteria 11774
406 Ga0207641_10044037 3300026088 Bacteria 3751
407 Ga0207648_10000126 3300026089 Bacteria 75403
408 Ga0207648_10000442 3300026089 Bacteria 45913
409 Ga0207648_10000589 3300026089 Bacteria 40773
410 Ga0207648_10007227 3300026089 Bacteria 10946
411 Ga0207648_10010389 3300026089 Bacteria 8825
412 Ga0207648_10035320 3300026089 Bacteria 4404
413 Ga0207648_10040242 3300026089 Bacteria 4108
414 Ga0207648_10043114 3300026089 Bacteria 3962
415 Ga0207648_10056959 3300026089 Bacteria 3410
416 Ga0207648_10082231 3300026089 Bacteria 2808
417 Ga0207676_10000377 3300026095 Bacteria 37930
418 Ga0207676_10011120 3300026095 Bacteria 6425
419 Ga0207676_10022772 3300026095 Bacteria 4611
420 Ga0207676_10032647 3300026095 Bacteria 3925
421 Ga0207674_10000369 3300026116 Bacteria 58569
422 Ga0207674_10003357 3300026116 Bacteria 19642
423 Ga0207674_10019115 3300026116 Bacteria 7426
424 Ga0207674_10038883 3300026116 Bacteria 4935
425 Ga0207674_10063978 3300026116 Bacteria 3711
426 Ga0207674_10128471 3300026116 Bacteria 2499
427 Ga0207675_100002550 3300026118 Bacteria 18032
428 Ga0207675_100003777 3300026118 Bacteria 14745
429 Ga0207675_100028188 3300026118 Bacteria 5229
430 Ga0207675_100062447 3300026118 Bacteria 3479
431 Ga0207683_10000144 3300026121 Bacteria 59196
432 Ga0207683_10000959 3300026121 Bacteria 26436
433 Ga0207683_10004945 3300026121 Bacteria 11466
434 Ga0207683_10008777 3300026121 Bacteria 8631
435 Ga0207698_10002438 3300026142 Bacteria 11017
436 Ga0207698_10012550 3300026142 Bacteria 5551
437 Ga0207698_10113170 3300026142 Bacteria 2279
438 Ga0209996_1002046 3300027395 Bacteria 2485
439 Ga0209998_10003871 3300027717 Bacteria 3233
440 Ga0209974_10000366 3300027876 Bacteria 14899
441 Ga0207428_10018006 3300027907 Bacteria 6050
442 Ga0268266_10010702 3300028379 Bacteria 7993
443 Ga0268266_10041724 3300028379 Bacteria 3916
444 Ga0268265_10000628 3300028380 Bacteria 35160
445 Ga0268265_10002348 3300028380 Bacteria 14344
446 Ga0268265_10009770 3300028380 Bacteria 6478
447 Ga0268265_10043250 3300028380 Bacteria 3347
448 Ga0268265_10083710 3300028380 Bacteria 2527
449 Ga0268265_10134039 3300028380 Bacteria 2063
450 Ga0268264_10001089 3300028381 Bacteria 26866
451 Ga0268264_10011904 3300028381 Bacteria 7166
452 Ga0268264_10073830 3300028381 Bacteria 2896
453 Ga0268264_10116712 3300028381 Bacteria 2347
454 Ga0265330_10002161 3300031235 Bacteria 10831
455 Ga0265332_10000004 3300031238 Bacteria 426592
456 Ga0265332_10000284 3300031238 Bacteria 39799
457 Ga0265329_10009102 3300031242 Bacteria 3723
458 Ga0265331_10000415 3300031250 Bacteria 43326
459 Ga0265327_10002711 3300031251 Bacteria 18137
460 Ga0265316_10011426 3300031344 Bacteria 8009
461 Ga0307509_10000105 3300031507 Bacteria 119065
462 Ga0307408_100025686 3300031548 Bacteria 4036
463 Ga0316575_10008484 3300031665 Bacteria 3745
464 Ga0265314_10003685 3300031711 Bacteria 14694
465 Ga0265314_10042093 3300031711 Bacteria 3262
466 Ga0307405_10009760 3300031731 Bacteria 4936
467 Ga0307405_10017861 3300031731 Bacteria 3902
468 Ga0307413_10003113 3300031824 Bacteria 6910
469 Ga0307410_10000921 3300031852 Bacteria 12567
470 Ga0307410_10004177 3300031852 Bacteria 7413
471 Ga0307406_10006332 3300031901 Bacteria 6531
472 Ga0307406_10010231 3300031901 Bacteria 5286
473 Ga0307407_10002346 3300031903 Bacteria 7371
474 Ga0307412_10014385 3300031911 Bacteria 4665
475 Ga0307409_100014278 3300031995 Bacteria 5157
476 Ga0307416_100008070 3300032002 Bacteria 6750
477 Ga0307416_100011450 3300032002 Bacteria 5917
478 Ga0307411_10026945 3300032005 Bacteria 3468
479 Ga0307415_100008244 3300032126 Bacteria 5766
480 Ga0373934_0000397 3300035086 Bacteria 15147
481 Ga0373934_0004935 3300035086 Bacteria 4940
482 Ga0373923_0007265 3300035111 Bacteria 3887
483 Ga0373953_0000890 3300035117 Bacteria 8362
484 Ga0373953_0027741 3300035117 Bacteria 2178
485 Ga0373954_0000772 3300035118 Bacteria 12332
486 Ga0373956_0000018 3300035119 Bacteria 50671
487 Ga0373956_0002888 3300035119 Bacteria 6954
488 Ga0373946_0021851 3300035171 Bacteria 2485
489 Ga0316574_0009848 3300035398 Bacteria 5373
490 Ga0373924_0006554 3300035410 Bacteria 4175
491 Ga0373931_0057809 3300035691 Bacteria 2081
492 Ga0373927_0010190 3300035695 Bacteria 6282
493 Ga0373933_0000035 3300035724 Bacteria 82702
494 Ga0373937_0048405 3300036401 Bacteria 3891
495 Ga0373937_0095074 3300036401 Bacteria 2763
496 Ga0373937_0102952 3300036401 Bacteria 2651
497 Ga0395900_0067298 3300037418 Bacteria 3680
498 Ga0439441_000155 3300042001 Bacteria 5942
499 Ga0439435_0002367 3300042436 Bacteria 3727
500 Ga0439444_0002677 3300042437 Bacteria 2459
501 Ga0439460_0000735 3300042461 Bacteria 7333
502 Ga0453683_0085703 3300044673 Bacteria 1974
503 Ga0453684_0000331 3300044712 Bacteria 197952
504 Ga0451576_0014607 3300045051 Bacteria 8729
505 Ga0466967_0002332 3300045976 Bacteria 11744
506 Ga0495629_0062757 3300046459 Bacteria 2595
507 Ga0495651_0008636 3300046462 Bacteria 7813
508 Ga0495582_0006387 3300046473 Bacteria 6551
509 Ga0495639_0010997 3300046475 Bacteria 3897
510 Ga0495639_0047009 3300046475 Bacteria 1954
511 Ga0495662_0011055 3300046476 Bacteria 4413
512 Ga0495628_0018175 3300046516 Bacteria 5830
513 Ga0495630_0004891 3300046517 Bacteria 9413
514 Ga0495665_0002238 3300046531 Bacteria 10474
515 Ga0495633_0006065 3300046558 Bacteria 7246
516 Ga0495634_0090566 3300046642 Bacteria 1986
517 Ga0495635_0019989 3300046663 Bacteria 4666
518 Ga0495657_0053334 3300046675 Bacteria 2706
519 Ga0495623_0021169 3300046679 Bacteria 4202
520 Ga0495647_0010361 3300046681 Bacteria 3171
521 Ga0495658_0020909 3300046683 Bacteria 3443
522 Ga0495613_0009879 3300046689 Bacteria 7094
523 Ga0495613_0048397 3300046689 Bacteria 3139
524 Ga0495600_0007282 3300046809 Bacteria 6759
525 Ga0495600_0052366 3300046809 Bacteria 2665
526 Ga0495674_0008982 3300047319 Bacteria 9496
527 Ga0495675_0006190 3300047444 Bacteria 7323
528 Ga0495593_0043140 3300047673 Bacteria 2419
529 Ga0496100_0021004 3300048903 Bacteria 3925
530 Ga0496100_0046877 3300048903 Bacteria 2782
531 Ga0496101_0009002 3300048904 Bacteria 6545
532 Ga0496101_0083339 3300048904 Bacteria 2367
533 Ga0496102_0002745 3300048905 Bacteria 15008
534 Ga0496102_0010791 3300048905 Bacteria 7868
535 Ga0496102_0013617 3300048905 Bacteria 7050
536 Ga0496103_0010149 3300048906 Bacteria 5569
537 Ga0496104_0011927 3300048907 Bacteria 7796
538 Ga0496105_0012325 3300048908 Bacteria 6769
539 Ga0496106_0002746 3300048909 Bacteria 13028
540 Ga0496106_0037319 3300048909 Bacteria 3635
541 Ga0496107_0014219 3300048910 Bacteria 5573
542 Ga0496107_0015023 3300048910 Bacteria 5424
543 Ga0496108_0021197 3300048911 Bacteria 5341
544 Ga0496108_0047549 3300048911 Bacteria 3586
545 Ga0496109_0003042 3300048912 Bacteria 13979
546 Ga0496109_0077449 3300048912 Bacteria 3060
547 Ga0496112_0001624 3300048915 Bacteria 17413
548 Ga0496112_0094268 3300048915 Bacteria 2964
549 Ga0496114_0013013 3300048917 Bacteria 6667
550 Ga0496114_0045159 3300048917 Bacteria 3659
551 Ga0496115_0109956 3300048918 Bacteria 2264
552 Ga0501038_0055372 3300049574 Bacteria 3407
553 Ga0501039_0008726 3300049575 Bacteria 7719
554 Ga0501041_0010354 3300049577 Bacteria 5495
555 Ga0501041_0010484 3300049577 Bacteria 5461
556 Ga0501043_0000058 3300049579 Bacteria 102030
557 Ga0501046_0000051 3300049580 Bacteria 133545
558 Ga0501047_0000003 3300049581 Bacteria 508375
559 Ga0501048_0001376 3300049582 Bacteria 18399
560 Ga0501070_0021699 3300049586 Bacteria 5384
561 Ga0501071_0050555 3300049587 Bacteria 2994
562 Ga0501072_0024456 3300049588 Bacteria 4698
563 Ga0501074_0005875 3300049590 Bacteria 8851
564 Ga0501075_0005228 3300049591 Bacteria 8872
565 Ga0501075_0067172 3300049591 Bacteria 2707
566 Ga0501076_0001236 3300049592 Bacteria 17015
567 Ga0501076_0005353 3300049592 Bacteria 9216
568 Ga0501077_0012008 3300049593 Bacteria 5421
569 Ga0501079_0085213 3300049741 Bacteria 2445
570 Ga0501081_0014871 3300049743 Bacteria 5134
571 Ga0501045_0032958 3300049824 Bacteria 3755
572 Ga0501045_0085770 3300049824 Bacteria 2324
573 nmdc:mga00v17_12012_c1 3300050491 Bacteria 4767
574 nmdc:mga09592_26986_c2 3300050508 Bacteria 3194
575 nmdc:mga09592_2820_c1 3300050508 Bacteria 14086
576 nmdc:mga0qj67_15349_c1 3300050509 Bacteria 5800
577 nmdc:mga06r32_66281_c1 3300050510 Bacteria 3484
578 nmdc:mga08y16_21040_c1 3300050511 Bacteria 6888
579 nmdc:mga08y16_90495_c1 3300050511 Bacteria 3190
580 nmdc:mga0n895_118898_c1 3300050512 Bacteria 2663
581 nmdc:mga0n895_21867_c1 3300050512 Bacteria 5989
582 nmdc:mga0n895_24771_c1 3300050512 Bacteria 5659
583 nmdc:mga0rr50_35512_c1 3300050513 Bacteria 3580
584 nmdc:mga08x19_13835_c1 3300050514 Bacteria 4887
585 nmdc:mga08x19_25511_c1 3300050514 Bacteria 3681
586 nmdc:mga0a205_33543_c1 3300050515 Bacteria 4922
587 Ga0495619_0034544 3300053085 Bacteria 3287
588 Ga0500636_0000320 3300053177 Bacteria 26563
589 Ga0501082_0048039 3300060353 Bacteria 3678
590 Ga0530510_0009845 3300061734 Bacteria 6706

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10077270 Ga0207712_100772703 474
2 3300048917 Ga0496114_0045159 Ga0496114_0045159_2134_3636 475
3 3300049743 Ga0501081_0014871 Ga0501081_0014871_3490_5100 496
4 3300046642 Ga0495634_0090566 Ga0495634_0090566_10_1671 508
5 3300048907 Ga0496104_0011927 Ga0496104_0011927_4972_6654 537
6 3300003775 Ga0055524_1003537 Ga0055524_10035378 547
7 3300044673 Ga0453683_0085703 Ga0453683_0085703_34_1809 563
8 3300049579 Ga0501043_0000058 Ga0501043_0000058_60614_62494 565
9 3300049580 Ga0501046_0000051 Ga0501046_0000051_39584_41464 565
10 3300049581 Ga0501047_0000003 Ga0501047_0000003_466940_468820 565
11 3300049582 Ga0501048_0001376 Ga0501048_0001376_8783_10663 565
12 3300005536 Ga0070697_100001076 Ga0070697_10000107619 566
13 3300006846 Ga0075430_100079425 Ga0075430_1000794253 567
14 3300046516 Ga0495628_0018175 Ga0495628_0018175_2836_4695 567
15 3300050508 nmdc:mga09592_26986_c2 nmdc:mga09592_26986_c2_723_2579 567
16 3300046517 Ga0495630_0004891 Ga0495630_0004891_1589_3448 570
17 3300047444 Ga0495675_0006190 Ga0495675_0006190_5304_7163 570
18 3300005343 Ga0070687_100051465 Ga0070687_1000514652 573
19 3300005719 Ga0068861_100087357 Ga0068861_1000873572 573
20 3300009094 Ga0111539_10162687 Ga0111539_101626872 573
21 3300028380 Ga0268265_10134039 Ga0268265_101340392 573
22 3300025925 Ga0207650_10050188 Ga0207650_100501882 574
23 3300035410 Ga0373924_0006554 Ga0373924_0006554_825_2678 574
24 3300046475 Ga0495639_0010997 Ga0495639_0010997_315_2174 574
25 3300046675 Ga0495657_0053334 Ga0495657_0053334_392_2251 574
26 3300046681 Ga0495647_0010361 Ga0495647_0010361_252_2111 574
27 3300046683 Ga0495658_0020909 Ga0495658_0020909_1478_3337 574
28 3300046689 Ga0495613_0048397 Ga0495613_0048397_190_2049 574
29 3300046809 Ga0495600_0052366 Ga0495600_0052366_579_2438 574
30 3300047319 Ga0495674_0008982 Ga0495674_0008982_2312_4171 574
31 3300053085 Ga0495619_0034544 Ga0495619_0034544_338_2197 574
32 3300005333 Ga0070677_10001330 Ga0070677_100013303 575
33 3300005338 Ga0068868_100007221 Ga0068868_1000072212 575
34 3300005347 Ga0070668_100016206 Ga0070668_1000162063 575
35 3300005355 Ga0070671_100010529 Ga0070671_1000105293 575
36 3300005364 Ga0070673_100001510 Ga0070673_10000151013 575
37 3300005456 Ga0070678_100001864 Ga0070678_1000018648 575
38 3300005457 Ga0070662_100006101 Ga0070662_1000061013 575
39 3300005543 Ga0070672_100010643 Ga0070672_1000106433 575
40 3300005546 Ga0070696_100084013 Ga0070696_1000840131 575
41 3300005616 Ga0068852_100002603 Ga0068852_10000260312 575
42 3300005842 Ga0068858_100009634 Ga0068858_1000096344 575
43 3300005843 Ga0068860_100011798 Ga0068860_1000117988 575
44 3300006237 Ga0097621_100005472 Ga0097621_1000054721 575
45 3300025893 Ga0207682_10001222 Ga0207682_100012229 575
46 3300025937 Ga0207669_10001618 Ga0207669_100016186 575
47 3300025960 Ga0207651_10020462 Ga0207651_100204624 575
48 3300026035 Ga0207703_10006351 Ga0207703_100063516 575
49 3300026142 Ga0207698_10012550 Ga0207698_100125502 575
50 3300049824 Ga0501045_0032958 Ga0501045_0032958_293_2140 576
51 3300006051 Ga0075364_10007219 Ga0075364_100072193 579
52 3300031711 Ga0265314_10042093 Ga0265314_100420932 579
53 iso_pu_bacteria 2643221554 2643790351 582
54 3300049575 Ga0501039_0008726 Ga0501039_0008726_3823_5688 583
55 3300049577 Ga0501041_0010484 Ga0501041_0010484_2309_4174 583
56 3300049591 Ga0501075_0005228 Ga0501075_0005228_1481_3346 583
57 3300049592 Ga0501076_0005353 Ga0501076_0005353_2331_4196 583
58 3300002739 JGI25158J39367_1001262 JGI25158J39367_10012622 585
59 3300002774 JGI25150J39212_1004937 JGI25150J39212_10049371 585
60 3300003790 Ga0055528_1009883 Ga0055528_10098832 585
61 3300005364 Ga0070673_100051153 Ga0070673_1000511532 586
62 3300005441 Ga0070700_100000816 Ga0070700_10000081615 586
63 3300005444 Ga0070694_100075697 Ga0070694_1000756972 586
64 3300005459 Ga0068867_100018356 Ga0068867_1000183564 586
65 3300005844 Ga0068862_100092767 Ga0068862_1000927672 586
66 3300006844 Ga0075428_100004485 Ga0075428_10000448512 586
67 3300006880 Ga0075429_100013978 Ga0075429_1000139784 586
68 3300006881 Ga0068865_100000771 Ga0068865_1000007715 586
69 3300009094 Ga0111539_10036136 Ga0111539_100361363 586
70 3300014745 Ga0157377_10010593 Ga0157377_100105932 586
71 3300025940 Ga0207691_10028978 Ga0207691_100289785 586
72 3300025960 Ga0207651_10033189 Ga0207651_100331892 586
73 3300026075 Ga0207708_10002136 Ga0207708_100021367 586
74 3300026089 Ga0207648_10056959 Ga0207648_100569592 586
75 3300026118 Ga0207675_100002550 Ga0207675_10000255015 586
76 3300027907 Ga0207428_10018006 Ga0207428_100180064 586
77 3300028380 Ga0268265_10000628 Ga0268265_1000062824 586
78 3300028380 Ga0268265_10002348 Ga0268265_1000234812 586
79 3300035086 Ga0373934_0000397 Ga0373934_0000397_12949_14805 586
80 3300035117 Ga0373953_0027741 Ga0373953_0027741_103_1959 586
81 3300035119 Ga0373956_0000018 Ga0373956_0000018_48378_50234 586
82 3300035724 Ga0373933_0000035 Ga0373933_0000035_50223_52079 586
83 3300045976 Ga0466967_0002332 Ga0466967_0002332_4031_5887 586
84 3300046462 Ga0495651_0008636 Ga0495651_0008636_441_2297 586
85 3300050508 nmdc:mga09592_2820_c1 nmdc:mga09592_2820_c1_2395_4260 586
86 3300050511 nmdc:mga08y16_21040_c1 nmdc:mga08y16_21040_c1_5011_6876 586
87 3300006844 Ga0075428_100030014 Ga0075428_1000300143 587
88 3300006846 Ga0075430_100012772 Ga0075430_1000127723 587
89 3300006847 Ga0075431_100064476 Ga0075431_1000644763 587
90 3300027395 Ga0209996_1002046 Ga0209996_10020462 587
91 3300031665 Ga0316575_10008484 Ga0316575_100084843 587
92 3300035398 Ga0316574_0009848 Ga0316574_0009848_3480_5339 587
93 3300042001 Ga0439441_000155 Ga0439441_000155_354_2240 587
94 3300042436 Ga0439435_0002367 Ga0439435_0002367_1640_3526 587
95 3300042437 Ga0439444_0002677 Ga0439444_0002677_22_1908 587
96 3300042461 Ga0439460_0000735 Ga0439460_0000735_982_2868 587
97 3300049574 Ga0501038_0055372 Ga0501038_0055372_882_2768 587
98 3300049577 Ga0501041_0010354 Ga0501041_0010354_2931_4817 587
99 3300049587 Ga0501071_0050555 Ga0501071_0050555_288_2174 587
100 3300049588 Ga0501072_0024456 Ga0501072_0024456_1725_3611 587
101 3300049591 Ga0501075_0067172 Ga0501075_0067172_645_2531 587
102 3300049592 Ga0501076_0001236 Ga0501076_0001236_5423_7309 587
103 3300049593 Ga0501077_0012008 Ga0501077_0012008_2554_4440 587
104 3300049741 Ga0501079_0085213 Ga0501079_0085213_222_2108 587
105 3300049824 Ga0501045_0085770 Ga0501045_0085770_349_2235 587
106 3300050509 nmdc:mga0qj67_15349_c1 nmdc:mga0qj67_15349_c1_3653_5512 587
107 3300050510 nmdc:mga06r32_66281_c1 nmdc:mga06r32_66281_c1_791_2650 587
108 3300060353 Ga0501082_0048039 Ga0501082_0048039_1301_3187 587
109 3300061734 Ga0530510_0009845 Ga0530510_0009845_1127_3013 587
110 iso_pu_bacteria 2574179768 2574429368 587
111 iso_pu_bacteria 2891633521 2891635564 587
112 3300025942 Ga0207689_10015645 Ga0207689_100156452 588
113 3300026075 Ga0207708_10013971 Ga0207708_100139713 588
114 3300026118 Ga0207675_100028188 Ga0207675_1000281882 588
115 3300031548 Ga0307408_100025686 Ga0307408_1000256863 588
116 3300031731 Ga0307405_10017861 Ga0307405_100178613 588
117 3300031852 Ga0307410_10004177 Ga0307410_100041772 588
118 3300031901 Ga0307406_10010231 Ga0307406_100102314 588
119 3300031903 Ga0307407_10002346 Ga0307407_100023466 588
120 3300031911 Ga0307412_10014385 Ga0307412_100143853 588
121 3300032002 Ga0307416_100011450 Ga0307416_1000114504 588
122 3300032005 Ga0307411_10026945 Ga0307411_100269453 588
123 3300050514 nmdc:mga08x19_25511_c1 nmdc:mga08x19_25511_c1_482_2320 588
124 3300048915 Ga0496112_0001624 Ga0496112_0001624_5748_7604 589
125 3300050491 nmdc:mga00v17_12012_c1 nmdc:mga00v17_12012_c1_1224_3089 589
126 iso_pu_bacteria 2547132512 2548847615 589
127 3300005329 Ga0070683_100011136 Ga0070683_1000111364 590
128 3300005330 Ga0070690_100005520 Ga0070690_1000055206 590
129 3300005331 Ga0070670_100008762 Ga0070670_1000087627 590
130 3300005334 Ga0068869_100034018 Ga0068869_1000340183 590
131 3300005335 Ga0070666_10025481 Ga0070666_100254812 590
132 3300005336 Ga0070680_100009608 Ga0070680_1000096082 590
133 3300005338 Ga0068868_100035463 Ga0068868_1000354632 590
134 3300005339 Ga0070660_100005315 Ga0070660_1000053157 590
135 3300005340 Ga0070689_100001989 Ga0070689_1000019897 590
136 3300005343 Ga0070687_100024753 Ga0070687_1000247531 590
137 3300005345 Ga0070692_10003283 Ga0070692_100032833 590
138 3300005355 Ga0070671_100064620 Ga0070671_1000646202 590
139 3300005364 Ga0070673_100000328 Ga0070673_10000032819 590
140 3300005365 Ga0070688_100008857 Ga0070688_1000088574 590
141 3300005366 Ga0070659_100013911 Ga0070659_1000139116 590
142 3300005437 Ga0070710_10010714 Ga0070710_100107143 590
143 3300005439 Ga0070711_100002929 Ga0070711_1000029295 590
144 3300005444 Ga0070694_100009912 Ga0070694_1000099124 590
145 3300005445 Ga0070708_100050988 Ga0070708_1000509882 590
146 3300005456 Ga0070678_100003405 Ga0070678_1000034056 590
147 3300005466 Ga0070685_10007091 Ga0070685_100070913 590
148 3300005467 Ga0070706_100019444 Ga0070706_1000194442 590
149 3300005468 Ga0070707_100057631 Ga0070707_1000576313 590
150 3300005518 Ga0070699_100010012 Ga0070699_1000100126 590
151 3300005535 Ga0070684_100013308 Ga0070684_1000133084 590
152 3300005536 Ga0070697_100058192 Ga0070697_1000581922 590
153 3300005547 Ga0070693_100000852 Ga0070693_1000008522 590
154 3300005563 Ga0068855_100138090 Ga0068855_1001380902 590
155 3300005578 Ga0068854_100036700 Ga0068854_1000367002 590
156 3300005617 Ga0068859_100007009 Ga0068859_1000070096 590
157 3300005618 Ga0068864_100021805 Ga0068864_1000218053 590
158 3300005841 Ga0068863_100022555 Ga0068863_1000225553 590
159 3300005842 Ga0068858_100007231 Ga0068858_1000072314 590
160 3300006173 Ga0070716_100012828 Ga0070716_1000128284 590
161 3300006358 Ga0068871_100057683 Ga0068871_1000576832 590
162 3300006914 Ga0075436_100038245 Ga0075436_1000382452 590
163 3300006931 Ga0097620_100007009 Ga0097620_1000070096 590
164 3300007076 Ga0075435_100006293 Ga0075435_1000062937 590
165 3300009098 Ga0105245_10100379 Ga0105245_101003792 590
166 3300009545 Ga0105237_10051202 Ga0105237_100512022 590
167 3300009551 Ga0105238_10015758 Ga0105238_100157587 590
168 3300010375 Ga0105239_10016466 Ga0105239_100164665 590
169 3300011119 Ga0105246_10052817 Ga0105246_100528171 590
170 3300013100 Ga0157373_10044324 Ga0157373_100443243 590
171 3300013104 Ga0157370_10007816 Ga0157370_100078168 590
172 3300013105 Ga0157369_10071836 Ga0157369_100718362 590
173 3300013296 Ga0157374_10001173 Ga0157374_1000117316 590
174 3300013307 Ga0157372_10188223 Ga0157372_101882232 590
175 3300013308 Ga0157375_10008337 Ga0157375_100083373 590
176 3300014325 Ga0163163_10041598 Ga0163163_100415982 590
177 3300014968 Ga0157379_10005995 Ga0157379_100059956 590
178 3300025898 Ga0207692_10022429 Ga0207692_100224292 590
179 3300025912 Ga0207707_10050499 Ga0207707_100504993 590
180 3300025915 Ga0207693_10000463 Ga0207693_1000046318 590
181 3300025915 Ga0207693_10008943 Ga0207693_100089433 590
182 3300025916 Ga0207663_10011310 Ga0207663_100113104 590
183 3300025919 Ga0207657_10002776 Ga0207657_100027762 590
184 3300025927 Ga0207687_10040418 Ga0207687_100404182 590
185 3300025927 Ga0207687_10041232 Ga0207687_100412322 590
186 3300025931 Ga0207644_10004473 Ga0207644_100044736 590
187 3300025933 Ga0207706_10077626 Ga0207706_100776262 590
188 3300025934 Ga0207686_10000801 Ga0207686_100008014 590
189 3300025939 Ga0207665_10016045 Ga0207665_100160454 590
190 3300025939 Ga0207665_10031471 Ga0207665_100314713 590
191 3300025941 Ga0207711_10005307 Ga0207711_100053076 590
192 3300025942 Ga0207689_10103523 Ga0207689_101035232 590
193 3300025944 Ga0207661_10097371 Ga0207661_100973712 590
194 3300025945 Ga0207679_10094338 Ga0207679_100943382 590
195 3300025949 Ga0207667_10087203 Ga0207667_100872032 590
196 3300025960 Ga0207651_10003339 Ga0207651_100033395 590
197 3300026023 Ga0207677_10004244 Ga0207677_100042443 590
198 3300026035 Ga0207703_10021728 Ga0207703_100217284 590
199 3300026078 Ga0207702_10001823 Ga0207702_1000182310 590
200 3300026088 Ga0207641_10001847 Ga0207641_100018472 590
201 3300026095 Ga0207676_10000377 Ga0207676_1000037718 590
202 3300026116 Ga0207674_10063978 Ga0207674_100639781 590
203 3300026121 Ga0207683_10000144 Ga0207683_1000014444 590
204 3300026142 Ga0207698_10113170 Ga0207698_101131702 590
205 3300028381 Ga0268264_10116712 Ga0268264_101167121 590
206 3300035086 Ga0373934_0004935 Ga0373934_0004935_2006_3847 590
207 3300035111 Ga0373923_0007265 Ga0373923_0007265_569_2410 590
208 3300035117 Ga0373953_0000890 Ga0373953_0000890_1026_2867 590
209 3300035118 Ga0373954_0000772 Ga0373954_0000772_2904_4745 590
210 3300035119 Ga0373956_0002888 Ga0373956_0002888_891_2732 590
211 3300036401 Ga0373937_0048405 Ga0373937_0048405_150_1991 590
212 3300046473 Ga0495582_0006387 Ga0495582_0006387_3734_5575 590
213 3300046475 Ga0495639_0047009 Ga0495639_0047009_16_1857 590
214 3300046476 Ga0495662_0011055 Ga0495662_0011055_1409_3250 590
215 3300046531 Ga0495665_0002238 Ga0495665_0002238_578_2419 590
216 3300046663 Ga0495635_0019989 Ga0495635_0019989_856_2697 590
217 3300046679 Ga0495623_0021169 Ga0495623_0021169_1333_3174 590
218 3300046689 Ga0495613_0009879 Ga0495613_0009879_2714_4555 590
219 3300046809 Ga0495600_0007282 Ga0495600_0007282_1413_3254 590
220 3300047673 Ga0495593_0043140 Ga0495593_0043140_365_2206 590
221 3300048903 Ga0496100_0021004 Ga0496100_0021004_1203_3044 590
222 3300048908 Ga0496105_0012325 Ga0496105_0012325_3847_5688 590
223 3300048909 Ga0496106_0037319 Ga0496106_0037319_469_2310 590
224 3300050512 nmdc:mga0n895_24771_c1 nmdc:mga0n895_24771_c1_1258_3114 590
225 3300050513 nmdc:mga0rr50_35512_c1 nmdc:mga0rr50_35512_c1_890_2731 590
226 3300050514 nmdc:mga08x19_13835_c1 nmdc:mga08x19_13835_c1_28_1884 590
227 3300050515 nmdc:mga0a205_33543_c1 nmdc:mga0a205_33543_c1_2546_4402 590
228 iso_pu_bacteria 639633007 639786022 590
229 3300005549 Ga0070704_100106872 Ga0070704_1001068721 591
230 3300025939 Ga0207665_10032101 Ga0207665_100321012 591
231 3300025940 Ga0207691_10012143 Ga0207691_100121433 592
232 3300031507 Ga0307509_10000105 Ga0307509_1000010523 592
233 3300044712 Ga0453684_0000331 Ga0453684_0000331_150141_152018 592
234 3300005293 Ga0065715_10106418 Ga0065715_101064182 593
235 3300005328 Ga0070676_10010596 Ga0070676_100105965 593
236 3300005333 Ga0070677_10019797 Ga0070677_100197972 593
237 3300005334 Ga0068869_100001603 Ga0068869_1000016034 593
238 3300005335 Ga0070666_10003422 Ga0070666_100034226 593
239 3300005353 Ga0070669_100001415 Ga0070669_1000014154 593
240 3300005355 Ga0070671_100025752 Ga0070671_1000257524 593
241 3300005364 Ga0070673_100015978 Ga0070673_1000159785 593
242 3300005367 Ga0070667_100002204 Ga0070667_1000022045 593
243 3300005445 Ga0070708_100005341 Ga0070708_1000053417 593
244 3300005459 Ga0068867_100001223 Ga0068867_1000012239 593
245 3300005467 Ga0070706_100012952 Ga0070706_1000129522 593
246 3300005518 Ga0070699_100045572 Ga0070699_1000455722 593
247 3300005543 Ga0070672_100000618 Ga0070672_10000061819 593
248 3300005548 Ga0070665_100002113 Ga0070665_1000021134 593
249 3300005617 Ga0068859_100011594 Ga0068859_1000115942 593
250 3300005617 Ga0068859_100080732 Ga0068859_1000807323 593
251 3300005618 Ga0068864_100021514 Ga0068864_1000215143 593
252 3300005841 Ga0068863_100076062 Ga0068863_1000760623 593
253 3300005842 Ga0068858_100002706 Ga0068858_1000027064 593
254 3300005843 Ga0068860_100006037 Ga0068860_1000060378 593
255 3300006237 Ga0097621_100004231 Ga0097621_1000042315 593
256 3300006931 Ga0097620_100011595 Ga0097620_1000115952 593
257 3300006931 Ga0097620_100080730 Ga0097620_1000807303 593
258 3300009177 Ga0105248_10008807 Ga0105248_100088073 593
259 3300013296 Ga0157374_10005247 Ga0157374_100052476 593
260 3300013306 Ga0163162_10005104 Ga0163162_1000510413 593
261 3300013308 Ga0157375_10012590 Ga0157375_100125904 593
262 3300025907 Ga0207645_10000530 Ga0207645_1000053017 593
263 3300025910 Ga0207684_10041819 Ga0207684_100418193 593
264 3300025922 Ga0207646_10062759 Ga0207646_100627593 593
265 3300025925 Ga0207650_10005770 Ga0207650_100057709 593
266 3300025926 Ga0207659_10001980 Ga0207659_1000198011 593
267 3300025940 Ga0207691_10001011 Ga0207691_1000101119 593
268 3300025942 Ga0207689_10007164 Ga0207689_100071645 593
269 3300025960 Ga0207651_10008658 Ga0207651_100086585 593
270 3300025972 Ga0207668_10079527 Ga0207668_100795272 593
271 3300025986 Ga0207658_10002303 Ga0207658_1000230310 593
272 3300026035 Ga0207703_10071744 Ga0207703_100717443 593
273 3300026088 Ga0207641_10001517 Ga0207641_100015178 593
274 3300026089 Ga0207648_10000126 Ga0207648_1000012613 593
275 3300026121 Ga0207683_10000959 Ga0207683_1000095916 593
276 3300028381 Ga0268264_10011904 Ga0268264_100119043 593
277 3300031238 Ga0265332_10000004 Ga0265332_1000000449 593
278 3300035695 Ga0373927_0010190 Ga0373927_0010190_640_2505 593
279 3300048904 Ga0496101_0083339 Ga0496101_0083339_143_1999 593
280 3300048911 Ga0496108_0021197 Ga0496108_0021197_762_2618 593
281 iso_pu_bacteria 2932422444 2932422510 593
282 3300005353 Ga0070669_100053672 Ga0070669_1000536722 594
283 3300005353 Ga0070669_100068288 Ga0070669_1000682882 594
284 3300005355 Ga0070671_100080033 Ga0070671_1000800332 594
285 3300005843 Ga0068860_100035111 Ga0068860_1000351113 594
286 3300005843 Ga0068860_100041400 Ga0068860_1000414004 594
287 3300005844 Ga0068862_100016512 Ga0068862_1000165126 594
288 3300009177 Ga0105248_10001255 Ga0105248_1000125530 594
289 3300009177 Ga0105248_10018851 Ga0105248_100188514 594
290 3300025923 Ga0207681_10009034 Ga0207681_100090343 594
291 3300025928 Ga0207700_10000455 Ga0207700_1000045513 594
292 3300025931 Ga0207644_10024466 Ga0207644_100244663 594
293 3300025941 Ga0207711_10023132 Ga0207711_100231323 594
294 3300025942 Ga0207689_10001031 Ga0207689_1000103111 594
295 3300026035 Ga0207703_10062643 Ga0207703_100626432 594
296 3300026089 Ga0207648_10040242 Ga0207648_100402425 594
297 3300026116 Ga0207674_10128471 Ga0207674_101284712 594
298 3300028380 Ga0268265_10043250 Ga0268265_100432502 594
299 3300028380 Ga0268265_10083710 Ga0268265_100837101 594
300 3300028381 Ga0268264_10073830 Ga0268264_100738302 594
301 3300031235 Ga0265330_10002161 Ga0265330_100021614 594
302 3300031238 Ga0265332_10000284 Ga0265332_1000028430 594
303 3300031242 Ga0265329_10009102 Ga0265329_100091023 594
304 3300031250 Ga0265331_10000415 Ga0265331_1000041526 594
305 3300031251 Ga0265327_10002711 Ga0265327_1000271113 594
306 3300031344 Ga0265316_10011426 Ga0265316_100114268 594
307 3300031711 Ga0265314_10003685 Ga0265314_1000368510 594
308 3300035171 Ga0373946_0021851 Ga0373946_0021851_18_1892 594
309 3300037418 Ga0395900_0067298 Ga0395900_0067298_446_2311 594
310 iso_pu_bacteria 2894023352 2894027794 594
311 3300005354 Ga0070675_100017996 Ga0070675_1000179962 595
312 3300005457 Ga0070662_100029733 Ga0070662_1000297333 595
313 3300005459 Ga0068867_100054812 Ga0068867_1000548122 595
314 3300005543 Ga0070672_100001738 Ga0070672_1000017384 595
315 3300009177 Ga0105248_10151969 Ga0105248_101519693 595
316 3300013308 Ga0157375_10060360 Ga0157375_100603602 595
317 3300025926 Ga0207659_10005968 Ga0207659_100059682 595
318 3300025940 Ga0207691_10002116 Ga0207691_100021168 595
319 3300026089 Ga0207648_10035320 Ga0207648_100353203 595
320 3300005328 Ga0070676_10030302 Ga0070676_100303023 596
321 3300005331 Ga0070670_100014387 Ga0070670_1000143875 596
322 3300005334 Ga0068869_100003167 Ga0068869_1000031677 596
323 3300005367 Ga0070667_100011630 Ga0070667_1000116304 596
324 3300005458 Ga0070681_10001659 Ga0070681_1000165911 596
325 3300005459 Ga0068867_100002515 Ga0068867_1000025156 596
326 3300005530 Ga0070679_100117383 Ga0070679_1001173831 596
327 3300005614 Ga0068856_100063423 Ga0068856_1000634232 596
328 3300005616 Ga0068852_100154751 Ga0068852_1001547511 596
329 3300005617 Ga0068859_100005851 Ga0068859_1000058513 596
330 3300005618 Ga0068864_100001193 Ga0068864_10000119313 596
331 3300005618 Ga0068864_100059736 Ga0068864_1000597362 596
332 3300005719 Ga0068861_100012072 Ga0068861_1000120721 596
333 3300005841 Ga0068863_100005071 Ga0068863_1000050718 596
334 3300005842 Ga0068858_100021920 Ga0068858_1000219201 596
335 3300005844 Ga0068862_100008440 Ga0068862_1000084406 596
336 3300006931 Ga0097620_100005851 Ga0097620_1000058513 596
337 3300009148 Ga0105243_10050726 Ga0105243_100507263 596
338 3300009177 Ga0105248_10031606 Ga0105248_100316062 596
339 3300014968 Ga0157379_10012613 Ga0157379_100126134 596
340 3300025907 Ga0207645_10038996 Ga0207645_100389962 596
341 3300025908 Ga0207643_10005162 Ga0207643_100051626 596
342 3300025921 Ga0207652_10159770 Ga0207652_101597701 596
343 3300025925 Ga0207650_10032028 Ga0207650_100320282 596
344 3300025941 Ga0207711_10055165 Ga0207711_100551652 596
345 3300025942 Ga0207689_10000003 Ga0207689_1000000353 596
346 3300025986 Ga0207658_10005483 Ga0207658_100054833 596
347 3300026023 Ga0207677_10015778 Ga0207677_100157783 596
348 3300026035 Ga0207703_10000987 Ga0207703_1000098711 596
349 3300026078 Ga0207702_10013792 Ga0207702_100137925 596
350 3300026088 Ga0207641_10004700 Ga0207641_100047006 596
351 3300026089 Ga0207648_10000442 Ga0207648_1000044231 596
352 3300026116 Ga0207674_10038883 Ga0207674_100388834 596
353 3300028380 Ga0268265_10009770 Ga0268265_100097704 596
354 3300028381 Ga0268264_10001089 Ga0268264_100010899 596
355 3300048905 Ga0496102_0010791 Ga0496102_0010791_4186_6051 596
356 3300048906 Ga0496103_0010149 Ga0496103_0010149_590_2455 596
357 3300048912 Ga0496109_0077449 Ga0496109_0077449_979_2844 596
358 3300005340 Ga0070689_100019475 Ga0070689_1000194753 597
359 3300005347 Ga0070668_100012194 Ga0070668_1000121945 597
360 3300005347 Ga0070668_100023760 Ga0070668_1000237602 597
361 3300005354 Ga0070675_100004574 Ga0070675_1000045743 597
362 3300005459 Ga0068867_100018020 Ga0068867_1000180203 597
363 3300005548 Ga0070665_100032024 Ga0070665_1000320245 597
364 3300005841 Ga0068863_100032443 Ga0068863_1000324434 597
365 3300006871 Ga0075434_100075710 Ga0075434_1000757103 597
366 3300009176 Ga0105242_10018528 Ga0105242_100185284 597
367 3300014325 Ga0163163_10055514 Ga0163163_100555143 597
368 3300014326 Ga0157380_10056113 Ga0157380_100561133 597
369 3300025923 Ga0207681_10016081 Ga0207681_100160812 597
370 3300025936 Ga0207670_10019328 Ga0207670_100193283 597
371 3300025940 Ga0207691_10006226 Ga0207691_100062263 597
372 3300026089 Ga0207648_10043114 Ga0207648_100431143 597
373 3300026095 Ga0207676_10032647 Ga0207676_100326474 597
374 3300026118 Ga0207675_100062447 Ga0207675_1000624472 597
375 3300028379 Ga0268266_10010702 Ga0268266_100107022 597
376 3300036401 Ga0373937_0095074 Ga0373937_0095074_18_1880 597
377 3300046558 Ga0495633_0006065 Ga0495633_0006065_3259_5151 597
378 3300048915 Ga0496112_0094268 Ga0496112_0094268_826_2688 597
379 3300048918 Ga0496115_0109956 Ga0496115_0109956_390_2252 597
380 3300050512 nmdc:mga0n895_118898_c1 nmdc:mga0n895_118898_c1_643_2505 597
381 3300053177 Ga0500636_0000320 Ga0500636_0000320_24637_26541 597
382 3300005339 Ga0070660_100006963 Ga0070660_1000069633 598
383 3300005339 Ga0070660_100017586 Ga0070660_1000175863 598
384 3300005344 Ga0070661_100002676 Ga0070661_1000026764 598
385 3300005347 Ga0070668_100081972 Ga0070668_1000819722 598
386 3300005354 Ga0070675_100002777 Ga0070675_1000027772 598
387 3300005366 Ga0070659_100008744 Ga0070659_1000087446 598
388 3300005366 Ga0070659_100011020 Ga0070659_1000110203 598
389 3300005367 Ga0070667_100010761 Ga0070667_1000107615 598
390 3300005435 Ga0070714_100023434 Ga0070714_1000234343 598
391 3300005435 Ga0070714_100105362 Ga0070714_1001053621 598
392 3300005437 Ga0070710_10051010 Ga0070710_100510101 598
393 3300005455 Ga0070663_100018113 Ga0070663_1000181133 598
394 3300005458 Ga0070681_10009268 Ga0070681_100092685 598
395 3300005459 Ga0068867_100002941 Ga0068867_1000029412 598
396 3300005518 Ga0070699_100032080 Ga0070699_1000320802 598
397 3300005530 Ga0070679_100081109 Ga0070679_1000811093 598
398 3300005535 Ga0070684_100008314 Ga0070684_1000083143 598
399 3300005535 Ga0070684_100024621 Ga0070684_1000246213 598
400 3300005546 Ga0070696_100009781 Ga0070696_1000097816 598
401 3300005548 Ga0070665_100020139 Ga0070665_1000201393 598
402 3300005563 Ga0068855_100002431 Ga0068855_10000243120 598
403 3300005564 Ga0070664_100000232 Ga0070664_10000023219 598
404 3300005577 Ga0068857_100000150 Ga0068857_10000015020 598
405 3300005614 Ga0068856_100015939 Ga0068856_1000159393 598
406 3300005614 Ga0068856_100022621 Ga0068856_1000226212 598
407 3300005614 Ga0068856_100076927 Ga0068856_1000769272 598
408 3300005616 Ga0068852_100002736 Ga0068852_1000027366 598
409 3300005618 Ga0068864_100004662 Ga0068864_1000046624 598
410 3300005834 Ga0068851_10006428 Ga0068851_100064283 598
411 3300005834 Ga0068851_10024417 Ga0068851_100244171 598
412 3300005840 Ga0068870_10006298 Ga0068870_100062982 598
413 3300005841 Ga0068863_100031853 Ga0068863_1000318533 598
414 3300006358 Ga0068871_100003356 Ga0068871_1000033568 598
415 3300006358 Ga0068871_100006707 Ga0068871_1000067072 598
416 3300006871 Ga0075434_100027426 Ga0075434_1000274263 598
417 3300009093 Ga0105240_10012137 Ga0105240_100121372 598
418 3300009093 Ga0105240_10113589 Ga0105240_101135892 598
419 3300009177 Ga0105248_10066758 Ga0105248_100667582 598
420 3300009545 Ga0105237_10031857 Ga0105237_100318574 598
421 3300009551 Ga0105238_10004955 Ga0105238_100049553 598
422 3300013100 Ga0157373_10011974 Ga0157373_100119742 598
423 3300013100 Ga0157373_10034594 Ga0157373_100345943 598
424 3300013102 Ga0157371_10056458 Ga0157371_100564582 598
425 3300013105 Ga0157369_10010212 Ga0157369_100102124 598
426 3300013105 Ga0157369_10010469 Ga0157369_100104695 598
427 3300013307 Ga0157372_10000985 Ga0157372_1000098529 598
428 3300013308 Ga0157375_10006967 Ga0157375_100069678 598
429 3300025321 Ga0207656_10006766 Ga0207656_100067663 598
430 3300025908 Ga0207643_10009075 Ga0207643_100090754 598
431 3300025912 Ga0207707_10002904 Ga0207707_1000290410 598
432 3300025913 Ga0207695_10011566 Ga0207695_100115668 598
433 3300025913 Ga0207695_10030233 Ga0207695_100302334 598
434 3300025919 Ga0207657_10009229 Ga0207657_100092295 598
435 3300025919 Ga0207657_10012006 Ga0207657_100120063 598
436 3300025919 Ga0207657_10026962 Ga0207657_100269623 598
437 3300025920 Ga0207649_10010084 Ga0207649_100100843 598
438 3300025924 Ga0207694_10006116 Ga0207694_100061168 598
439 3300025924 Ga0207694_10045922 Ga0207694_100459223 598
440 3300025929 Ga0207664_10004425 Ga0207664_100044258 598
441 3300025931 Ga0207644_10042633 Ga0207644_100426332 598
442 3300025932 Ga0207690_10002295 Ga0207690_100022955 598
443 3300025941 Ga0207711_10028179 Ga0207711_100281794 598
444 3300025945 Ga0207679_10014817 Ga0207679_100148173 598
445 3300025945 Ga0207679_10072490 Ga0207679_100724903 598
446 3300025949 Ga0207667_10003456 Ga0207667_100034566 598
447 3300025949 Ga0207667_10009543 Ga0207667_100095433 598
448 3300026067 Ga0207678_10005363 Ga0207678_100053639 598
449 3300026078 Ga0207702_10001905 Ga0207702_1000190517 598
450 3300026078 Ga0207702_10004335 Ga0207702_1000433510 598
451 3300026088 Ga0207641_10044037 Ga0207641_100440372 598
452 3300026089 Ga0207648_10000589 Ga0207648_1000058939 598
453 3300026095 Ga0207676_10011120 Ga0207676_100111203 598
454 3300026116 Ga0207674_10000369 Ga0207674_1000036920 598
455 3300026116 Ga0207674_10019115 Ga0207674_100191155 598
456 3300026142 Ga0207698_10002438 Ga0207698_100024386 598
457 3300045051 Ga0451576_0014607 Ga0451576_0014607_2409_4310 598
458 3300050512 nmdc:mga0n895_21867_c1 nmdc:mga0n895_21867_c1_575_2440 598
459 3300005367 Ga0070667_100050280 Ga0070667_1000502801 599
460 3300005459 Ga0068867_100013075 Ga0068867_1000130753 599
461 3300025899 Ga0207642_10024351 Ga0207642_100243512 599
462 3300026089 Ga0207648_10010389 Ga0207648_100103894 599
463 3300005459 Ga0068867_100079320 Ga0068867_1000793202 600
464 3300005548 Ga0070665_100016497 Ga0070665_1000164975 600
465 3300006237 Ga0097621_100069324 Ga0097621_1000693242 600
466 3300026089 Ga0207648_10082231 Ga0207648_100822313 600
467 3300026121 Ga0207683_10004945 Ga0207683_100049455 600
468 3300027717 Ga0209998_10003871 Ga0209998_100038713 600
469 3300027876 Ga0209974_10000366 Ga0209974_100003666 600
470 3300028379 Ga0268266_10041724 Ga0268266_100417241 600
471 3300049586 Ga0501070_0021699 Ga0501070_0021699_713_2689 600
472 3300049590 Ga0501074_0005875 Ga0501074_0005875_3863_5839 600
473 3300001977 JGI24746J21847_1002078 JGI24746J21847_10020782 601
474 3300002075 JGI24738J21930_10008049 JGI24738J21930_100080492 601
475 3300002076 JGI24749J21850_1001582 JGI24749J21850_10015823 601
476 3300002077 JGI24744J21845_10006896 JGI24744J21845_100068962 601
477 3300002239 JGI24034J26672_10002490 JGI24034J26672_100024902 601
478 3300005293 Ga0065715_10099723 Ga0065715_100997232 601
479 3300005329 Ga0070683_100012394 Ga0070683_1000123945 601
480 3300005330 Ga0070690_100001622 Ga0070690_1000016224 601
481 3300005331 Ga0070670_100058176 Ga0070670_1000581763 601
482 3300005331 Ga0070670_100072954 Ga0070670_1000729543 601
483 3300005333 Ga0070677_10004494 Ga0070677_100044943 601
484 3300005334 Ga0068869_100020382 Ga0068869_1000203822 601
485 3300005339 Ga0070660_100010635 Ga0070660_1000106355 601
486 3300005339 Ga0070660_100027115 Ga0070660_1000271153 601
487 3300005340 Ga0070689_100004833 Ga0070689_1000048334 601
488 3300005353 Ga0070669_100030011 Ga0070669_1000300113 601
489 3300005355 Ga0070671_100038012 Ga0070671_1000380122 601
490 3300005355 Ga0070671_100085895 Ga0070671_1000858952 601
491 3300005365 Ga0070688_100001281 Ga0070688_1000012815 601
492 3300005366 Ga0070659_100000775 Ga0070659_1000007759 601
493 3300005366 Ga0070659_100053304 Ga0070659_1000533043 601
494 3300005438 Ga0070701_10011312 Ga0070701_100113124 601
495 3300005441 Ga0070700_100012660 Ga0070700_1000126603 601
496 3300005459 Ga0068867_100011384 Ga0068867_1000113842 601
497 3300005466 Ga0070685_10002100 Ga0070685_100021005 601
498 3300005535 Ga0070684_100024579 Ga0070684_1000245792 601
499 3300005539 Ga0068853_100031794 Ga0068853_1000317943 601
500 3300005544 Ga0070686_100007051 Ga0070686_1000070513 601
501 3300005548 Ga0070665_100016657 Ga0070665_1000166575 601
502 3300005563 Ga0068855_100026060 Ga0068855_1000260602 601
503 3300005564 Ga0070664_100002189 Ga0070664_10000218910 601
504 3300005564 Ga0070664_100006956 Ga0070664_1000069567 601
505 3300005577 Ga0068857_100003300 Ga0068857_1000033003 601
506 3300005578 Ga0068854_100003871 Ga0068854_1000038715 601
507 3300005614 Ga0068856_100000121 Ga0068856_10000012157 601
508 3300005615 Ga0070702_100004941 Ga0070702_1000049413 601
509 3300005616 Ga0068852_100023842 Ga0068852_1000238424 601
510 3300005617 Ga0068859_100018722 Ga0068859_1000187223 601
511 3300005618 Ga0068864_100002176 Ga0068864_1000021762 601
512 3300005718 Ga0068866_10001297 Ga0068866_100012978 601
513 3300005719 Ga0068861_100048238 Ga0068861_1000482382 601
514 3300005834 Ga0068851_10005887 Ga0068851_100058872 601
515 3300005840 Ga0068870_10001159 Ga0068870_100011598 601
516 3300005841 Ga0068863_100024596 Ga0068863_1000245963 601
517 3300005842 Ga0068858_100011839 Ga0068858_1000118393 601
518 3300005843 Ga0068860_100036564 Ga0068860_1000365643 601
519 3300005844 Ga0068862_100030923 Ga0068862_1000309232 601
520 3300006881 Ga0068865_100041607 Ga0068865_1000416072 601
521 3300006931 Ga0097620_100018724 Ga0097620_1000187243 601
522 3300009094 Ga0111539_10019136 Ga0111539_100191363 601
523 3300009553 Ga0105249_10042235 Ga0105249_100422353 601
524 3300013100 Ga0157373_10000313 Ga0157373_1000031341 601
525 3300013102 Ga0157371_10001031 Ga0157371_1000103118 601
526 3300013104 Ga0157370_10002415 Ga0157370_1000241515 601
527 3300013296 Ga0157374_10016090 Ga0157374_100160905 601
528 3300013306 Ga0163162_10063648 Ga0163162_100636482 601
529 3300014325 Ga0163163_10004614 Ga0163163_100046145 601
530 3300014326 Ga0157380_10005087 Ga0157380_100050874 601
531 3300014745 Ga0157377_10004602 Ga0157377_100046023 601
532 3300014968 Ga0157379_10049691 Ga0157379_100496912 601
533 3300017792 Ga0163161_10050562 Ga0163161_100505623 601
534 3300025271 Ga0207666_1000621 Ga0207666_10006213 601
535 3300025893 Ga0207682_10000731 Ga0207682_100007319 601
536 3300025903 Ga0207680_10021684 Ga0207680_100216842 601
537 3300025907 Ga0207645_10003858 Ga0207645_1000385810 601
538 3300025908 Ga0207643_10000267 Ga0207643_1000026712 601
539 3300025918 Ga0207662_10006514 Ga0207662_100065142 601
540 3300025919 Ga0207657_10000995 Ga0207657_100009953 601
541 3300025919 Ga0207657_10023022 Ga0207657_100230222 601
542 3300025920 Ga0207649_10001599 Ga0207649_1000159910 601
543 3300025920 Ga0207649_10021813 Ga0207649_100218132 601
544 3300025923 Ga0207681_10045524 Ga0207681_100455242 601
545 3300025925 Ga0207650_10002076 Ga0207650_1000207611 601
546 3300025925 Ga0207650_10034011 Ga0207650_100340112 601
547 3300025926 Ga0207659_10019297 Ga0207659_100192972 601
548 3300025931 Ga0207644_10003838 Ga0207644_100038384 601
549 3300025931 Ga0207644_10026764 Ga0207644_100267642 601
550 3300025931 Ga0207644_10051893 Ga0207644_100518932 601
551 3300025932 Ga0207690_10002015 Ga0207690_100020153 601
552 3300025933 Ga0207706_10000644 Ga0207706_1000064413 601
553 3300025936 Ga0207670_10023141 Ga0207670_100231412 601
554 3300025937 Ga0207669_10000673 Ga0207669_100006733 601
555 3300025938 Ga0207704_10019351 Ga0207704_100193513 601
556 3300025940 Ga0207691_10007167 Ga0207691_100071675 601
557 3300025941 Ga0207711_10065246 Ga0207711_100652463 601
558 3300025942 Ga0207689_10001154 Ga0207689_1000115419 601
559 3300025944 Ga0207661_10020377 Ga0207661_100203773 601
560 3300025944 Ga0207661_10035846 Ga0207661_100358462 601
561 3300025945 Ga0207679_10006231 Ga0207679_100062316 601
562 3300025945 Ga0207679_10018627 Ga0207679_100186272 601
563 3300025949 Ga0207667_10001918 Ga0207667_1000191815 601
564 3300025972 Ga0207668_10022978 Ga0207668_100229783 601
565 3300025981 Ga0207640_10022374 Ga0207640_100223742 601
566 3300025986 Ga0207658_10035829 Ga0207658_100358292 601
567 3300026035 Ga0207703_10029206 Ga0207703_100292063 601
568 3300026041 Ga0207639_10087382 Ga0207639_100873822 601
569 3300026067 Ga0207678_10002008 Ga0207678_1000200810 601
570 3300026075 Ga0207708_10013301 Ga0207708_100133013 601
571 3300026078 Ga0207702_10002122 Ga0207702_1000212215 601
572 3300026089 Ga0207648_10007227 Ga0207648_100072278 601
573 3300026095 Ga0207676_10022772 Ga0207676_100227724 601
574 3300026116 Ga0207674_10003357 Ga0207674_1000335716 601
575 3300026118 Ga0207675_100003777 Ga0207675_1000037779 601
576 3300026121 Ga0207683_10008777 Ga0207683_100087778 601
577 3300031731 Ga0307405_10009760 Ga0307405_100097604 601
578 3300031824 Ga0307413_10003113 Ga0307413_100031134 601
579 3300031852 Ga0307410_10000921 Ga0307410_100009216 601
580 3300031901 Ga0307406_10006332 Ga0307406_100063323 601
581 3300031995 Ga0307409_100014278 Ga0307409_1000142784 601
582 3300032002 Ga0307416_100008070 Ga0307416_1000080706 601
583 3300032126 Ga0307415_100008244 Ga0307415_1000082443 601
584 3300035691 Ga0373931_0057809 Ga0373931_0057809_131_2008 601
585 3300036401 Ga0373937_0102952 Ga0373937_0102952_706_2580 601
586 3300046459 Ga0495629_0062757 Ga0495629_0062757_220_2094 601
587 3300048903 Ga0496100_0046877 Ga0496100_0046877_676_2550 601
588 3300048904 Ga0496101_0009002 Ga0496101_0009002_614_2488 601
589 3300048905 Ga0496102_0002745 Ga0496102_0002745_4543_6420 601
590 3300048905 Ga0496102_0013617 Ga0496102_0013617_4698_6572 601
591 3300048909 Ga0496106_0002746 Ga0496106_0002746_510_2387 601
592 3300048910 Ga0496107_0014219 Ga0496107_0014219_2726_4600 601
593 3300048910 Ga0496107_0015023 Ga0496107_0015023_3143_5020 601
594 3300048911 Ga0496108_0047549 Ga0496108_0047549_1296_3170 601
595 3300048912 Ga0496109_0003042 Ga0496109_0003042_8780_10654 601
596 3300048917 Ga0496114_0013013 Ga0496114_0013013_729_2603 601
597 3300050511 nmdc:mga08y16_90495_c1 nmdc:mga08y16_90495_c1_1017_2891 601

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21760

SecD_1st

Protein translocase subunit SecDF, P1 domain, N-terminal

231

290

0.98

PF13721

SecD-TM1

SecD export protein N-terminal TM region

1

105

0.97

PF22599

SecDF_P1_head

SecDF, P1 head subdomain

310

426

0.96

PF07549

Sec_GG

SecD/SecF GG Motif

117

143

0.92

PF02355

SecD_SecF

Protein export membrane protein

421

601

0.91

PF03176

MMPL

MMPL family

455

625

0.79

Feature Viewer

pLDDT pTM Quality
71.91 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map