F467685

General Info

Members Datasets Scaffolds Average Seq Length
597 337 521 275

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0103618|Ga0395900_0103618_1304_2197
Length 297
Sequence MASNKLLLITGVSSGFGHALARQALADGHRVVGTVRNAQAAESFEALCRGRAHARLLDVTQFDAIDDVVADIEANVGPVDILVNNAGYGHEGILEESPLSDLRRQFDVNVFGPVAMMKAVLPFMRARRRGHILNITSMGGYITMPGIAYYCGSKFALEGISDTLAKEVQPFGIAVTAIAPGSFRTDWAGRSMQRTPRSIADYDALFDPVRKAREEKNGKQLGDPAKAARALLAIIQAEAPPTHLLLGSDALHLVRSKLADLTRNLDLWEEVTTSTDMSSLHSPNRKNSSVWNDPRKL

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
12 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
15 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
16 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
17 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
20 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
21 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
22 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
23 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
24 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
25 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
26 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
27 2643221556 Massilia sp. Root1485 Isolate Unclassified
28 2643221684 Massilia sp. Root133 Isolate Unclassified
29 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
30 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
31 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
32 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
33 2739367700 Dyella sp. YR388 Isolate Unclassified
34 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
35 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
36 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
37 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
38 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
39 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
40 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
41 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
42 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
43 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
44 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
45 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
46 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
47 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
48 2855730933 Achromobacter sp. HZ28 Isolate Nodule
49 2855767633 Achromobacter sp. HZ34 Isolate Nodule
50 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
51 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
52 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
53 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
54 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
55 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
56 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
57 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
58 2904564687 Burkholderia sp. 571 Isolate Unclassified
59 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
60 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
61 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
62 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
63 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
64 2928536128 Burkholderia sola 565 Isolate Unclassified
65 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
66 2937967321 Serratia sp. YC16 Isolate Unclassified
67 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
68 2941471342 Luteibacter sp. 621 Isolate Unclassified
69 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
70 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
71 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
72 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
73 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
74 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
77 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
80 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
81 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
82 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
83 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
84 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
85 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
86 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
87 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
88 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
89 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
90 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
91 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
92 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
93 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
94 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
95 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
96 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
97 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
98 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
127 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
195 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
196 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
197 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
320 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
321 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
322 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
325 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
330 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
331 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
332 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
333 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
334 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
335 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
336 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
337 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.27
Metatranscriptomes 0
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.58
Nodule 3.35
Rhizoplane 4.52
Rhizosphere 62.65
Stem 0
Stem Tuber 0
Unclassified 13.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001724 3300001904 Bacteria 3941
2 JGI24739J22299_10006189 3300001989 Bacteria 4519
3 JGI24737J22298_10000893 3300001990 Bacteria 10621
4 JGI25162J39368_1004421 3300002737 Bacteria 3276
5 JGI25152J39213_1003813 3300002773 Bacteria 4995
6 JGI25159J45721_1000427 3300002987 Bacteria 19387
7 JGI25153J46596_10008267 3300003215 Bacteria 4995
8 rootL2_10057614 3300003322 Bacteria 2916
9 rootL2_10121717 3300003322 Bacteria 4084
10 rootH1_10141536 3300003323 Bacteria 5852
11 JGI25160J50197_1000012 3300003354 Bacteria 267582
12 JGI25161J50226_1000002 3300003374 Bacteria 420324
13 Ga0055538_1000019 3300003751 Bacteria 282365
14 Ga0055539_1000024 3300003752 Bacteria 282365
15 Ga0055533_1000032 3300003756 Bacteria 282365
16 Ga0055533_1001916 3300003756 Bacteria 5138
17 Ga0055525_1000041 3300003759 Bacteria 282365
18 Ga0055527_1003675 3300003760 Bacteria 2224
19 Ga0055526_1000618 3300003771 Bacteria 27611
20 Ga0055526_1002058 3300003771 Bacteria 13825
21 Ga0055526_1018145 3300003771 Bacteria 2643
22 Ga0055537_1000600 3300003773 Bacteria 20010
23 Ga0055537_1001733 3300003773 Bacteria 8052
24 Ga0055524_1000607 3300003775 Bacteria 25734
25 Ga0055524_1002359 3300003775 Bacteria 9823
26 Ga0055524_1002882 3300003775 Bacteria 8610
27 Ga0055534_1000409 3300003784 Bacteria 26375
28 Ga0055528_1002313 3300003790 Bacteria 10323
29 Ga0055530_10002435 3300003791 Bacteria 12016
30 Ga0055540_1000023 3300003792 Bacteria 201131
31 Ga0055540_1000240 3300003792 Bacteria 50063
32 Ga0055540_1004561 3300003792 Bacteria 6168
33 Ga0055531_10016451 3300003794 Bacteria 3189
34 Ga0055541_1000018 3300003841 Bacteria 282365
35 Ga0055541_1005666 3300003841 Bacteria 2169
36 Ga0055543_1000050 3300004625 Bacteria 107366
37 Ga0070683_100030508 3300005329 Bacteria 4895
38 Ga0070680_100116054 3300005336 Bacteria 2231
39 Ga0070661_100002593 3300005344 Bacteria 12392
40 Ga0070659_100002014 3300005366 Bacteria 14521
41 Ga0070667_100000010 3300005367 Bacteria 273500
42 Ga0070663_100000413 3300005455 Bacteria 22436
43 Ga0070663_100063668 3300005455 Bacteria 2664
44 Ga0070663_100217323 3300005455 Bacteria 1499
45 Ga0070662_100001814 3300005457 Bacteria 13128
46 Ga0070681_10032130 3300005458 Bacteria 5268
47 Ga0068853_100025864 3300005539 Bacteria 4927
48 Ga0070665_100335385 3300005548 Bacteria 1517
49 Ga0068855_100220641 3300005563 Bacteria 2126
50 Ga0070717_10004621 3300006028 Bacteria 9976
51 Ga0075364_10001122 3300006051 Bacteria 14302
52 Ga0079104_1000333 3300006946 Bacteria 57718
53 Ga0099826_10000046 3300006948 Bacteria 75105
54 Ga0105251_10034837 3300009011 Bacteria 2488
55 Ga0105240_10009708 3300009093 Bacteria 13588
56 Ga0105240_10278976 3300009093 Bacteria 1920
57 Ga0105240_10286863 3300009093 Bacteria 1889
58 Ga0105240_10444745 3300009093 Bacteria 1452
59 Ga0105242_10309569 3300009176 Bacteria 1445
60 Ga0105248_10000240 3300009177 Bacteria 63265
61 Ga0105248_10122284 3300009177 Bacteria 2936
62 Ga0105248_10145626 3300009177 Unclassified 2673
63 Ga0105237_10000652 3300009545 Bacteria 48467
64 Ga0105237_10008925 3300009545 Bacteria 10798
65 Ga0105249_10000226 3300009553 Bacteria 64018
66 Ga0105239_10006412 3300010375 Bacteria 13657
67 Ga0157370_10068101 3300013104 Bacteria 3364
68 Ga0157370_10079805 3300013104 Bacteria 3081
69 Ga0157369_10053790 3300013105 Bacteria 4349
70 Ga0163162_10006013 3300013306 Bacteria 11745
71 Ga0182008_10000421 3300014497 Bacteria 32709
72 Ga0182008_10012129 3300014497 Bacteria 4557
73 Ga0182006_1015996 3300015261 Bacteria 3205
74 Ga0182006_1041833 3300015261 Bacteria 1798
75 Ga0182006_1068655 3300015261 Bacteria 1319
76 Ga0182006_1080115 3300015261 Bacteria 1193
77 Ga0182007_10000279 3300015262 Bacteria 33868
78 Ga0182007_10004019 3300015262 Bacteria 6785
79 Ga0182007_10006638 3300015262 Bacteria 4953
80 Ga0182005_1032684 3300015265 Bacteria 1416
81 Ga0183368_1002 3300015687 Bacteria 1865598
82 Ga0183360_10001 3300015689 Bacteria 3943671
83 Ga0213872_10001611 3300021361 Bacteria 14275
84 Ga0213872_10006306 3300021361 Bacteria 5978
85 Ga0209760_103311 3300025207 Bacteria 1438
86 Ga0209784_100009 3300025224 Bacteria 688031
87 Ga0209784_100010 3300025224 Bacteria 683664
88 Ga0209566_100007 3300025225 Bacteria 688031
89 Ga0209566_100008 3300025225 Bacteria 683664
90 Ga0209566_100220 3300025225 Bacteria 56957
91 Ga0209674_100016 3300025226 Bacteria 696756
92 Ga0209674_100018 3300025226 Bacteria 688031
93 Ga0209674_100019 3300025226 Bacteria 683664
94 Ga0209674_101276 3300025226 Bacteria 7021
95 Ga0209674_102528 3300025226 Bacteria 3865
96 Ga0209672_100644 3300025228 Bacteria 17971
97 Ga0209563_100020 3300025230 Bacteria 688031
98 Ga0209563_100021 3300025230 Bacteria 683764
99 Ga0207427_100991 3300025231 Bacteria 11960
100 Ga0209437_100019 3300025233 Bacteria 683764
101 Ga0209437_112438 3300025233 Bacteria 1241
102 Ga0209677_100010 3300025253 Bacteria 688031
103 Ga0209677_100011 3300025253 Bacteria 683664
104 Ga0209148_1003324 3300025254 Bacteria 4531
105 Ga0209129_1000535 3300025258 Bacteria 26444
106 Ga0209233_1000025 3300025261 Bacteria 683764
107 Ga0209565_1000003 3300025263 Bacteria 1099648
108 Ga0209565_1000094 3300025263 Bacteria 134853
109 Ga0209455_1002471 3300025272 Bacteria 7106
110 Ga0209673_1000003 3300025273 Bacteria 980859
111 Ga0209130_1000028 3300025284 Bacteria 325668
112 Ga0209675_1000003 3300025291 Bacteria 1003982
113 Ga0209676_1000068 3300025292 Bacteria 314068
114 Ga0209676_1006666 3300025292 Bacteria 5629
115 Ga0209676_1021191 3300025292 Bacteria 2189
116 Ga0209564_1000509 3300025295 Bacteria 63951
117 Ga0209564_1000614 3300025295 Bacteria 54746
118 Ga0209758_1001399 3300025297 Bacteria 28640
119 Ga0209758_1014100 3300025297 Bacteria 4286
120 Ga0209050_1000287 3300025298 Bacteria 106507
121 Ga0209050_1001298 3300025298 Bacteria 28251
122 Ga0209050_1003335 3300025298 Bacteria 11970
123 Ga0209256_1000029 3300025299 Bacteria 415922
124 Ga0209256_1001721 3300025299 Bacteria 20987
125 Ga0209256_1010972 3300025299 Bacteria 3703
126 Ga0207426_1000012 3300025302 Bacteria 730942
127 Ga0209051_1000079 3300025303 Bacteria 201183
128 Ga0209051_1000199 3300025303 Bacteria 106517
129 Ga0209051_1055135 3300025303 Bacteria 1292
130 Ga0209257_1000183 3300025304 Bacteria 156618
131 Ga0209257_1007945 3300025304 Bacteria 6219
132 Ga0207655_1000322 3300025728 Bacteria 70535
133 Ga0207647_10000196 3300025904 Bacteria 49500
134 Ga0207647_10030710 3300025904 Bacteria 3464
135 Ga0207647_10056669 3300025904 Bacteria 2404
136 Ga0207647_10099990 3300025904 Bacteria 1722
137 Ga0207707_10018916 3300025912 Bacteria 6005
138 Ga0207695_10012652 3300025913 Bacteria 10108
139 Ga0207695_10015040 3300025913 Bacteria 9132
140 Ga0207671_10004902 3300025914 Bacteria 12573
141 Ga0207671_10006203 3300025914 Bacteria 10730
142 Ga0207657_10012791 3300025919 Bacteria 8259
143 Ga0207649_10002545 3300025920 Bacteria 10151
144 Ga0207652_10512561 3300025921 Bacteria 1079
145 Ga0207690_10003042 3300025932 Bacteria 10100
146 Ga0207706_10009190 3300025933 Bacteria 9081
147 Ga0207709_10006106 3300025935 Bacteria 6786
148 Ga0207711_10000860 3300025941 Bacteria 29387
149 Ga0207661_10031964 3300025944 Bacteria 4072
150 Ga0207667_10056417 3300025949 Bacteria 4127
151 Ga0207712_10000141 3300025961 Bacteria 75812
152 Ga0207658_10000297 3300025986 Bacteria 52019
153 Ga0207639_10028174 3300026041 Bacteria 4099
154 Ga0207678_10000223 3300026067 Bacteria 50785
155 Ga0207678_10089893 3300026067 Bacteria 2625
156 Ga0207678_10166859 3300026067 Bacteria 1880
157 Ga0207683_10251162 3300026121 Bacteria 1614
158 Ga0209281_1000322 3300027111 Bacteria 84374
159 Ga0209371_1002265 3300027312 Bacteria 11029
160 Ga0209371_1006679 3300027312 Bacteria 4208
161 Ga0209371_1011230 3300027312 Bacteria 2674
162 Ga0209282_1000011 3300027666 Bacteria 217665
163 Ga0268266_10036078 3300028379 Bacteria 4206
164 Ga0268266_10150630 3300028379 Bacteria 2096
165 Ga0268266_10212231 3300028379 Bacteria 1776
166 Ga0307517_10160444 3300028786 Bacteria 1511
167 Ga0268256_1002005 3300030500 Bacteria 11029
168 Ga0268256_1006761 3300030500 Bacteria 4208
169 Ga0268256_1012185 3300030500 Bacteria 2674
170 Ga0316183_1048625 3300030742 Bacteria 7746
171 Ga0307412_10011865 3300031911 Bacteria 5060
172 Ga0307409_100105249 3300031995 Bacteria 2352
173 Ga0307416_100086071 3300032002 Bacteria 2678
174 Ga0395899_0002835 3300037312 Bacteria 13961
175 Ga0395899_0005349 3300037312 Bacteria 9973
176 Ga0395899_0014986 3300037312 Bacteria 5913
177 Ga0395899_0071705 3300037312 Bacteria 2535
178 Ga0395899_0116867 3300037312 Bacteria 1913
179 Ga0395900_0011239 3300037418 Bacteria 9155
180 Ga0395900_0034627 3300037418 Bacteria 5201
181 Ga0395900_0063807 3300037418 Bacteria 3786
182 Ga0395900_0103618 3300037418 Bacteria 2922
183 Ga0395898_0036832 3300037466 Bacteria 4855
184 Ga0395898_0125160 3300037466 Bacteria 2462
185 Ga0395898_0135857 3300037466 Bacteria 2354
186 Ga0395905_0000864 3300037471 Bacteria 39520
187 Ga0395905_0037101 3300037471 Bacteria 4577
188 Ga0395905_0124819 3300037471 Bacteria 2420
189 Ga0395905_0159905 3300037471 Bacteria 2117
190 Ga0395901_0000009 3300038443 Bacteria 479396
191 Ga0395901_0000122 3300038443 Bacteria 100003
192 Ga0395901_0013989 3300038443 Bacteria 8166
193 Ga0395901_0018611 3300038443 Bacteria 7094
194 Ga0436361_0204659 3300039447 Bacteria 10676
195 Ga0436361_0234917 3300039447 Bacteria 14328
196 Ga0436361_0860790 3300039447 Bacteria 5296
197 Ga0451797_1290501 3300041453 Bacteria 1451
198 Ga0451795_0693632 3300041456 Bacteria 4113
199 Ga0451800_1495546 3300041459 Bacteria 4092
200 Ga0451802_0538624 3300041460 Bacteria 2984
201 Ga0451807_0295110 3300041486 Bacteria 3508
202 Ga0451855_0476812 3300041511 Bacteria 1100
203 Ga0439451_000430 3300042009 Bacteria 8194
204 Ga0439456_001098 3300042013 Bacteria 5366
205 Ga0439456_001555 3300042013 Bacteria 4623
206 Ga0439463_006543 3300042016 Bacteria 2887
207 Ga0466972_0138656 3300044658 Bacteria 1145
208 Ga0466982_0000040 3300044672 Bacteria 41234
209 Ga0466982_0096822 3300044672 Bacteria 1828
210 Ga0466965_0014160 3300044683 Bacteria 3774
211 Ga0466965_0103556 3300044683 Bacteria 1457
212 Ga0466966_0000043 3300044684 Bacteria 93998
213 Ga0466966_0086778 3300044684 Bacteria 1945
214 Ga0466966_0229381 3300044684 Bacteria 1120
215 Ga0466961_0000276 3300044693 Bacteria 34281
216 Ga0466961_0000399 3300044693 Bacteria 27917
217 Ga0466961_0001254 3300044693 Bacteria 15642
218 Ga0466961_0002248 3300044693 Bacteria 12016
219 Ga0466961_0021631 3300044693 Bacteria 4138
220 Ga0466961_0084273 3300044693 Bacteria 2010
221 Ga0466963_0013925 3300044694 Bacteria 4953
222 Ga0466971_0006143 3300044719 Bacteria 5222
223 Ga0466971_0018270 3300044719 Bacteria 3105
224 Ga0466970_0025215 3300044765 Bacteria 3113
225 Ga0466957_0034600 3300044842 Bacteria 3030
226 Ga0466957_0034805 3300044842 Bacteria 3021
227 Ga0466957_0276053 3300044842 Bacteria 1123
228 Ga0466959_0000058 3300045049 Bacteria 77145
229 Ga0466959_0006194 3300045049 Bacteria 8265
230 Ga0466959_0014441 3300045049 Bacteria 5737
231 Ga0466959_0061661 3300045049 Bacteria 2726
232 Ga0466959_0538980 3300045049 Bacteria 787
233 Ga0466958_0003683 3300045836 Bacteria 7999
234 Ga0466958_0004961 3300045836 Bacteria 7099
235 Ga0466958_0009639 3300045836 Bacteria 5387
236 Ga0466958_0011537 3300045836 Bacteria 4977
237 Ga0495617_000004 3300046452 Bacteria 511274
238 Ga0495627_000001 3300046453 Bacteria 1104709
239 Ga0495592_0003426 3300046454 Bacteria 11380
240 Ga0495603_0024474 3300046455 Bacteria 3651
241 Ga0495603_0027886 3300046455 Bacteria 3405
242 Ga0495603_0051840 3300046455 Bacteria 2437
243 Ga0495590_0028547 3300046457 Bacteria 1956
244 Ga0495590_0059417 3300046457 Bacteria 1337
245 Ga0495591_060250 3300046458 Bacteria 1010
246 Ga0495629_0002611 3300046459 Bacteria 13809
247 Ga0495629_0003779 3300046459 Bacteria 11400
248 Ga0495638_0000011 3300046460 Bacteria 442453
249 Ga0495638_0000052 3300046460 Bacteria 203695
250 Ga0495641_0012418 3300046461 Bacteria 4766
251 Ga0495651_0027687 3300046462 Bacteria 4417
252 Ga0495651_0257932 3300046462 Bacteria 1187
253 Ga0495653_0015446 3300046463 Bacteria 6224
254 Ga0495650_0000015 3300046471 Bacteria 557595
255 Ga0495650_0000145 3300046471 Bacteria 164687
256 Ga0495650_0001196 3300046471 Bacteria 27428
257 Ga0495650_0003003 3300046471 Bacteria 12750
258 Ga0495650_0016591 3300046471 Bacteria 3725
259 Ga0495650_0026303 3300046471 Bacteria 2709
260 Ga0495650_0030988 3300046471 Bacteria 2413
261 Ga0495650_0035756 3300046471 Bacteria 2183
262 Ga0495580_0005559 3300046472 Bacteria 10392
263 Ga0495580_0006174 3300046472 Bacteria 9793
264 Ga0495580_0035146 3300046472 Bacteria 3604
265 Ga0495580_0276432 3300046472 Bacteria 1146
266 Ga0495582_0011266 3300046473 Bacteria 4927
267 Ga0495605_0000222 3300046474 Bacteria 70142
268 Ga0495605_0000286 3300046474 Bacteria 55733
269 Ga0495605_0042317 3300046474 Bacteria 2265
270 Ga0495639_0029766 3300046475 Bacteria 2424
271 Ga0495664_0025951 3300046477 Bacteria 3411
272 Ga0495664_0181293 3300046477 Bacteria 1277
273 Ga0495584_0040929 3300046491 Bacteria 2339
274 Ga0495584_0085295 3300046491 Bacteria 1591
275 Ga0495585_0010318 3300046492 Bacteria 5568
276 Ga0495585_0041098 3300046492 Bacteria 2594
277 Ga0495594_0030303 3300046499 Bacteria 2925
278 Ga0495596_0000094 3300046500 Bacteria 62938
279 Ga0495596_0003209 3300046500 Bacteria 8403
280 Ga0495607_0000025 3300046501 Bacteria 159379
281 Ga0495607_0000507 3300046501 Bacteria 38608
282 Ga0495607_0000517 3300046501 Bacteria 38004
283 Ga0495607_0005537 3300046501 Bacteria 9009
284 Ga0495607_0014088 3300046501 Bacteria 5219
285 Ga0495607_0024269 3300046501 Bacteria 3783
286 Ga0495583_0000086 3300046506 Bacteria 165176
287 Ga0495583_0005819 3300046506 Bacteria 8230
288 Ga0495583_0015018 3300046506 Bacteria 4234
289 Ga0495606_0001737 3300046507 Bacteria 27992
290 Ga0495606_0045044 3300046507 Bacteria 2928
291 Ga0495606_0053398 3300046507 Bacteria 2622
292 Ga0495606_0192140 3300046507 Bacteria 1169
293 Ga0495608_0000402 3300046511 Bacteria 30297
294 Ga0495610_0003962 3300046512 Bacteria 11204
295 Ga0495610_0044766 3300046512 Bacteria 2194
296 Ga0495616_0000615 3300046513 Bacteria 26805
297 Ga0495616_0015812 3300046513 Bacteria 4187
298 Ga0495616_0047588 3300046513 Bacteria 2159
299 Ga0495618_0003285 3300046514 Bacteria 10124
300 Ga0495620_0000021 3300046515 Bacteria 139145
301 Ga0495628_0011358 3300046516 Bacteria 7533
302 Ga0495630_0001299 3300046517 Bacteria 17218
303 Ga0495630_0010276 3300046517 Bacteria 6753
304 Ga0495630_0137201 3300046517 Bacteria 1859
305 Ga0495631_0000419 3300046518 Bacteria 29233
306 Ga0495631_0002033 3300046518 Bacteria 11776
307 Ga0495632_0000062 3300046519 Bacteria 118205
308 Ga0495632_0012426 3300046519 Bacteria 4914
309 Ga0495632_0040375 3300046519 Bacteria 2350
310 Ga0495632_0045548 3300046519 Bacteria 2184
311 Ga0495637_0006422 3300046520 Bacteria 5901
312 Ga0495637_0038547 3300046520 Bacteria 2068
313 Ga0495643_0000254 3300046522 Bacteria 78711
314 Ga0495643_0002050 3300046522 Bacteria 16731
315 Ga0495643_0052380 3300046522 Bacteria 2191
316 Ga0495643_0055049 3300046522 Bacteria 2127
317 Ga0495644_0001820 3300046523 Bacteria 8596
318 Ga0495648_0000036 3300046524 Bacteria 195997
319 Ga0495648_0005508 3300046524 Bacteria 10501
320 Ga0495648_0026034 3300046524 Bacteria 3947
321 Ga0495666_0028716 3300046526 Bacteria 2736
322 Ga0495642_0000753 3300046528 Bacteria 15922
323 Ga0495652_0001389 3300046529 Bacteria 26896
324 Ga0495652_0020680 3300046529 Bacteria 5851
325 Ga0495652_0303464 3300046529 Bacteria 1160
326 Ga0495654_0010930 3300046530 Bacteria 4932
327 Ga0495654_0011832 3300046530 Bacteria 4708
328 Ga0495665_0000013 3300046531 Bacteria 68469
329 Ga0495665_0027212 3300046531 Bacteria 3070
330 Ga0495665_0058796 3300046531 Bacteria 2029
331 Ga0495640_0005984 3300046533 Bacteria 9645
332 Ga0495586_0000740 3300046535 Bacteria 18711
333 Ga0495586_0022328 3300046535 Bacteria 3377
334 Ga0495586_0255445 3300046535 Bacteria 1000
335 Ga0495609_0000148 3300046538 Bacteria 72666
336 Ga0495609_0000162 3300046538 Bacteria 69584
337 Ga0495609_0003010 3300046538 Bacteria 9938
338 Ga0495609_0003367 3300046538 Bacteria 9197
339 Ga0495609_0007175 3300046538 Bacteria 5595
340 Ga0495597_0000011 3300046542 Bacteria 221377
341 Ga0495597_0000622 3300046542 Bacteria 28970
342 Ga0495597_0080819 3300046542 Bacteria 1390
343 Ga0495645_0003033 3300046543 Bacteria 11361
344 Ga0495645_0060302 3300046543 Bacteria 2750
345 Ga0495645_0134168 3300046543 Bacteria 1733
346 Ga0495622_0000420 3300046557 Bacteria 28044
347 Ga0495622_0014484 3300046557 Bacteria 3662
348 Ga0495622_0045531 3300046557 Bacteria 2038
349 Ga0495633_0002844 3300046558 Bacteria 11920
350 Ga0495667_0097743 3300046559 Bacteria 1901
351 Ga0495656_0010072 3300046615 Bacteria 3423
352 Ga0495656_0098584 3300046615 Bacteria 1348
353 Ga0495634_0014990 3300046642 Bacteria 5574
354 Ga0495634_0132339 3300046642 Bacteria 1589
355 Ga0495625_0000861 3300046660 Bacteria 41279
356 Ga0495625_0005899 3300046660 Bacteria 11023
357 Ga0495625_0020323 3300046660 Bacteria 5129
358 Ga0495625_0026662 3300046660 Bacteria 4363
359 Ga0495625_0126567 3300046660 Bacteria 1734
360 Ga0495661_0008155 3300046665 Bacteria 7262
361 Ga0495661_0013328 3300046665 Bacteria 5526
362 Ga0495661_0024502 3300046665 Bacteria 3905
363 Ga0495661_0040225 3300046665 Bacteria 2901
364 Ga0495588_0000094 3300046674 Bacteria 176169
365 Ga0495588_0011084 3300046674 Bacteria 4220
366 Ga0495623_0016063 3300046679 Bacteria 4836
367 Ga0495613_0002059 3300046689 Bacteria 15283
368 Ga0495613_0026646 3300046689 Bacteria 4306
369 Ga0495624_0022984 3300046690 Bacteria 4114
370 Ga0495670_0034450 3300046691 Bacteria 2522
371 Ga0495670_0123880 3300046691 Bacteria 1344
372 Ga0495671_0012193 3300046692 Bacteria 4698
373 Ga0495671_0074290 3300046692 Bacteria 1668
374 Ga0495649_0001301 3300046694 Bacteria 19082
375 Ga0495649_0003036 3300046694 Bacteria 11514
376 Ga0495649_0032015 3300046694 Bacteria 2899
377 Ga0495649_0061955 3300046694 Bacteria 2011
378 Ga0495649_0134872 3300046694 Bacteria 1302
379 Ga0495589_0000011 3300046794 Bacteria 250370
380 Ga0495589_0000025 3300046794 Bacteria 185024
381 Ga0495589_0000359 3300046794 Bacteria 35371
382 Ga0495589_0003728 3300046794 Bacteria 8215
383 Ga0495589_0009673 3300046794 Bacteria 5010
384 Ga0495589_0096031 3300046794 Bacteria 1437
385 Ga0495600_0004412 3300046809 Bacteria 8415
386 Ga0495600_0026717 3300046809 Bacteria 3727
387 Ga0495660_0000299 3300046810 Bacteria 45148
388 Ga0495660_0001104 3300046810 Bacteria 19276
389 Ga0495660_0003415 3300046810 Bacteria 9832
390 Ga0495660_0008788 3300046810 Bacteria 5898
391 Ga0495660_0015920 3300046810 Bacteria 4340
392 Ga0495660_0022997 3300046810 Bacteria 3556
393 Ga0495660_0025436 3300046810 Bacteria 3362
394 Ga0495660_0056938 3300046810 Bacteria 2110
395 Ga0495581_0002574 3300047315 Bacteria 10304
396 Ga0495581_0016672 3300047315 Bacteria 4271
397 Ga0495581_0017953 3300047315 Bacteria 4111
398 Ga0495604_0017105 3300047317 Bacteria 5800
399 Ga0495636_0265275 3300047318 Bacteria 797
400 Ga0495674_0056904 3300047319 Bacteria 3423
401 Ga0495672_0000090 3300047320 Bacteria 148367
402 Ga0495672_0000222 3300047320 Bacteria 81058
403 Ga0495672_0001124 3300047320 Bacteria 27126
404 Ga0495672_0028143 3300047320 Bacteria 3561
405 Ga0495672_0032587 3300047320 Bacteria 3239
406 Ga0495672_0050021 3300047320 Bacteria 2471
407 Ga0495676_0000004 3300047321 Bacteria 313696
408 Ga0495680_0024717 3300047322 Bacteria 4979
409 Ga0495680_0108806 3300047322 Bacteria 2056
410 Ga0495683_0001821 3300047323 Bacteria 13414
411 Ga0495687_000402 3300047443 Bacteria 53513
412 Ga0495687_001224 3300047443 Bacteria 24532
413 Ga0495687_033370 3300047443 Bacteria 2336
414 Ga0495687_046645 3300047443 Bacteria 1869
415 Ga0495675_0012921 3300047444 Bacteria 5262
416 Ga0495675_0109921 3300047444 Bacteria 1721
417 Ga0495677_0001975 3300047445 Bacteria 8183
418 Ga0495679_016467 3300047446 Bacteria 2674
419 Ga0495673_0007807 3300047469 Bacteria 6092
420 Ga0495673_0061273 3300047469 Bacteria 1611
421 Ga0495681_0003969 3300047470 Bacteria 10195
422 Ga0495681_0097439 3300047470 Bacteria 1290
423 Ga0495684_0500145 3300047471 Bacteria 836
424 Ga0495686_0000213 3300047472 Bacteria 107285
425 Ga0495602_0069178 3300048088 Bacteria 3027
426 Ga0495614_0000269 3300048089 Bacteria 20268
427 Ga0495626_0000017 3300048091 Bacteria 231648
428 Ga0495626_0000022 3300048091 Bacteria 216166
429 Ga0495626_0008220 3300048091 Bacteria 5745
430 Ga0495626_0071628 3300048091 Bacteria 1557
431 Ga0496100_0000094 3300048903 Bacteria 50690
432 Ga0496100_0016531 3300048903 Bacteria 4335
433 Ga0496101_0000181 3300048904 Bacteria 50837
434 Ga0496101_0086586 3300048904 Bacteria 2324
435 Ga0496102_0000397 3300048905 Bacteria 50794
436 Ga0496102_0005182 3300048905 Bacteria 11066
437 Ga0496102_0125415 3300048905 Bacteria 2400
438 Ga0496103_0003529 3300048906 Bacteria 9559
439 Ga0496104_0049105 3300048907 Bacteria 3979
440 Ga0496104_0117559 3300048907 Bacteria 2552
441 Ga0496106_0004030 3300048909 Bacteria 10981
442 Ga0496109_0410543 3300048912 Bacteria 1279
443 Ga0496113_0019743 3300048916 Bacteria 4723
444 Ga0496113_0024821 3300048916 Bacteria 4266
445 Ga0496115_0000072 3300048918 Bacteria 91408
446 Ga0496115_0000462 3300048918 Bacteria 32479
447 Ga0496115_0004247 3300048918 Bacteria 10360
448 Ga0496116_0021352 3300048919 Bacteria 4886
449 Ga0496116_0028808 3300048919 Bacteria 4016
450 Ga0496117_0000210 3300048920 Bacteria 112808
451 Ga0496117_0054473 3300048920 Bacteria 2802
452 Ga0496118_0000788 3300048921 Bacteria 50781
453 Ga0496118_0004274 3300048921 Bacteria 17088
454 Ga0496118_0069268 3300048921 Bacteria 2556
455 Ga0496119_0081827 3300048922 Bacteria 1858
456 Ga0496121_0000290 3300048924 Bacteria 104280
457 Ga0496121_0000457 3300048924 Bacteria 80467
458 Ga0496121_0025456 3300048924 Bacteria 5612
459 Ga0496121_0026631 3300048924 Bacteria 5439
460 Ga0496121_0032295 3300048924 Bacteria 4763
461 Ga0496121_0125786 3300048924 Bacteria 1927
462 Ga0496121_0135553 3300048924 Bacteria 1835
463 Ga0496121_0137011 3300048924 Bacteria 1822
464 Ga0496122_0000473 3300048925 Bacteria 83672
465 Ga0496122_0013578 3300048925 Bacteria 7955
466 Ga0496122_0022284 3300048925 Bacteria 5637
467 Ga0496122_0026840 3300048925 Bacteria 4947
468 Ga0496122_0133962 3300048925 Bacteria 1566
469 Ga0496123_0000029 3300048926 Bacteria 295871
470 Ga0496123_0000857 3300048926 Bacteria 48563
471 Ga0496123_0001289 3300048926 Bacteria 35761
472 Ga0496123_0011972 3300048926 Bacteria 7444
473 Ga0496123_0122015 3300048926 Bacteria 1463
474 Ga0496123_0131021 3300048926 Bacteria 1389
475 Ga0496124_0000004 3300048927 Bacteria 976131
476 Ga0496124_0000022 3300048927 Bacteria 421020
477 Ga0496124_0006294 3300048927 Bacteria 12973
478 Ga0496124_0138827 3300048927 Bacteria 1920
479 Ga0496124_0207089 3300048927 Bacteria 1487
480 Ga0496124_0262460 3300048927 Bacteria 1270
481 Ga0496124_0424440 3300048927 Bacteria 915
482 Ga0496125_0000945 3300048928 Bacteria 45641
483 Ga0496125_0007717 3300048928 Bacteria 11397
484 Ga0496125_0008590 3300048928 Bacteria 10665
485 Ga0496125_0021684 3300048928 Bacteria 5980
486 Ga0496125_0080826 3300048928 Bacteria 2486
487 Ga0496126_0000426 3300048929 Bacteria 84838
488 Ga0496126_0014182 3300048929 Bacteria 8066
489 Ga0496126_0017267 3300048929 Bacteria 7190
490 Ga0496126_0066652 3300048929 Bacteria 3219
491 Ga0496126_0149775 3300048929 Bacteria 2000
492 Ga0496126_0150287 3300048929 Bacteria 1997
493 Ga0496126_0203448 3300048929 Bacteria 1671
494 Ga0495678_000803 3300049459 Bacteria 28133
495 Ga0495678_006770 3300049459 Bacteria 6037
496 Ga0495678_031274 3300049459 Bacteria 2221
497 Ga0495682_0002612 3300049460 Bacteria 8446
498 Ga0501033_0004413 3300049570 Bacteria 11258
499 Ga0501033_0444188 3300049570 Bacteria 901
500 Ga0501034_0126776 3300049571 Bacteria 2537
501 Ga0501036_0327181 3300049572 Bacteria 1280
502 Ga0501042_0168551 3300049578 Bacteria 1580
503 Ga0501047_0006878 3300049581 Bacteria 10687
504 Ga0501047_0570809 3300049581 Bacteria 954
505 Ga0500643_000121 3300053087 Bacteria 81461
506 Ga0500646_0006759 3300053090 Bacteria 2919
507 Ga0500651_0169174 3300053093 Bacteria 1304
508 Ga0500618_001370 3300053125 Bacteria 11048
509 Ga0500618_010436 3300053125 Bacteria 2492
510 Ga0500652_000047 3300053131 Bacteria 58171
511 Ga0500559_0029513 3300053136 Bacteria 2349
512 Ga0500568_0000339 3300053139 Bacteria 36709
513 Ga0500586_000044 3300053145 Bacteria 21646
514 Ga0500604_0003627 3300053151 Bacteria 4154
515 Ga0500616_0001844 3300053153 Bacteria 19195
516 Ga0500616_0008875 3300053153 Bacteria 6178
517 Ga0500622_0000043 3300053156 Bacteria 161080
518 Ga0500634_0022277 3300053161 Bacteria 3437
519 Ga0500570_000097 3300053724 Bacteria 24774
520 Ga0466962_0003548 3300061719 Bacteria 7429
521 Ga0466962_0073090 3300061719 Bacteria 1638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100030508 Ga0070683_1000305087 227
2 3300005336 Ga0070680_100116054 Ga0070680_1001160542 227
3 3300005458 Ga0070681_10032130 Ga0070681_100321305 227
4 3300025912 Ga0207707_10018916 Ga0207707_100189166 227
5 3300025921 Ga0207652_10512561 Ga0207652_105125612 227
6 3300025944 Ga0207661_10031964 Ga0207661_100319645 227
7 3300053136 Ga0500559_0029513 Ga0500559_0029513_1279_2100 241
8 3300044693 Ga0466961_0084273 Ga0466961_0084273_1252_1983 242
9 3300045049 Ga0466959_0538980 Ga0466959_0538980_32_769 242
10 3300047471 Ga0495684_0500145 Ga0495684_0500145_92_826 242
11 3300047443 Ga0495687_000402 Ga0495687_000402_15412_16260 243
12 3300048922 Ga0496119_0081827 Ga0496119_0081827_1103_1846 243
13 3300046529 Ga0495652_0303464 Ga0495652_0303464_364_1110 245
14 3300046513 Ga0495616_0047588 Ga0495616_0047588_15_767 246
15 3300046538 Ga0495609_0000162 Ga0495609_0000162_53669_54409 246
16 3300047318 Ga0495636_0265275 Ga0495636_0265275_33_776 246
17 3300046530 Ga0495654_0011832 Ga0495654_0011832_2545_3366 247
18 3300048925 Ga0496122_0022284 Ga0496122_0022284_919_1764 247
19 3300048926 Ga0496123_0000857 Ga0496123_0000857_46076_46921 247
20 3300048927 Ga0496124_0207089 Ga0496124_0207089_233_1078 247
21 3300046452 Ga0495617_000004 Ga0495617_000004_288270_289097 252
22 3300046660 Ga0495625_0026662 Ga0495625_0026662_2243_3070 252
23 3300046810 Ga0495660_0008788 Ga0495660_0008788_3503_4264 252
24 3300046810 Ga0495660_0056938 Ga0495660_0056938_356_1183 252
25 3300048927 Ga0496124_0006294 Ga0496124_0006294_11980_12825 253
26 3300001990 JGI24737J22298_10000893 JGI24737J22298_100008936 254
27 3300025919 Ga0207657_10012791 Ga0207657_100127916 254
28 3300025932 Ga0207690_10003042 Ga0207690_100030425 254
29 3300048924 Ga0496121_0026631 Ga0496121_0026631_1135_1968 254
30 3300048927 Ga0496124_0000004 Ga0496124_0000004_67698_68531 254
31 3300014497 Ga0182008_10000421 Ga0182008_1000042125 255
32 3300044658 Ga0466972_0138656 Ga0466972_0138656_273_1106 255
33 3300044683 Ga0466965_0103556 Ga0466965_0103556_319_1152 255
34 3300044684 Ga0466966_0086778 Ga0466966_0086778_617_1450 255
35 3300044842 Ga0466957_0276053 Ga0466957_0276053_93_926 255
36 3300048912 Ga0496109_0410543 Ga0496109_0410543_309_1175 255
37 3300048925 Ga0496122_0013578 Ga0496122_0013578_4106_4972 255
38 3300048928 Ga0496125_0000945 Ga0496125_0000945_38096_38962 255
39 3300053087 Ga0500643_000121 Ga0500643_000121_1041_1886 255
40 3300053093 Ga0500651_0169174 Ga0500651_0169174_132_1025 255
41 3300025292 Ga0209676_1000068 Ga0209676_1000068245 256
42 3300046558 Ga0495633_0002844 Ga0495633_0002844_6224_7084 256
43 3300047445 Ga0495677_0001975 Ga0495677_0001975_6883_7716 256
44 3300053145 Ga0500586_000044 Ga0500586_000044_14795_15655 256
45 3300053153 Ga0500616_0008875 Ga0500616_0008875_4032_4874 256
46 3300001989 JGI24739J22299_10006189 JGI24739J22299_100061892 257
47 3300048918 Ga0496115_0004247 Ga0496115_0004247_3221_4054 257
48 3300002737 JGI25162J39368_1004421 JGI25162J39368_10044213 258
49 3300015261 Ga0182006_1068655 Ga0182006_10686552 258
50 3300025226 Ga0209674_101276 Ga0209674_1012764 258
51 3300025233 Ga0209437_112438 Ga0209437_1124381 258
52 3300025254 Ga0209148_1003324 Ga0209148_10033244 258
53 3300046538 Ga0495609_0003010 Ga0495609_0003010_3481_4314 258
54 3300046542 Ga0495597_0000622 Ga0495597_0000622_8956_9789 258
55 3300003841 Ga0055541_1005666 Ga0055541_10056662 260
56 3300006946 Ga0079104_1000333 Ga0079104_100033319 260
57 3300025225 Ga0209566_100220 Ga0209566_10022050 260
58 3300025226 Ga0209674_102528 Ga0209674_1025282 260
59 3300027111 Ga0209281_1000322 Ga0209281_100032219 260
60 iso_pu_bacteria 8045864390 8045865694 260
61 3300003791 Ga0055530_10002435 Ga0055530_100024354 261
62 3300003792 Ga0055540_1000023 Ga0055540_10000238 261
63 3300003794 Ga0055531_10016451 Ga0055531_100164512 261
64 3300025298 Ga0209050_1001298 Ga0209050_100129821 261
65 3300025303 Ga0209051_1000079 Ga0209051_1000079178 261
66 3300025304 Ga0209257_1000183 Ga0209257_1000183136 261
67 3300048924 Ga0496121_0137011 Ga0496121_0137011_773_1606 261
68 iso_pu_bacteria 2687453743 2689994454 264
69 3300003760 Ga0055527_1003675 Ga0055527_10036752 265
70 3300005344 Ga0070661_100002593 Ga0070661_1000025933 265
71 3300005455 Ga0070663_100217323 Ga0070663_1002173231 265
72 3300009093 Ga0105240_10286863 Ga0105240_102868632 265
73 3300009093 Ga0105240_10444745 Ga0105240_104447452 265
74 3300025228 Ga0209672_100644 Ga0209672_1006446 265
75 3300025272 Ga0209455_1002471 Ga0209455_10024716 265
76 3300025913 Ga0207695_10015040 Ga0207695_100150404 265
77 3300025920 Ga0207649_10002545 Ga0207649_100025454 265
78 3300026067 Ga0207678_10089893 Ga0207678_100898932 265
79 3300037312 Ga0395899_0116867 Ga0395899_0116867_744_1577 265
80 3300037418 Ga0395900_0011239 Ga0395900_0011239_3632_4465 265
81 3300038443 Ga0395901_0000122 Ga0395901_0000122_14156_14989 265
82 3300046506 Ga0495583_0005819 Ga0495583_0005819_7035_7883 265
83 3300048929 Ga0496126_0017267 Ga0496126_0017267_2462_3295 265
84 3300037312 Ga0395899_0005349 Ga0395899_0005349_3409_4242 266
85 3300013105 Ga0157369_10053790 Ga0157369_100537902 267
86 iso_pu_bacteria 8053945823 8053947665 267
87 3300046453 Ga0495627_000001 Ga0495627_000001_46779_47624 268
88 3300047320 Ga0495672_0000222 Ga0495672_0000222_40065_40904 268
89 3300053724 Ga0500570_000097 Ga0500570_000097_18722_19543 268
90 3300013104 Ga0157370_10068101 Ga0157370_100681012 269
91 3300015261 Ga0182006_1080115 Ga0182006_10801152 269
92 3300015262 Ga0182007_10000279 Ga0182007_1000027933 269
93 3300037312 Ga0395899_0071705 Ga0395899_0071705_141_1028 269
94 3300037466 Ga0395898_0125160 Ga0395898_0125160_1470_2357 269
95 3300037471 Ga0395905_0159905 Ga0395905_0159905_1102_1989 269
96 3300046460 Ga0495638_0000011 Ga0495638_0000011_111360_112205 269
97 3300046524 Ga0495648_0000036 Ga0495648_0000036_111214_112059 269
98 3300048929 Ga0496126_0000426 Ga0496126_0000426_80164_80979 269
99 3300028786 Ga0307517_10160444 Ga0307517_101604441 270
100 3300044672 Ga0466982_0096822 Ga0466982_0096822_81_896 270
101 3300046457 Ga0495590_0059417 Ga0495590_0059417_360_1193 270
102 3300046474 Ga0495605_0000286 Ga0495605_0000286_53108_53941 270
103 3300046501 Ga0495607_0005537 Ga0495607_0005537_6384_7217 270
104 3300046522 Ga0495643_0002050 Ga0495643_0002050_13028_13861 270
105 3300046665 Ga0495661_0013328 Ga0495661_0013328_3901_4734 270
106 3300046694 Ga0495649_0032015 Ga0495649_0032015_1117_1950 270
107 3300046794 Ga0495589_0000359 Ga0495589_0000359_5482_6315 270
108 3300046810 Ga0495660_0000299 Ga0495660_0000299_21339_22172 270
109 3300047320 Ga0495672_0001124 Ga0495672_0001124_4005_4838 270
110 3300047443 Ga0495687_001224 Ga0495687_001224_5319_6152 270
111 3300048091 Ga0495626_0000022 Ga0495626_0000022_176757_177590 270
112 3300048926 Ga0496123_0131021 Ga0496123_0131021_228_1043 270
113 3300053151 Ga0500604_0003627 Ga0500604_0003627_10_828 270
114 iso_pu_bacteria 8056207758 8056215061 270
115 iso_pu_bacteria 2513237138 2513865995 271
116 iso_pu_bacteria 2687453130 2687581314 271
117 iso_pu_bacteria 2501025501 2501075255 272
118 iso_pu_bacteria 2501025502 2501081241 272
119 iso_pu_bacteria 2501025504 2501411570 272
120 iso_pu_bacteria 2508501071 2508853961 272
121 iso_pu_bacteria 2508501125 2509131979 272
122 iso_pu_bacteria 2510065045 2510250164 272
123 iso_pu_bacteria 2510917013 2511094303 272
124 iso_pu_bacteria 2510917014 2511099541 272
125 iso_pu_bacteria 2510917015 2511106715 272
126 iso_pu_bacteria 2512047030 2512350600 272
127 iso_pu_bacteria 2513237151 2513962039 272
128 iso_pu_bacteria 2515154123 2515689626 272
129 iso_pu_bacteria 2515154189 2516023241 272
130 iso_pu_bacteria 2599185240 2599745199 272
131 iso_pu_bacteria 2599185307 2599970551 272
132 iso_pu_bacteria 2599185311 2599997184 272
133 iso_pu_bacteria 2599185355 2600206620 272
134 iso_pu_bacteria 2643221556 2643799550 272
135 iso_pu_bacteria 2643221684 2644471640 272
136 iso_pu_bacteria 2675903129 2676743072 272
137 iso_pu_bacteria 2718217991 2719639318 272
138 iso_pu_bacteria 2739367700 2739730443 272
139 iso_pu_bacteria 2744054900 2746091396 272
140 iso_pu_bacteria 2744054901 2746097290 272
141 iso_pu_bacteria 2772190666 2772439803 272
142 iso_pu_bacteria 2791355137 2792833504 272
143 iso_pu_bacteria 2806310673 2807178073 272
144 iso_pu_bacteria 2808606384 2808973877 272
145 iso_pu_bacteria 2808606390 2809008681 272
146 iso_pu_bacteria 2808606391 2809015813 272
147 iso_pu_bacteria 2816332141 2816516853 272
148 iso_pu_bacteria 2842324504 2842326505 272
149 iso_pu_bacteria 2842348783 2842350976 272
150 iso_pu_bacteria 2842454564 2842455813 272
151 iso_pu_bacteria 2842780639 2842783116 272
152 iso_pu_bacteria 2855730933 2855731273 272
153 iso_pu_bacteria 2855767633 2855767961 272
154 iso_pu_bacteria 2857357740 2857365155 272
155 iso_pu_bacteria 2857542790 2857545634 272
156 iso_pu_bacteria 2870068957 2870076303 272
157 iso_pu_bacteria 2881412998 2881413838 272
158 iso_pu_bacteria 2881609920 2881610237 272
159 iso_pu_bacteria 2883087390 2883093571 272
160 iso_pu_bacteria 2884338543 2884339501 272
161 iso_pu_bacteria 2904483920 2904484761 272
162 iso_pu_bacteria 2904564687 2904567160 272
163 iso_pu_bacteria 2904571731 2904573896 272
164 iso_pu_bacteria 2904615490 2904621116 272
165 iso_pu_bacteria 2919046199 2919047323 272
166 iso_pu_bacteria 2923586266 2923591547 272
167 iso_pu_bacteria 2928536128 2928541023 272
168 iso_pu_bacteria 2931369376 2931371553 272
169 iso_pu_bacteria 2939626828 2939629344 272
170 iso_pu_bacteria 2941471342 2941473919 272
171 iso_pu_bacteria 2947233263 2947238012 272
172 iso_pu_bacteria 3007718800 3007721986 272
173 iso_pu_bacteria 8047673197 8047675949 272
174 iso_pu_bacteria 8055266321 8055273239 272
175 3300037312 Ga0395899_0014986 Ga0395899_0014986_2174_3016 273
176 3300037418 Ga0395900_0063807 Ga0395900_0063807_1960_2802 273
177 3300037471 Ga0395905_0037101 Ga0395905_0037101_2103_2945 273
178 3300038443 Ga0395901_0013989 Ga0395901_0013989_6555_7397 273
179 3300046455 Ga0495603_0051840 Ga0495603_0051840_250_1077 273
180 3300046472 Ga0495580_0005559 Ga0495580_0005559_2070_2897 273
181 3300046516 Ga0495628_0011358 Ga0495628_0011358_633_1460 273
182 3300046517 Ga0495630_0001299 Ga0495630_0001299_13230_14057 273
183 3300046529 Ga0495652_0020680 Ga0495652_0020680_53_880 273
184 3300046531 Ga0495665_0000013 Ga0495665_0000013_44673_45500 273
185 3300046535 Ga0495586_0000740 Ga0495586_0000740_16649_17476 273
186 3300046660 Ga0495625_0126567 Ga0495625_0126567_118_987 273
187 3300046665 Ga0495661_0008155 Ga0495661_0008155_4608_5435 273
188 3300046690 Ga0495624_0022984 Ga0495624_0022984_1477_2304 273
189 3300047315 Ga0495581_0017953 Ga0495581_0017953_1783_2610 273
190 3300047319 Ga0495674_0056904 Ga0495674_0056904_1311_2138 273
191 3300047446 Ga0495679_016467 Ga0495679_016467_482_1309 273
192 3300009177 Ga0105248_10145626 Ga0105248_101456264 274
193 3300025914 Ga0207671_10006203 Ga0207671_100062035 274
194 3300044693 Ga0466961_0001254 Ga0466961_0001254_13055_13882 274
195 3300045049 Ga0466959_0000058 Ga0466959_0000058_38255_39082 274
196 iso_pu_bacteria 2510917022 2511134651 274
197 iso_pu_bacteria 2512564014 2512643955 274
198 iso_pu_bacteria 2582581299 2585231602 274
199 iso_pu_bacteria 2582581307 2585273732 274
200 iso_pu_bacteria 2585427531 2585559906 274
201 iso_pu_bacteria 2585427609 2585905916 274
202 iso_pu_bacteria 2585428125 2587978969 274
203 iso_pu_bacteria 2617270742 2617380463 274
204 iso_pu_bacteria 2852387548 2852388212 274
205 iso_pu_bacteria 2921643360 2921643604 274
206 iso_pu_bacteria 8046767195 8046770925 274
207 3300028379 Ga0268266_10212231 Ga0268266_102122313 275
208 3300046512 Ga0495610_0003962 Ga0495610_0003962_4296_5129 275
209 3300046519 Ga0495632_0012426 Ga0495632_0012426_3939_4772 275
210 3300047472 Ga0495686_0000213 Ga0495686_0000213_7914_8744 275
211 3300049459 Ga0495678_000803 Ga0495678_000803_26408_27238 275
212 3300001904 JGI24736J21556_1001724 JGI24736J21556_10017243 276
213 3300002773 JGI25152J39213_1003813 JGI25152J39213_10038136 276
214 3300002987 JGI25159J45721_1000427 JGI25159J45721_100042715 276
215 3300003215 JGI25153J46596_10008267 JGI25153J46596_100082676 276
216 3300003322 rootL2_10057614 rootL2_100576143 276
217 3300003322 rootL2_10121717 rootL2_101217173 276
218 3300003323 rootH1_10141536 rootH1_101415367 276
219 3300003354 JGI25160J50197_1000012 JGI25160J50197_100001254 276
220 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002206 276
221 3300003751 Ga0055538_1000019 Ga0055538_1000019175 276
222 3300003752 Ga0055539_1000024 Ga0055539_1000024115 276
223 3300003756 Ga0055533_1000032 Ga0055533_1000032175 276
224 3300003756 Ga0055533_1001916 Ga0055533_10019161 276
225 3300003759 Ga0055525_1000041 Ga0055525_1000041175 276
226 3300003771 Ga0055526_1000618 Ga0055526_100061820 276
227 3300003771 Ga0055526_1002058 Ga0055526_10020587 276
228 3300003771 Ga0055526_1018145 Ga0055526_10181452 276
229 3300003773 Ga0055537_1000600 Ga0055537_100060013 276
230 3300003773 Ga0055537_1001733 Ga0055537_100173312 276
231 3300003775 Ga0055524_1000607 Ga0055524_100060710 276
232 3300003775 Ga0055524_1002359 Ga0055524_10023596 276
233 3300003775 Ga0055524_1002882 Ga0055524_10028822 276
234 3300003784 Ga0055534_1000409 Ga0055534_100040920 276
235 3300003790 Ga0055528_1002313 Ga0055528_10023134 276
236 3300003792 Ga0055540_1000240 Ga0055540_100024035 276
237 3300003792 Ga0055540_1004561 Ga0055540_10045614 276
238 3300003841 Ga0055541_1000018 Ga0055541_1000018115 276
239 3300004625 Ga0055543_1000050 Ga0055543_100005043 276
240 3300005366 Ga0070659_100002014 Ga0070659_1000020144 276
241 3300005367 Ga0070667_100000010 Ga0070667_100000010174 276
242 3300005455 Ga0070663_100000413 Ga0070663_10000041315 276
243 3300005455 Ga0070663_100063668 Ga0070663_1000636681 276
244 3300005457 Ga0070662_100001814 Ga0070662_10000181412 276
245 3300005539 Ga0068853_100025864 Ga0068853_1000258643 276
246 3300005548 Ga0070665_100335385 Ga0070665_1003353852 276
247 3300005563 Ga0068855_100220641 Ga0068855_1002206412 276
248 3300006028 Ga0070717_10004621 Ga0070717_100046217 276
249 3300006051 Ga0075364_10001122 Ga0075364_1000112217 276
250 3300006948 Ga0099826_10000046 Ga0099826_1000004620 276
251 3300009011 Ga0105251_10034837 Ga0105251_100348373 276
252 3300009093 Ga0105240_10009708 Ga0105240_100097083 276
253 3300009093 Ga0105240_10278976 Ga0105240_102789762 276
254 3300009176 Ga0105242_10309569 Ga0105242_103095692 276
255 3300009177 Ga0105248_10000240 Ga0105248_1000024026 276
256 3300009177 Ga0105248_10122284 Ga0105248_101222842 276
257 3300009545 Ga0105237_10000652 Ga0105237_1000065211 276
258 3300009545 Ga0105237_10008925 Ga0105237_100089253 276
259 3300009553 Ga0105249_10000226 Ga0105249_1000022625 276
260 3300010375 Ga0105239_10006412 Ga0105239_1000641214 276
261 3300013104 Ga0157370_10079805 Ga0157370_100798052 276
262 3300013306 Ga0163162_10006013 Ga0163162_100060137 276
263 3300014497 Ga0182008_10012129 Ga0182008_100121293 276
264 3300015261 Ga0182006_1015996 Ga0182006_10159963 276
265 3300015261 Ga0182006_1041833 Ga0182006_10418332 276
266 3300015262 Ga0182007_10004019 Ga0182007_100040194 276
267 3300015262 Ga0182007_10006638 Ga0182007_100066385 276
268 3300015265 Ga0182005_1032684 Ga0182005_10326842 276
269 3300015687 Ga0183368_1002 Ga0183368_100246 276
270 3300015689 Ga0183360_10001 Ga0183360_100012169 276
271 3300021361 Ga0213872_10001611 Ga0213872_1000161116 276
272 3300021361 Ga0213872_10006306 Ga0213872_100063067 276
273 3300025207 Ga0209760_103311 Ga0209760_1033111 276
274 3300025224 Ga0209784_100009 Ga0209784_100009185 276
275 3300025224 Ga0209784_100010 Ga0209784_100010602 276
276 3300025225 Ga0209566_100007 Ga0209566_100007185 276
277 3300025225 Ga0209566_100008 Ga0209566_100008602 276
278 3300025226 Ga0209674_100016 Ga0209674_100016150 276
279 3300025226 Ga0209674_100018 Ga0209674_100018185 276
280 3300025226 Ga0209674_100019 Ga0209674_100019602 276
281 3300025230 Ga0209563_100020 Ga0209563_100020185 276
282 3300025230 Ga0209563_100021 Ga0209563_100021602 276
283 3300025231 Ga0207427_100991 Ga0207427_1009913 276
284 3300025233 Ga0209437_100019 Ga0209437_100019602 276
285 3300025253 Ga0209677_100010 Ga0209677_100010185 276
286 3300025253 Ga0209677_100011 Ga0209677_100011602 276
287 3300025258 Ga0209129_1000535 Ga0209129_100053524 276
288 3300025261 Ga0209233_1000025 Ga0209233_1000025602 276
289 3300025263 Ga0209565_1000003 Ga0209565_1000003996 276
290 3300025263 Ga0209565_1000094 Ga0209565_100009473 276
291 3300025273 Ga0209673_1000003 Ga0209673_1000003882 276
292 3300025284 Ga0209130_1000028 Ga0209130_1000028243 276
293 3300025291 Ga0209675_1000003 Ga0209675_100000342 276
294 3300025292 Ga0209676_1006666 Ga0209676_10066662 276
295 3300025292 Ga0209676_1021191 Ga0209676_10211912 276
296 3300025295 Ga0209564_1000509 Ga0209564_100050945 276
297 3300025295 Ga0209564_1000614 Ga0209564_100061448 276
298 3300025297 Ga0209758_1001399 Ga0209758_100139915 276
299 3300025297 Ga0209758_1014100 Ga0209758_10141003 276
300 3300025298 Ga0209050_1000287 Ga0209050_100028740 276
301 3300025298 Ga0209050_1003335 Ga0209050_10033357 276
302 3300025299 Ga0209256_1000029 Ga0209256_1000029383 276
303 3300025299 Ga0209256_1001721 Ga0209256_10017213 276
304 3300025299 Ga0209256_1010972 Ga0209256_10109724 276
305 3300025302 Ga0207426_1000012 Ga0207426_1000012338 276
306 3300025303 Ga0209051_1000199 Ga0209051_100019940 276
307 3300025303 Ga0209051_1055135 Ga0209051_10551352 276
308 3300025304 Ga0209257_1007945 Ga0209257_10079456 276
309 3300025728 Ga0207655_1000322 Ga0207655_100032245 276
310 3300025904 Ga0207647_10000196 Ga0207647_100001965 276
311 3300025904 Ga0207647_10030710 Ga0207647_100307103 276
312 3300025904 Ga0207647_10056669 Ga0207647_100566694 276
313 3300025904 Ga0207647_10099990 Ga0207647_100999901 276
314 3300025913 Ga0207695_10012652 Ga0207695_1001265210 276
315 3300025914 Ga0207671_10004902 Ga0207671_100049024 276
316 3300025933 Ga0207706_10009190 Ga0207706_1000919010 276
317 3300025935 Ga0207709_10006106 Ga0207709_100061066 276
318 3300025941 Ga0207711_10000860 Ga0207711_1000086027 276
319 3300025949 Ga0207667_10056417 Ga0207667_100564172 276
320 3300025961 Ga0207712_10000141 Ga0207712_1000014146 276
321 3300025986 Ga0207658_10000297 Ga0207658_1000029735 276
322 3300026041 Ga0207639_10028174 Ga0207639_100281742 276
323 3300026067 Ga0207678_10000223 Ga0207678_1000022313 276
324 3300026067 Ga0207678_10166859 Ga0207678_101668592 276
325 3300026121 Ga0207683_10251162 Ga0207683_102511622 276
326 3300027312 Ga0209371_1002265 Ga0209371_10022656 276
327 3300027312 Ga0209371_1006679 Ga0209371_10066792 276
328 3300027312 Ga0209371_1011230 Ga0209371_10112301 276
329 3300027666 Ga0209282_1000011 Ga0209282_100001180 276
330 3300028379 Ga0268266_10036078 Ga0268266_100360784 276
331 3300028379 Ga0268266_10150630 Ga0268266_101506302 276
332 3300030500 Ga0268256_1002005 Ga0268256_10020056 276
333 3300030500 Ga0268256_1006761 Ga0268256_10067612 276
334 3300030500 Ga0268256_1012185 Ga0268256_10121853 276
335 3300030742 Ga0316183_1048625 Ga0316183_10486254 276
336 3300031911 Ga0307412_10011865 Ga0307412_100118652 276
337 3300031995 Ga0307409_100105249 Ga0307409_1001052492 276
338 3300032002 Ga0307416_100086071 Ga0307416_1000860713 276
339 3300037312 Ga0395899_0002835 Ga0395899_0002835_3693_4529 276
340 3300037418 Ga0395900_0034627 Ga0395900_0034627_409_1275 276
341 3300037418 Ga0395900_0103618 Ga0395900_0103618_1304_2197 276
342 3300037466 Ga0395898_0036832 Ga0395898_0036832_2457_3293 276
343 3300037466 Ga0395898_0135857 Ga0395898_0135857_664_1542 276
344 3300037471 Ga0395905_0000864 Ga0395905_0000864_36030_36866 276
345 3300037471 Ga0395905_0124819 Ga0395905_0124819_280_1158 276
346 3300038443 Ga0395901_0000009 Ga0395901_0000009_275544_276413 276
347 3300038443 Ga0395901_0018611 Ga0395901_0018611_2049_2942 276
348 3300039447 Ga0436361_0204659 Ga0436361_0204659_6142_6984 276
349 3300039447 Ga0436361_0234917 Ga0436361_0234917_7950_8798 276
350 3300039447 Ga0436361_0860790 Ga0436361_0860790_3860_4702 276
351 3300041453 Ga0451797_1290501 Ga0451797_1290501_174_1010 276
352 3300041456 Ga0451795_0693632 Ga0451795_0693632_2606_3442 276
353 3300041459 Ga0451800_1495546 Ga0451800_1495546_2958_3794 276
354 3300041460 Ga0451802_0538624 Ga0451802_0538624_1643_2479 276
355 3300041486 Ga0451807_0295110 Ga0451807_0295110_2344_3180 276
356 3300041511 Ga0451855_0476812 Ga0451855_0476812_206_1042 276
357 3300042009 Ga0439451_000430 Ga0439451_000430_224_1057 276
358 3300042013 Ga0439456_001098 Ga0439456_001098_2821_3654 276
359 3300042013 Ga0439456_001555 Ga0439456_001555_3457_4290 276
360 3300042016 Ga0439463_006543 Ga0439463_006543_1486_2319 276
361 3300044672 Ga0466982_0000040 Ga0466982_0000040_36585_37418 276
362 3300044683 Ga0466965_0014160 Ga0466965_0014160_2163_2996 276
363 3300044684 Ga0466966_0000043 Ga0466966_0000043_27078_27911 276
364 3300044684 Ga0466966_0229381 Ga0466966_0229381_254_1087 276
365 3300044693 Ga0466961_0000276 Ga0466961_0000276_1022_1867 276
366 3300044693 Ga0466961_0000399 Ga0466961_0000399_796_1629 276
367 3300044693 Ga0466961_0002248 Ga0466961_0002248_8414_9247 276
368 3300044693 Ga0466961_0021631 Ga0466961_0021631_3079_3924 276
369 3300044694 Ga0466963_0013925 Ga0466963_0013925_2313_3158 276
370 3300044719 Ga0466971_0006143 Ga0466971_0006143_3206_4039 276
371 3300044719 Ga0466971_0018270 Ga0466971_0018270_447_1292 276
372 3300044765 Ga0466970_0025215 Ga0466970_0025215_522_1367 276
373 3300044842 Ga0466957_0034600 Ga0466957_0034600_84_917 276
374 3300044842 Ga0466957_0034805 Ga0466957_0034805_152_997 276
375 3300045049 Ga0466959_0006194 Ga0466959_0006194_779_1612 276
376 3300045049 Ga0466959_0014441 Ga0466959_0014441_2479_3312 276
377 3300045049 Ga0466959_0061661 Ga0466959_0061661_213_1058 276
378 3300045836 Ga0466958_0003683 Ga0466958_0003683_205_1047 276
379 3300045836 Ga0466958_0004961 Ga0466958_0004961_6248_7081 276
380 3300045836 Ga0466958_0009639 Ga0466958_0009639_2556_3389 276
381 3300045836 Ga0466958_0011537 Ga0466958_0011537_2781_3626 276
382 3300046454 Ga0495592_0003426 Ga0495592_0003426_2960_3793 276
383 3300046455 Ga0495603_0024474 Ga0495603_0024474_2665_3498 276
384 3300046455 Ga0495603_0027886 Ga0495603_0027886_329_1162 276
385 3300046457 Ga0495590_0028547 Ga0495590_0028547_871_1704 276
386 3300046458 Ga0495591_060250 Ga0495591_060250_24_857 276
387 3300046459 Ga0495629_0002611 Ga0495629_0002611_11613_12446 276
388 3300046459 Ga0495629_0003779 Ga0495629_0003779_7907_8740 276
389 3300046460 Ga0495638_0000052 Ga0495638_0000052_29069_29902 276
390 3300046461 Ga0495641_0012418 Ga0495641_0012418_50_883 276
391 3300046462 Ga0495651_0027687 Ga0495651_0027687_353_1195 276
392 3300046462 Ga0495651_0257932 Ga0495651_0257932_73_906 276
393 3300046463 Ga0495653_0015446 Ga0495653_0015446_3329_4162 276
394 3300046471 Ga0495650_0000015 Ga0495650_0000015_522434_523300 276
395 3300046471 Ga0495650_0000145 Ga0495650_0000145_9633_10466 276
396 3300046471 Ga0495650_0001196 Ga0495650_0001196_17767_18600 276
397 3300046471 Ga0495650_0003003 Ga0495650_0003003_7883_8716 276
398 3300046471 Ga0495650_0016591 Ga0495650_0016591_911_1744 276
399 3300046471 Ga0495650_0026303 Ga0495650_0026303_574_1407 276
400 3300046471 Ga0495650_0030988 Ga0495650_0030988_488_1321 276
401 3300046471 Ga0495650_0035756 Ga0495650_0035756_203_1036 276
402 3300046472 Ga0495580_0006174 Ga0495580_0006174_1420_2253 276
403 3300046472 Ga0495580_0035146 Ga0495580_0035146_205_1038 276
404 3300046472 Ga0495580_0276432 Ga0495580_0276432_271_1104 276
405 3300046473 Ga0495582_0011266 Ga0495582_0011266_2993_3826 276
406 3300046474 Ga0495605_0000222 Ga0495605_0000222_43525_44385 276
407 3300046474 Ga0495605_0042317 Ga0495605_0042317_218_1051 276
408 3300046475 Ga0495639_0029766 Ga0495639_0029766_466_1299 276
409 3300046477 Ga0495664_0025951 Ga0495664_0025951_617_1450 276
410 3300046477 Ga0495664_0181293 Ga0495664_0181293_156_989 276
411 3300046491 Ga0495584_0040929 Ga0495584_0040929_1127_1960 276
412 3300046491 Ga0495584_0085295 Ga0495584_0085295_559_1392 276
413 3300046492 Ga0495585_0010318 Ga0495585_0010318_1771_2604 276
414 3300046492 Ga0495585_0041098 Ga0495585_0041098_278_1111 276
415 3300046499 Ga0495594_0030303 Ga0495594_0030303_892_1725 276
416 3300046500 Ga0495596_0000094 Ga0495596_0000094_8943_9776 276
417 3300046500 Ga0495596_0003209 Ga0495596_0003209_612_1445 276
418 3300046501 Ga0495607_0000025 Ga0495607_0000025_153076_153921 276
419 3300046501 Ga0495607_0000507 Ga0495607_0000507_34673_35506 276
420 3300046501 Ga0495607_0000517 Ga0495607_0000517_21455_22321 276
421 3300046501 Ga0495607_0014088 Ga0495607_0014088_2637_3473 276
422 3300046501 Ga0495607_0024269 Ga0495607_0024269_1385_2218 276
423 3300046506 Ga0495583_0000086 Ga0495583_0000086_83177_84010 276
424 3300046506 Ga0495583_0015018 Ga0495583_0015018_2265_3098 276
425 3300046507 Ga0495606_0001737 Ga0495606_0001737_13956_14789 276
426 3300046507 Ga0495606_0045044 Ga0495606_0045044_1047_1889 276
427 3300046507 Ga0495606_0053398 Ga0495606_0053398_1573_2406 276
428 3300046507 Ga0495606_0192140 Ga0495606_0192140_308_1141 276
429 3300046511 Ga0495608_0000402 Ga0495608_0000402_26678_27511 276
430 3300046512 Ga0495610_0044766 Ga0495610_0044766_560_1393 276
431 3300046513 Ga0495616_0000615 Ga0495616_0000615_10648_11514 276
432 3300046513 Ga0495616_0015812 Ga0495616_0015812_2580_3413 276
433 3300046514 Ga0495618_0003285 Ga0495618_0003285_1635_2468 276
434 3300046515 Ga0495620_0000021 Ga0495620_0000021_17077_17943 276
435 3300046517 Ga0495630_0010276 Ga0495630_0010276_2063_2896 276
436 3300046517 Ga0495630_0137201 Ga0495630_0137201_857_1690 276
437 3300046518 Ga0495631_0000419 Ga0495631_0000419_12119_12985 276
438 3300046518 Ga0495631_0002033 Ga0495631_0002033_8276_9109 276
439 3300046519 Ga0495632_0000062 Ga0495632_0000062_94462_95295 276
440 3300046519 Ga0495632_0040375 Ga0495632_0040375_1504_2340 276
441 3300046519 Ga0495632_0045548 Ga0495632_0045548_1145_1978 276
442 3300046520 Ga0495637_0006422 Ga0495637_0006422_2584_3417 276
443 3300046520 Ga0495637_0038547 Ga0495637_0038547_874_1719 276
444 3300046522 Ga0495643_0000254 Ga0495643_0000254_43961_44806 276
445 3300046522 Ga0495643_0052380 Ga0495643_0052380_671_1537 276
446 3300046522 Ga0495643_0055049 Ga0495643_0055049_379_1212 276
447 3300046523 Ga0495644_0001820 Ga0495644_0001820_2936_3802 276
448 3300046524 Ga0495648_0005508 Ga0495648_0005508_2480_3316 276
449 3300046524 Ga0495648_0026034 Ga0495648_0026034_3092_3925 276
450 3300046526 Ga0495666_0028716 Ga0495666_0028716_1284_2117 276
451 3300046528 Ga0495642_0000753 Ga0495642_0000753_14416_15249 276
452 3300046529 Ga0495652_0001389 Ga0495652_0001389_2018_2851 276
453 3300046530 Ga0495654_0010930 Ga0495654_0010930_2505_3338 276
454 3300046531 Ga0495665_0027212 Ga0495665_0027212_479_1312 276
455 3300046531 Ga0495665_0058796 Ga0495665_0058796_282_1115 276
456 3300046533 Ga0495640_0005984 Ga0495640_0005984_5596_6429 276
457 3300046535 Ga0495586_0022328 Ga0495586_0022328_2064_2897 276
458 3300046535 Ga0495586_0255445 Ga0495586_0255445_146_979 276
459 3300046538 Ga0495609_0000148 Ga0495609_0000148_60570_61403 276
460 3300046538 Ga0495609_0003367 Ga0495609_0003367_2434_3267 276
461 3300046538 Ga0495609_0007175 Ga0495609_0007175_2935_3768 276
462 3300046542 Ga0495597_0000011 Ga0495597_0000011_215147_215992 276
463 3300046542 Ga0495597_0080819 Ga0495597_0080819_545_1378 276
464 3300046543 Ga0495645_0003033 Ga0495645_0003033_7868_8701 276
465 3300046543 Ga0495645_0060302 Ga0495645_0060302_1623_2456 276
466 3300046543 Ga0495645_0134168 Ga0495645_0134168_341_1174 276
467 3300046557 Ga0495622_0000420 Ga0495622_0000420_11098_11964 276
468 3300046557 Ga0495622_0014484 Ga0495622_0014484_2210_3043 276
469 3300046557 Ga0495622_0045531 Ga0495622_0045531_216_1049 276
470 3300046559 Ga0495667_0097743 Ga0495667_0097743_514_1347 276
471 3300046615 Ga0495656_0010072 Ga0495656_0010072_776_1609 276
472 3300046615 Ga0495656_0098584 Ga0495656_0098584_38_871 276
473 3300046642 Ga0495634_0014990 Ga0495634_0014990_4701_5534 276
474 3300046642 Ga0495634_0132339 Ga0495634_0132339_78_911 276
475 3300046660 Ga0495625_0000861 Ga0495625_0000861_11230_12096 276
476 3300046660 Ga0495625_0005899 Ga0495625_0005899_5891_6724 276
477 3300046660 Ga0495625_0020323 Ga0495625_0020323_418_1251 276
478 3300046665 Ga0495661_0024502 Ga0495661_0024502_2275_3141 276
479 3300046665 Ga0495661_0040225 Ga0495661_0040225_1352_2185 276
480 3300046674 Ga0495588_0000094 Ga0495588_0000094_80212_81078 276
481 3300046674 Ga0495588_0011084 Ga0495588_0011084_1501_2334 276
482 3300046679 Ga0495623_0016063 Ga0495623_0016063_1769_2602 276
483 3300046689 Ga0495613_0002059 Ga0495613_0002059_866_1699 276
484 3300046689 Ga0495613_0026646 Ga0495613_0026646_1581_2414 276
485 3300046691 Ga0495670_0034450 Ga0495670_0034450_217_1050 276
486 3300046691 Ga0495670_0123880 Ga0495670_0123880_405_1238 276
487 3300046692 Ga0495671_0012193 Ga0495671_0012193_1155_1988 276
488 3300046692 Ga0495671_0074290 Ga0495671_0074290_530_1363 276
489 3300046694 Ga0495649_0001301 Ga0495649_0001301_12963_13829 276
490 3300046694 Ga0495649_0003036 Ga0495649_0003036_1040_1873 276
491 3300046694 Ga0495649_0061955 Ga0495649_0061955_202_1035 276
492 3300046694 Ga0495649_0134872 Ga0495649_0134872_389_1234 276
493 3300046794 Ga0495589_0000011 Ga0495589_0000011_12697_13563 276
494 3300046794 Ga0495589_0000025 Ga0495589_0000025_105549_106382 276
495 3300046794 Ga0495589_0003728 Ga0495589_0003728_399_1232 276
496 3300046794 Ga0495589_0009673 Ga0495589_0009673_307_1140 276
497 3300046794 Ga0495589_0096031 Ga0495589_0096031_399_1232 276
498 3300046809 Ga0495600_0004412 Ga0495600_0004412_7070_7903 276
499 3300046809 Ga0495600_0026717 Ga0495600_0026717_933_1766 276
500 3300046810 Ga0495660_0001104 Ga0495660_0001104_7331_8197 276
501 3300046810 Ga0495660_0003415 Ga0495660_0003415_2749_3594 276
502 3300046810 Ga0495660_0015920 Ga0495660_0015920_2028_2861 276
503 3300046810 Ga0495660_0022997 Ga0495660_0022997_220_1053 276
504 3300046810 Ga0495660_0025436 Ga0495660_0025436_2505_3344 276
505 3300047315 Ga0495581_0002574 Ga0495581_0002574_4141_4974 276
506 3300047315 Ga0495581_0016672 Ga0495581_0016672_2661_3494 276
507 3300047317 Ga0495604_0017105 Ga0495604_0017105_1492_2325 276
508 3300047320 Ga0495672_0000090 Ga0495672_0000090_105373_106218 276
509 3300047320 Ga0495672_0028143 Ga0495672_0028143_2405_3238 276
510 3300047320 Ga0495672_0032587 Ga0495672_0032587_416_1282 276
511 3300047320 Ga0495672_0050021 Ga0495672_0050021_382_1227 276
512 3300047321 Ga0495676_0000004 Ga0495676_0000004_200116_200949 276
513 3300047322 Ga0495680_0024717 Ga0495680_0024717_2655_3488 276
514 3300047322 Ga0495680_0108806 Ga0495680_0108806_706_1548 276
515 3300047323 Ga0495683_0001821 Ga0495683_0001821_4300_5133 276
516 3300047443 Ga0495687_033370 Ga0495687_033370_628_1461 276
517 3300047443 Ga0495687_046645 Ga0495687_046645_687_1553 276
518 3300047444 Ga0495675_0012921 Ga0495675_0012921_3381_4214 276
519 3300047444 Ga0495675_0109921 Ga0495675_0109921_123_956 276
520 3300047469 Ga0495673_0007807 Ga0495673_0007807_3752_4585 276
521 3300047469 Ga0495673_0061273 Ga0495673_0061273_313_1179 276
522 3300047470 Ga0495681_0003969 Ga0495681_0003969_9352_10185 276
523 3300047470 Ga0495681_0097439 Ga0495681_0097439_215_1048 276
524 3300048088 Ga0495602_0069178 Ga0495602_0069178_1049_1882 276
525 3300048089 Ga0495614_0000269 Ga0495614_0000269_1951_2784 276
526 3300048091 Ga0495626_0000017 Ga0495626_0000017_12448_13281 276
527 3300048091 Ga0495626_0008220 Ga0495626_0008220_3038_3904 276
528 3300048091 Ga0495626_0071628 Ga0495626_0071628_150_983 276
529 3300048903 Ga0496100_0000094 Ga0496100_0000094_43406_44248 276
530 3300048903 Ga0496100_0016531 Ga0496100_0016531_2077_2910 276
531 3300048904 Ga0496101_0000181 Ga0496101_0000181_43393_44235 276
532 3300048904 Ga0496101_0086586 Ga0496101_0086586_724_1557 276
533 3300048905 Ga0496102_0000397 Ga0496102_0000397_43368_44210 276
534 3300048905 Ga0496102_0005182 Ga0496102_0005182_4615_5448 276
535 3300048905 Ga0496102_0125415 Ga0496102_0125415_109_954 276
536 3300048906 Ga0496103_0003529 Ga0496103_0003529_2260_3102 276
537 3300048907 Ga0496104_0049105 Ga0496104_0049105_2001_2843 276
538 3300048907 Ga0496104_0117559 Ga0496104_0117559_1091_1924 276
539 3300048909 Ga0496106_0004030 Ga0496106_0004030_7682_8557 276
540 3300048916 Ga0496113_0019743 Ga0496113_0019743_3670_4503 276
541 3300048916 Ga0496113_0024821 Ga0496113_0024821_860_1702 276
542 3300048918 Ga0496115_0000072 Ga0496115_0000072_23146_23979 276
543 3300048918 Ga0496115_0000462 Ga0496115_0000462_5703_6536 276
544 3300048919 Ga0496116_0021352 Ga0496116_0021352_4002_4847 276
545 3300048919 Ga0496116_0028808 Ga0496116_0028808_2187_3020 276
546 3300048920 Ga0496117_0000210 Ga0496117_0000210_6677_7519 276
547 3300048920 Ga0496117_0054473 Ga0496117_0054473_192_1079 276
548 3300048921 Ga0496118_0000788 Ga0496118_0000788_6553_7395 276
549 3300048921 Ga0496118_0004274 Ga0496118_0004274_275_1162 276
550 3300048921 Ga0496118_0069268 Ga0496118_0069268_146_976 276
551 3300048924 Ga0496121_0000290 Ga0496121_0000290_92745_93575 276
552 3300048924 Ga0496121_0000457 Ga0496121_0000457_73056_73898 276
553 3300048924 Ga0496121_0025456 Ga0496121_0025456_993_1841 276
554 3300048924 Ga0496121_0032295 Ga0496121_0032295_1420_2253 276
555 3300048924 Ga0496121_0125786 Ga0496121_0125786_118_951 276
556 3300048924 Ga0496121_0135553 Ga0496121_0135553_155_988 276
557 3300048925 Ga0496122_0000473 Ga0496122_0000473_63824_64657 276
558 3300048925 Ga0496122_0026840 Ga0496122_0026840_131_964 276
559 3300048925 Ga0496122_0133962 Ga0496122_0133962_342_1181 276
560 3300048926 Ga0496123_0000029 Ga0496123_0000029_221490_222323 276
561 3300048926 Ga0496123_0001289 Ga0496123_0001289_32335_33168 276
562 3300048926 Ga0496123_0011972 Ga0496123_0011972_4038_4871 276
563 3300048926 Ga0496123_0122015 Ga0496123_0122015_343_1182 276
564 3300048927 Ga0496124_0000022 Ga0496124_0000022_172677_173510 276
565 3300048927 Ga0496124_0138827 Ga0496124_0138827_19_885 276
566 3300048927 Ga0496124_0262460 Ga0496124_0262460_77_919 276
567 3300048927 Ga0496124_0424440 Ga0496124_0424440_25_858 276
568 3300048928 Ga0496125_0007717 Ga0496125_0007717_3523_4356 276
569 3300048928 Ga0496125_0008590 Ga0496125_0008590_7210_8040 276
570 3300048928 Ga0496125_0021684 Ga0496125_0021684_4690_5529 276
571 3300048928 Ga0496125_0080826 Ga0496125_0080826_1452_2285 276
572 3300048929 Ga0496126_0014182 Ga0496126_0014182_5756_6589 276
573 3300048929 Ga0496126_0066652 Ga0496126_0066652_1633_2475 276
574 3300048929 Ga0496126_0149775 Ga0496126_0149775_1103_1933 276
575 3300048929 Ga0496126_0150287 Ga0496126_0150287_960_1793 276
576 3300048929 Ga0496126_0203448 Ga0496126_0203448_398_1231 276
577 3300049459 Ga0495678_006770 Ga0495678_006770_3197_4063 276
578 3300049459 Ga0495678_031274 Ga0495678_031274_974_1807 276
579 3300049460 Ga0495682_0002612 Ga0495682_0002612_5791_6657 276
580 3300049570 Ga0501033_0004413 Ga0501033_0004413_5915_6748 276
581 3300049570 Ga0501033_0444188 Ga0501033_0444188_16_855 276
582 3300049571 Ga0501034_0126776 Ga0501034_0126776_1682_2521 276
583 3300049572 Ga0501036_0327181 Ga0501036_0327181_119_952 276
584 3300049578 Ga0501042_0168551 Ga0501042_0168551_661_1500 276
585 3300049581 Ga0501047_0006878 Ga0501047_0006878_6341_7174 276
586 3300049581 Ga0501047_0570809 Ga0501047_0570809_99_938 276
587 3300053090 Ga0500646_0006759 Ga0500646_0006759_1470_2306 276
588 3300053125 Ga0500618_001370 Ga0500618_001370_368_1216 276
589 3300053125 Ga0500618_010436 Ga0500618_010436_455_1303 276
590 3300053131 Ga0500652_000047 Ga0500652_000047_53656_54492 276
591 3300053139 Ga0500568_0000339 Ga0500568_0000339_5256_6095 276
592 3300053153 Ga0500616_0001844 Ga0500616_0001844_8258_9097 276
593 3300053156 Ga0500622_0000043 Ga0500622_0000043_22019_22855 276
594 3300053161 Ga0500634_0022277 Ga0500634_0022277_975_1808 276
595 3300061719 Ga0466962_0003548 Ga0466962_0003548_5471_6304 276
596 3300061719 Ga0466962_0073090 Ga0466962_0073090_381_1214 276
597 iso_pu_bacteria 2937967321 2937968452 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

5

195

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

11

239

0.92

PF08659

KR

KR domain

6

185

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1a-assembly6.cif.gz_J the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9483 5 275
3m1a-assembly4.cif.gz_E the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9438 3 276
3m1a-assembly2.cif.gz_B the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9423 3 276
3m1a-assembly6.cif.gz_J the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9414 5 275
3m1a-assembly4.cif.gz_E the crystal structure of a short-chain dehydrogenase from streptomyces avermitilis to 2a 0.9404 3 276
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 5 180 3.40.50.720
3m1aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9415 3 276 3.40.50.720
af_Q54WM6_4_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 1 276 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9396 5 163 3.40.50.720
3m1aB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 3 276 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3E0ADX9-F1-model_v4 deleted 0.987 3 276
AF-A0A3L7API4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9869 4 276 GO:0016491
AF-A0A1I5UCJ1-F1-model_v4 Short-chain dehydrogenase 0.9857 1 276 GO:0016491
AF-A0A1H2PR25-F1-model_v4 Short-chain dehydrogenase 0.9855 1 276 GO:0016491
AF-A0A7K2RBF0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9854 3 276 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.79 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map