F467681

General Info

Members Datasets Scaffolds Average Seq Length
597 218 1194 281

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100200005|Ga0307409_1002000052
Length 285
Sequence VNRLTTYLSFIRFSHSVFALPFALTGALLAWQQAPFEWRQILWVVVAMVSARSAAMGFNRLVDARMDALNPRTAMREIPRGALSARDATIFVIVSSILFVAAAWRLNRTCGLLSPVALAIVFWYSLAKRYTSYTQAFLGLAMAVAPVGGWLAVGGPMTAPQPWLLGLAIGLWVGGFDILYACQDLDFDRAHGLNSIPVRFGIARSLWISRVMHVATVICMAALAWLVPLGPIYLGGVALVAALLIYEQSLVSEHDLSQVKRAFDLNGWVGILYFATTGMALYVGR

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 98.83
Stem 0
Stem Tuber 0
Unclassified 9.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100200005 3300031995 Unclassified 1787
2 SwRhRL2b_contig_216420 2162886007 Bacteria 1467
3 JGI24746J21847_1000226 3300001977 Bacteria 7749
4 JGI25406J46586_10013354 3300003203 Bacteria 3530
5 Ga0065704_10080442 3300005289 Unclassified 3946
6 Ga0065704_10162790 3300005289 Bacteria 1343
7 Ga0065712_10068725 3300005290 Bacteria 9225
8 Ga0065715_10001981 3300005293 Bacteria 6530
9 Ga0065715_10020771 3300005293 Unclassified 1617
10 Ga0065715_10094912 3300005293 Bacteria 4213
11 Ga0065707_10005732 3300005295 Unclassified 3633
12 Ga0065707_10008899 3300005295 Bacteria 3502
13 Ga0065707_10100582 3300005295 Bacteria 2913
14 Ga0065707_10164961 3300005295 Unclassified 1530
15 Ga0070676_10001466 3300005328 Bacteria 11939
16 Ga0070676_10037451 3300005328 Bacteria 2797
17 Ga0070683_100015415 3300005329 Bacteria 6712
18 Ga0070690_100010100 3300005330 Bacteria 5482
19 Ga0070690_100212109 3300005330 Bacteria 1353
20 Ga0070690_100223336 3300005330 Bacteria 1321
21 Ga0070670_100008844 3300005331 Bacteria 8597
22 Ga0070670_100029899 3300005331 Bacteria 4692
23 Ga0070670_100280048 3300005331 Bacteria 1456
24 Ga0070677_10001081 3300005333 Bacteria 8788
25 Ga0070677_10006996 3300005333 Bacteria 3752
26 Ga0070677_10010959 3300005333 Bacteria 3114
27 Ga0070677_10015193 3300005333 Bacteria 2725
28 Ga0068869_100002788 3300005334 Bacteria 10587
29 Ga0068869_100009091 3300005334 Bacteria 6438
30 Ga0068869_100299484 3300005334 Bacteria 1298
31 Ga0068869_100314601 3300005334 Bacteria 1268
32 Ga0070666_10009970 3300005335 Bacteria 5929
33 Ga0070666_10112097 3300005335 Bacteria 1887
34 Ga0070666_10134612 3300005335 Bacteria 1719
35 Ga0070666_10296048 3300005335 Unclassified 1152
36 Ga0068868_100201282 3300005338 Bacteria 1660
37 Ga0070660_100206083 3300005339 Bacteria 1596
38 Ga0070689_100079436 3300005340 Bacteria 2573
39 Ga0070689_100120089 3300005340 Bacteria 2099
40 Ga0070689_100283479 3300005340 Bacteria 1375
41 Ga0070691_10015469 3300005341 Bacteria 3505
42 Ga0070687_100024707 3300005343 Bacteria 2874
43 Ga0070687_100235485 3300005343 Unclassified 1129
44 Ga0070661_100016578 3300005344 Bacteria 5212
45 Ga0070692_10115409 3300005345 Bacteria 1491
46 Ga0070692_10154727 3300005345 Bacteria 1309
47 Ga0070668_100019404 3300005347 Bacteria 5117
48 Ga0070668_100093953 3300005347 Unclassified 2367
49 Ga0070669_100000448 3300005353 Bacteria 31480
50 Ga0070669_100039000 3300005353 Bacteria 3450
51 Ga0070669_100050635 3300005353 Bacteria 3034
52 Ga0070669_100256271 3300005353 Bacteria 1394
53 Ga0070669_100399604 3300005353 Bacteria 1124
54 Ga0070675_100001092 3300005354 Bacteria 19569
55 Ga0070675_100004445 3300005354 Bacteria 10689
56 Ga0070675_100012301 3300005354 Bacteria 6706
57 Ga0070675_100030474 3300005354 Bacteria 4355
58 Ga0070675_100035828 3300005354 Bacteria 4035
59 Ga0070675_100054795 3300005354 Bacteria 3281
60 Ga0070675_100101770 3300005354 Bacteria 2421
61 Ga0070675_100248111 3300005354 Bacteria 1557
62 Ga0070675_100582838 3300005354 Bacteria 1014
63 Ga0070671_100009064 3300005355 Bacteria 7987
64 Ga0070671_100187266 3300005355 Bacteria 1754
65 Ga0070674_100000386 3300005356 Bacteria 22108
66 Ga0070673_100004167 3300005364 Bacteria 9112
67 Ga0070673_100018920 3300005364 Bacteria 4936
68 Ga0070673_100024924 3300005364 Bacteria 4394
69 Ga0070673_100031267 3300005364 Bacteria 3993
70 Ga0070673_100133589 3300005364 Bacteria 2086
71 Ga0070673_100159181 3300005364 Bacteria 1919
72 Ga0070688_100110713 3300005365 Bacteria 1826
73 Ga0070688_100126926 3300005365 Unclassified 1716
74 Ga0070667_100061774 3300005367 Bacteria 3172
75 Ga0070667_100396315 3300005367 Bacteria 1256
76 Ga0070713_100031949 3300005436 Bacteria 4199
77 Ga0070701_10103656 3300005438 Bacteria 1579
78 Ga0070700_100032864 3300005441 Bacteria 3121
79 Ga0070700_100033669 3300005441 Bacteria 3088
80 Ga0070700_100205271 3300005441 Bacteria 1387
81 Ga0070694_100001458 3300005444 Bacteria 13864
82 Ga0070694_100074751 3300005444 Bacteria 2342
83 Ga0070694_100117938 3300005444 Bacteria 1900
84 Ga0070694_100175563 3300005444 Unclassified 1581
85 Ga0070708_100122550 3300005445 Unclassified 2400
86 Ga0070663_100261907 3300005455 Bacteria 1372
87 Ga0070678_100105343 3300005456 Unclassified 2195
88 Ga0070678_100126238 3300005456 Bacteria 2026
89 Ga0070678_100171296 3300005456 Bacteria 1768
90 Ga0070662_100026026 3300005457 Bacteria 4048
91 Ga0070662_100388727 3300005457 Bacteria 1149
92 Ga0070681_10058384 3300005458 Bacteria 3838
93 Ga0070681_10326520 3300005458 Bacteria 1444
94 Ga0068867_100000717 3300005459 Bacteria 22125
95 Ga0068867_100049639 3300005459 Bacteria 3090
96 Ga0068867_100062056 3300005459 Bacteria 2776
97 Ga0068867_100107615 3300005459 Bacteria 2137
98 Ga0068867_100305608 3300005459 Unclassified 1313
99 Ga0070685_10073276 3300005466 Bacteria 2035
100 Ga0070707_100597369 3300005468 Unclassified 1066
101 Ga0070698_100069783 3300005471 Bacteria 3527
102 Ga0070698_100164127 3300005471 Bacteria 2164
103 Ga0070699_100000611 3300005518 Bacteria 33730
104 Ga0070699_100005713 3300005518 Bacteria 10893
105 Ga0070699_100062092 3300005518 Bacteria 3238
106 Ga0070679_100272916 3300005530 Bacteria 1645
107 Ga0070684_100033881 3300005535 Bacteria 4364
108 Ga0070672_100006035 3300005543 Bacteria 8093
109 Ga0070672_100023510 3300005543 Bacteria 4544
110 Ga0070672_100026801 3300005543 Bacteria 4294
111 Ga0070672_100028344 3300005543 Bacteria 4188
112 Ga0070672_100048842 3300005543 Bacteria 3290
113 Ga0070672_100053452 3300005543 Bacteria 3158
114 Ga0070686_100009860 3300005544 Bacteria 5368
115 Ga0070686_100027233 3300005544 Unclassified 3459
116 Ga0070695_100000171 3300005545 Bacteria 30974
117 Ga0070695_100002328 3300005545 Bacteria 10903
118 Ga0070696_100000124 3300005546 Bacteria 40765
119 Ga0070696_100042294 3300005546 Bacteria 3151
120 Ga0070696_100052776 3300005546 Bacteria 2829
121 Ga0070704_100000145 3300005549 Bacteria 26912
122 Ga0070704_100012307 3300005549 Bacteria 5283
123 Ga0070704_100046030 3300005549 Bacteria 3039
124 Ga0070704_100522635 3300005549 Bacteria 1033
125 Ga0070664_100014926 3300005564 Bacteria 6338
126 Ga0070664_100017324 3300005564 Bacteria 5915
127 Ga0068857_100047972 3300005577 Bacteria 3793
128 Ga0068857_100066111 3300005577 Unclassified 3217
129 Ga0068857_100428719 3300005577 Bacteria 1234
130 Ga0068854_100217390 3300005578 Bacteria 1510
131 Ga0068859_100002171 3300005617 Bacteria 19940
132 Ga0068859_100010368 3300005617 Bacteria 9375
133 Ga0068859_100029009 3300005617 Bacteria 5551
134 Ga0068859_100062605 3300005617 Bacteria 3751
135 Ga0068859_100076839 3300005617 Bacteria 3379
136 Ga0068859_100079850 3300005617 Bacteria 3312
137 Ga0068859_100120299 3300005617 Bacteria 2692
138 Ga0068859_100377325 3300005617 Bacteria 1513
139 Ga0068864_100049911 3300005618 Unclassified 3601
140 Ga0068864_100069093 3300005618 Bacteria 3071
141 Ga0068864_100135869 3300005618 Bacteria 2214
142 Ga0068866_10003215 3300005718 Bacteria 6738
143 Ga0068861_100009126 3300005719 Bacteria 6837
144 Ga0068861_100020574 3300005719 Bacteria 4729
145 Ga0068861_100061969 3300005719 Bacteria 2872
146 Ga0068861_100476255 3300005719 Bacteria 1124
147 Ga0068870_10008434 3300005840 Bacteria 4636
148 Ga0068870_10021410 3300005840 Bacteria 3162
149 Ga0068870_10026594 3300005840 Bacteria 2886
150 Ga0068870_10026654 3300005840 Bacteria 2883
151 Ga0068870_10043491 3300005840 Bacteria 2343
152 Ga0068870_10052357 3300005840 Bacteria 2164
153 Ga0068863_100027693 3300005841 Bacteria 5407
154 Ga0068863_100074278 3300005841 Bacteria 3217
155 Ga0068863_100120134 3300005841 Bacteria 2505
156 Ga0068863_100142998 3300005841 Bacteria 2287
157 Ga0068858_100006973 3300005842 Bacteria 10975
158 Ga0068858_100018755 3300005842 Bacteria 6472
159 Ga0068858_100080752 3300005842 Bacteria 3022
160 Ga0068858_100140435 3300005842 Bacteria 2267
161 Ga0068858_100256955 3300005842 Bacteria 1660
162 Ga0068858_100300064 3300005842 Bacteria 1532
163 Ga0068860_100017502 3300005843 Bacteria 6984
164 Ga0068860_100134778 3300005843 Bacteria 2371
165 Ga0068860_100276902 3300005843 Bacteria 1639
166 Ga0068860_100428139 3300005843 Bacteria 1313
167 Ga0068862_100004218 3300005844 Bacteria 12175
168 Ga0068862_100016672 3300005844 Bacteria 6117
169 Ga0068862_100078824 3300005844 Bacteria 2854
170 Ga0068862_100172155 3300005844 Bacteria 1939
171 Ga0068862_100381435 3300005844 Bacteria 1315
172 Ga0081539_10000122 3300005985 Bacteria 183393
173 Ga0081539_10001218 3300005985 Bacteria 45966
174 Ga0070716_100039639 3300006173 Bacteria 2616
175 Ga0097621_100031186 3300006237 Bacteria 4228
176 Ga0097621_100202829 3300006237 Unclassified 1722
177 Ga0097621_100290218 3300006237 Bacteria 1442
178 Ga0068871_100013495 3300006358 Bacteria 6065
179 Ga0068871_100090495 3300006358 Unclassified 2549
180 Ga0075428_100008246 3300006844 Bacteria 11550
181 Ga0075428_100170607 3300006844 Unclassified 2358
182 Ga0075428_100439791 3300006844 Bacteria 1397
183 Ga0075428_100615951 3300006844 Unclassified 1159
184 Ga0075430_100000792 3300006846 Bacteria 24519
185 Ga0075430_100021205 3300006846 Bacteria 5524
186 Ga0075430_100024023 3300006846 Bacteria 5190
187 Ga0075430_100041873 3300006846 Bacteria 3874
188 Ga0075430_100100333 3300006846 Bacteria 2418
189 Ga0075431_100041233 3300006847 Bacteria 4758
190 Ga0075431_100068901 3300006847 Bacteria 3650
191 Ga0075431_100277476 3300006847 Bacteria 1697
192 Ga0075433_10000117 3300006852 Bacteria 39826
193 Ga0075433_10001282 3300006852 Bacteria 18351
194 Ga0075433_10010140 3300006852 Bacteria 7554
195 Ga0075433_10018837 3300006852 Bacteria 5744
196 Ga0075433_10034343 3300006852 Bacteria 4355
197 Ga0075433_10058585 3300006852 Bacteria 3369
198 Ga0075434_100001628 3300006871 Bacteria 19107
199 Ga0075434_100002292 3300006871 Bacteria 16732
200 Ga0075434_100007494 3300006871 Bacteria 10099
201 Ga0075434_100087930 3300006871 Bacteria 3109
202 Ga0075434_100466830 3300006871 Unclassified 1283
203 Ga0075429_100006146 3300006880 Bacteria 10381
204 Ga0075429_100034414 3300006880 Bacteria 4402
205 Ga0075429_100097712 3300006880 Unclassified 2562
206 Ga0075429_100125570 3300006880 Bacteria 2244
207 Ga0075429_100249891 3300006880 Unclassified 1553
208 Ga0068865_100016311 3300006881 Bacteria 4751
209 Ga0068865_100023946 3300006881 Bacteria 4002
210 Ga0068865_100181838 3300006881 Bacteria 1620
211 Ga0075436_100185007 3300006914 Bacteria 1473
212 Ga0097620_100002171 3300006931 Bacteria 19940
213 Ga0097620_100010367 3300006931 Bacteria 9375
214 Ga0097620_100029008 3300006931 Bacteria 5551
215 Ga0097620_100062605 3300006931 Bacteria 3751
216 Ga0097620_100076838 3300006931 Bacteria 3379
217 Ga0097620_100079847 3300006931 Bacteria 3312
218 Ga0097620_100120306 3300006931 Bacteria 2692
219 Ga0097620_100377335 3300006931 Bacteria 1513
220 Ga0075435_100005321 3300007076 Bacteria 8965
221 Ga0075435_100019524 3300007076 Bacteria 5180
222 Ga0075435_100053459 3300007076 Bacteria 3257
223 Ga0075435_100053466 3300007076 Bacteria 3257
224 Ga0075435_100056659 3300007076 Bacteria 3169
225 Ga0111539_10000058 3300009094 Bacteria 114638
226 Ga0111539_10000325 3300009094 Bacteria 58382
227 Ga0111539_10001074 3300009094 Bacteria 36076
228 Ga0111539_10001176 3300009094 Bacteria 34725
229 Ga0111539_10006888 3300009094 Bacteria 14599
230 Ga0111539_10007219 3300009094 Bacteria 14239
231 Ga0111539_10008450 3300009094 Bacteria 13096
232 Ga0111539_10035555 3300009094 Bacteria 6030
233 Ga0111539_10135947 3300009094 Bacteria 2879
234 Ga0111539_10386350 3300009094 Bacteria 1630
235 Ga0111539_10870640 3300009094 Bacteria 1048
236 Ga0111539_10917376 3300009094 Bacteria 1019
237 Ga0114129_10000535 3300009147 Bacteria 46578
238 Ga0114129_10002137 3300009147 Bacteria 27257
239 Ga0114129_10049856 3300009147 Bacteria 5882
240 Ga0114129_10054838 3300009147 Bacteria 5587
241 Ga0114129_10146551 3300009147 Bacteria 3234
242 Ga0114129_10453300 3300009147 Bacteria 1682
243 Ga0114129_10623182 3300009147 Bacteria 1395
244 Ga0105243_10066813 3300009148 Bacteria 2893
245 Ga0105242_10021699 3300009176 Bacteria 5045
246 Ga0105248_10019433 3300009177 Bacteria 7518
247 Ga0105238_10215879 3300009551 Bacteria 1894
248 Ga0105249_10001652 3300009553 Bacteria 19532
249 Ga0105249_10101865 3300009553 Unclassified 2702
250 Ga0105249_10448971 3300009553 Bacteria 1328
251 Ga0105239_10410286 3300010375 Unclassified 1534
252 Ga0105246_10306215 3300011119 Bacteria 1285
253 Ga0157378_10240796 3300013297 Unclassified 1728
254 Ga0163162_10084095 3300013306 Unclassified 3257
255 Ga0157375_10198155 3300013308 Bacteria 2163
256 Ga0157375_10209664 3300013308 Bacteria 2105
257 Ga0157375_10258984 3300013308 Bacteria 1901
258 Ga0157375_10371334 3300013308 Bacteria 1597
259 Ga0157375_10520678 3300013308 Bacteria 1352
260 Ga0163163_10016032 3300014325 Bacteria 6949
261 Ga0163163_10047257 3300014325 Bacteria 4230
262 Ga0163163_10106417 3300014325 Bacteria 2831
263 Ga0163163_10144152 3300014325 Bacteria 2425
264 Ga0163163_10286761 3300014325 Bacteria 1698
265 Ga0157380_10012940 3300014326 Bacteria 6065
266 Ga0157380_10016184 3300014326 Bacteria 5494
267 Ga0157380_10019788 3300014326 Bacteria 5022
268 Ga0157380_10054191 3300014326 Bacteria 3182
269 Ga0157380_10078615 3300014326 Bacteria 2692
270 Ga0157380_10773576 3300014326 Bacteria 974
271 Ga0157377_10031567 3300014745 Bacteria 2879
272 Ga0157377_10068869 3300014745 Bacteria 2040
273 Ga0157377_10107806 3300014745 Bacteria 1670
274 Ga0157377_10222270 3300014745 Bacteria 1210
275 Ga0157379_10027066 3300014968 Bacteria 5104
276 Ga0157379_10334439 3300014968 Unclassified 1384
277 Ga0157376_10044295 3300014969 Bacteria 3657
278 Ga0157376_10714415 3300014969 Unclassified 1008
279 Ga0163161_10005036 3300017792 Bacteria 9191
280 Ga0163161_10005471 3300017792 Bacteria 8818
281 Ga0163161_10217362 3300017792 Bacteria 1479
282 Ga0207673_1007388 3300025290 Bacteria 1377
283 Ga0207697_10000205 3300025315 Bacteria 31703
284 Ga0207682_10000463 3300025893 Bacteria 18777
285 Ga0207682_10015566 3300025893 Unclassified 2961
286 Ga0207682_10016176 3300025893 Bacteria 2907
287 Ga0207642_10034042 3300025899 Bacteria 2162
288 Ga0207688_10001136 3300025901 Bacteria 13709
289 Ga0207688_10241605 3300025901 Unclassified 1092
290 Ga0207680_10038326 3300025903 Unclassified 2774
291 Ga0207680_10057584 3300025903 Bacteria 2352
292 Ga0207680_10062350 3300025903 Bacteria 2277
293 Ga0207680_10098927 3300025903 Bacteria 1870
294 Ga0207645_10000604 3300025907 Bacteria 29721
295 Ga0207645_10020178 3300025907 Bacteria 4364
296 Ga0207645_10049326 3300025907 Bacteria 2688
297 Ga0207645_10075909 3300025907 Bacteria 2152
298 Ga0207643_10000388 3300025908 Bacteria 29338
299 Ga0207643_10001982 3300025908 Bacteria 11311
300 Ga0207643_10006413 3300025908 Bacteria 6300
301 Ga0207643_10017916 3300025908 Bacteria 3879
302 Ga0207643_10028364 3300025908 Bacteria 3108
303 Ga0207643_10054176 3300025908 Bacteria 2279
304 Ga0207643_10232605 3300025908 Bacteria 1131
305 Ga0207707_10276842 3300025912 Bacteria 1454
306 Ga0207662_10000796 3300025918 Bacteria 14521
307 Ga0207662_10007461 3300025918 Bacteria 5956
308 Ga0207662_10065324 3300025918 Bacteria 2191
309 Ga0207662_10244287 3300025918 Unclassified 1176
310 Ga0207657_10128389 3300025919 Bacteria 2080
311 Ga0207652_10422203 3300025921 Bacteria 1203
312 Ga0207646_10071544 3300025922 Bacteria 3098
313 Ga0207646_10085682 3300025922 Bacteria 2818
314 Ga0207646_10389177 3300025922 Bacteria 1259
315 Ga0207681_10003972 3300025923 Bacteria 9170
316 Ga0207681_10004122 3300025923 Bacteria 9008
317 Ga0207681_10026254 3300025923 Bacteria 3755
318 Ga0207681_10155353 3300025923 Unclassified 1719
319 Ga0207694_10018424 3300025924 Bacteria 5277
320 Ga0207650_10069584 3300025925 Bacteria 2644
321 Ga0207659_10000293 3300025926 Bacteria 30396
322 Ga0207659_10000326 3300025926 Bacteria 28731
323 Ga0207659_10024251 3300025926 Bacteria 4061
324 Ga0207659_10039077 3300025926 Bacteria 3306
325 Ga0207659_10052293 3300025926 Bacteria 2909
326 Ga0207659_10072369 3300025926 Bacteria 2520
327 Ga0207659_10091915 3300025926 Bacteria 2268
328 Ga0207659_10102530 3300025926 Unclassified 2160
329 Ga0207659_10199532 3300025926 Bacteria 1597
330 Ga0207700_10036310 3300025928 Bacteria 3558
331 Ga0207644_10002251 3300025931 Bacteria 12526
332 Ga0207644_10029483 3300025931 Bacteria 3808
333 Ga0207644_10106582 3300025931 Bacteria 2113
334 Ga0207644_10185334 3300025931 Bacteria 1634
335 Ga0207690_10438323 3300025932 Bacteria 1048
336 Ga0207706_10005654 3300025933 Bacteria 11652
337 Ga0207706_10014400 3300025933 Bacteria 7167
338 Ga0207706_10027132 3300025933 Bacteria 5122
339 Ga0207706_10237930 3300025933 Bacteria 1592
340 Ga0207686_10018704 3300025934 Bacteria 3926
341 Ga0207686_10277772 3300025934 Bacteria 1235
342 Ga0207670_10059553 3300025936 Bacteria 2598
343 Ga0207670_10261587 3300025936 Bacteria 1341
344 Ga0207670_10328270 3300025936 Bacteria 1205
345 Ga0207670_10450956 3300025936 Unclassified 1037
346 Ga0207669_10019925 3300025937 Unclassified 3504
347 Ga0207669_10160630 3300025937 Bacteria 1587
348 Ga0207704_10101093 3300025938 Bacteria 1922
349 Ga0207704_10289390 3300025938 Bacteria 1249
350 Ga0207704_10314546 3300025938 Bacteria 1205
351 Ga0207704_10454274 3300025938 Unclassified 1023
352 Ga0207691_10003596 3300025940 Bacteria 15063
353 Ga0207691_10009207 3300025940 Bacteria 9476
354 Ga0207691_10028129 3300025940 Bacteria 5265
355 Ga0207691_10057108 3300025940 Bacteria 3554
356 Ga0207691_10081247 3300025940 Bacteria 2914
357 Ga0207691_10107007 3300025940 Bacteria 2490
358 Ga0207689_10000493 3300025942 Bacteria 37382
359 Ga0207689_10015328 3300025942 Bacteria 6488
360 Ga0207689_10051283 3300025942 Bacteria 3401
361 Ga0207689_10067714 3300025942 Bacteria 2934
362 Ga0207689_10166406 3300025942 Bacteria 1817
363 Ga0207679_10021147 3300025945 Bacteria 4403
364 Ga0207679_10026642 3300025945 Bacteria 3989
365 Ga0207651_10005824 3300025960 Bacteria 6370
366 Ga0207651_10019020 3300025960 Bacteria 4105
367 Ga0207651_10026638 3300025960 Bacteria 3616
368 Ga0207651_10039920 3300025960 Bacteria 3100
369 Ga0207651_10063133 3300025960 Bacteria 2585
370 Ga0207651_10092507 3300025960 Bacteria 2218
371 Ga0207651_10128470 3300025960 Bacteria 1935
372 Ga0207651_10133831 3300025960 Bacteria 1903
373 Ga0207651_10154471 3300025960 Bacteria 1791
374 Ga0207651_10383207 3300025960 Bacteria 1192
375 Ga0207712_10426296 3300025961 Unclassified 1120
376 Ga0207668_10044066 3300025972 Bacteria 3033
377 Ga0207640_10229151 3300025981 Bacteria 1428
378 Ga0207658_10029230 3300025986 Bacteria 3890
379 Ga0207658_10040609 3300025986 Bacteria 3365
380 Ga0207677_10034222 3300026023 Bacteria 3288
381 Ga0207677_10114736 3300026023 Bacteria 2014
382 Ga0207677_10161468 3300026023 Bacteria 1741
383 Ga0207677_10168254 3300026023 Bacteria 1711
384 Ga0207677_10526832 3300026023 Bacteria 1026
385 Ga0207703_10026361 3300026035 Bacteria 4574
386 Ga0207703_10118710 3300026035 Bacteria 2268
387 Ga0207703_10275826 3300026035 Bacteria 1525
388 Ga0207703_10321796 3300026035 Bacteria 1416
389 Ga0207678_10064313 3300026067 Bacteria 3152
390 Ga0207678_10107286 3300026067 Bacteria 2382
391 Ga0207678_10230412 3300026067 Bacteria 1586
392 Ga0207708_10005513 3300026075 Bacteria 9340
393 Ga0207708_10005619 3300026075 Bacteria 9255
394 Ga0207708_10036463 3300026075 Bacteria 3744
395 Ga0207708_10041795 3300026075 Bacteria 3495
396 Ga0207708_10290472 3300026075 Unclassified 1327
397 Ga0207708_10362961 3300026075 Bacteria 1191
398 Ga0207708_10424085 3300026075 Unclassified 1103
399 Ga0207641_10098598 3300026088 Bacteria 2570
400 Ga0207641_10259503 3300026088 Bacteria 1626
401 Ga0207648_10000066 3300026089 Bacteria 98414
402 Ga0207648_10001196 3300026089 Bacteria 29074
403 Ga0207648_10039451 3300026089 Bacteria 4152
404 Ga0207648_10041336 3300026089 Bacteria 4049
405 Ga0207648_10132214 3300026089 Unclassified 2197
406 Ga0207648_10178827 3300026089 Bacteria 1877
407 Ga0207676_10026424 3300026095 Bacteria 4319
408 Ga0207676_10032807 3300026095 Bacteria 3917
409 Ga0207676_10035881 3300026095 Unclassified 3768
410 Ga0207676_10168080 3300026095 Bacteria 1908
411 Ga0207676_10788806 3300026095 Bacteria 926
412 Ga0207674_10008960 3300026116 Bacteria 11499
413 Ga0207674_10073205 3300026116 Bacteria 3439
414 Ga0207674_10076651 3300026116 Bacteria 3351
415 Ga0207674_10092297 3300026116 Bacteria 3017
416 Ga0207674_10294572 3300026116 Bacteria 1571
417 Ga0207675_100003750 3300026118 Bacteria 14800
418 Ga0207675_100006154 3300026118 Bacteria 11400
419 Ga0207675_100017966 3300026118 Bacteria 6596
420 Ga0207675_100141153 3300026118 Bacteria 2288
421 Ga0207683_10057124 3300026121 Bacteria 3426
422 Ga0207683_10093579 3300026121 Bacteria 2678
423 Ga0207683_10207219 3300026121 Bacteria 1784
424 Ga0207683_10273444 3300026121 Bacteria 1543
425 Ga0207683_10346523 3300026121 Bacteria 1363
426 Ga0207683_10619767 3300026121 Bacteria 1002
427 Ga0207428_10002555 3300027907 Bacteria 18177
428 Ga0207428_10004178 3300027907 Bacteria 13837
429 Ga0207428_10038890 3300027907 Bacteria 3864
430 Ga0207428_10096297 3300027907 Bacteria 2292
431 Ga0207428_10105173 3300027907 Bacteria 2177
432 Ga0268265_10000073 3300028380 Bacteria 128856
433 Ga0268265_10029337 3300028380 Bacteria 3948
434 Ga0268265_10056730 3300028380 Bacteria 2982
435 Ga0268265_10624134 3300028380 Bacteria 1033
436 Ga0268264_10077925 3300028381 Unclassified 2824
437 Ga0268264_10310517 3300028381 Bacteria 1488
438 Ga0268264_10347264 3300028381 Bacteria 1411
439 Ga0307408_100294912 3300031548 Bacteria 1356
440 Ga0307413_10008660 3300031824 Bacteria 4820
441 Ga0307413_10178479 3300031824 Bacteria 1511
442 Ga0307410_10083625 3300031852 Bacteria 2248
443 Ga0307410_10104944 3300031852 Bacteria 2033
444 Ga0307407_10223685 3300031903 Bacteria 1274
445 Ga0307412_10018353 3300031911 Bacteria 4208
446 Ga0307412_10416743 3300031911 Bacteria 1098
447 Ga0307409_100007833 3300031995 Bacteria 6429
448 Ga0307409_100019967 3300031995 Bacteria 4552
449 Ga0307409_100151264 3300031995 Bacteria 2015
450 Ga0307409_100431131 3300031995 Bacteria 1267
451 Ga0307409_100439872 3300031995 Bacteria 1256
452 Ga0307416_100016422 3300032002 Bacteria 5146
453 Ga0307416_100877993 3300032002 Bacteria 996
454 Ga0307414_10056993 3300032004 Bacteria 2744
455 Ga0307414_10063282 3300032004 Unclassified 2629
456 Ga0307414_10084609 3300032004 Bacteria 2334
457 Ga0307414_10144366 3300032004 Bacteria 1868
458 Ga0307414_10157122 3300032004 Unclassified 1802
459 Ga0307411_10014236 3300032005 Bacteria 4419
460 Ga0307411_10156803 3300032005 Bacteria 1699
461 Ga0307411_10172879 3300032005 Bacteria 1631
462 Ga0307411_10180704 3300032005 Unclassified 1601
463 Ga0307411_10354210 3300032005 Bacteria 1198
464 Ga0307411_10392039 3300032005 Bacteria 1145
465 Ga0307415_100228098 3300032126 Bacteria 1498
466 Ga0373940_0031268 3300035088 Bacteria 1420
467 Ga0373932_0011491 3300035112 Bacteria 2164
468 Ga0373937_0029325 3300036401 Bacteria 4983
469 Ga0373925_0315650 3300037068 Bacteria 1264
470 Ga0439435_0028300 3300042436 Bacteria 1505
471 Ga0439464_0062991 3300042439 Bacteria 1088
472 Ga0453683_0273605 3300044673 Bacteria 1078
473 Ga0451576_0070732 3300045051 Bacteria 3632
474 Ga0451576_0103400 3300045051 Bacteria 2963
475 Ga0451576_0145432 3300045051 Bacteria 2472
476 Ga0451576_0367688 3300045051 Bacteria 1506
477 Ga0495592_0053608 3300046454 Bacteria 2991
478 Ga0495592_0244813 3300046454 Bacteria 1188
479 Ga0495603_0038413 3300046455 Bacteria 2871
480 Ga0495584_0036713 3300046491 Bacteria 2475
481 Ga0495594_0065941 3300046499 Bacteria 2008
482 Ga0495630_0284238 3300046517 Bacteria 1264
483 Ga0495663_0060661 3300046525 Bacteria 1188
484 Ga0495642_0043701 3300046528 Unclassified 1828
485 Ga0495609_0067901 3300046538 Bacteria 1570
486 Ga0495621_0032752 3300046539 Bacteria 1789
487 Ga0495621_0070301 3300046539 Bacteria 1288
488 Ga0495633_0055353 3300046558 Bacteria 1865
489 Ga0495656_0004734 3300046615 Bacteria 4677
490 Ga0495659_0007730 3300046664 Bacteria 3409
491 Ga0495659_0030383 3300046664 Bacteria 1880
492 Ga0495659_0038247 3300046664 Bacteria 1703
493 Ga0495659_0070159 3300046664 Bacteria 1311
494 Ga0495659_0081970 3300046664 Unclassified 1226
495 Ga0495646_0195300 3300046680 Bacteria 1104
496 Ga0495613_0048660 3300046689 Bacteria 3131
497 Ga0495670_0043877 3300046691 Unclassified 2232
498 Ga0495600_0090856 3300046809 Bacteria 1992
499 Ga0495636_0002541 3300047318 Bacteria 7008
500 Ga0496104_0260768 3300048907 Bacteria 1646
501 Ga0496108_0087988 3300048911 Bacteria 2639
502 Ga0496108_0275132 3300048911 Bacteria 1466
503 Ga0496109_0082018 3300048912 Bacteria 2972
504 Ga0496114_0002165 3300048917 Bacteria 14953
505 Ga0496114_0090657 3300048917 Bacteria 2595
506 Ga0496115_0049192 3300048918 Bacteria 3374
507 Ga0501036_0019387 3300049572 Bacteria 5710
508 Ga0501038_0008228 3300049574 Bacteria 9599
509 Ga0501040_0001382 3300049576 Bacteria 15327
510 Ga0501041_0000597 3300049577 Bacteria 18872
511 Ga0501042_0013619 3300049578 Bacteria 5538
512 Ga0501043_0028175 3300049579 Bacteria 4409
513 Ga0501046_0003486 3300049580 Bacteria 14423
514 Ga0501048_0034141 3300049582 Bacteria 3673
515 Ga0501048_0045508 3300049582 Bacteria 3135
516 Ga0501048_0172402 3300049582 Unclassified 1533
517 Ga0501071_0424995 3300049587 Bacteria 1016
518 Ga0501072_0009683 3300049588 Bacteria 7327
519 Ga0501072_0031440 3300049588 Bacteria 4156
520 Ga0501072_0033825 3300049588 Bacteria 4005
521 Ga0501073_0183137 3300049589 Bacteria 1450
522 Ga0501074_0173422 3300049590 Bacteria 1539
523 Ga0501075_0000178 3300049591 Bacteria 33062
524 Ga0501075_0033842 3300049591 Bacteria 3802
525 Ga0501076_0001119 3300049592 Bacteria 17678
526 Ga0501076_0252036 3300049592 Bacteria 1445
527 Ga0501077_0092965 3300049593 Bacteria 1912
528 Ga0501217_045482 3300049661 Unclassified 1131
529 Ga0501249_016970 3300049679 Unclassified 1566
530 Ga0501079_0000603 3300049741 Bacteria 23834
531 Ga0501079_0287663 3300049741 Bacteria 1285
532 Ga0501080_0024517 3300049742 Bacteria 5592
533 Ga0501080_0195337 3300049742 Bacteria 1859
534 Ga0501081_0000629 3300049743 Bacteria 20130
535 Ga0501081_0007117 3300049743 Bacteria 7270
536 Ga0501081_0139064 3300049743 Bacteria 1740
537 Ga0501283_011409 3300049779 Unclassified 1322
538 Ga0501035_0341181 3300049822 Bacteria 1255
539 Ga0501045_0002740 3300049824 Bacteria 12039
540 Ga0501045_0098148 3300049824 Bacteria 2167
541 nmdc:mga05p37_12306_c1 3300050507 Bacteria 10218
542 nmdc:mga05p37_126813_c1 3300050507 Bacteria 3134
543 nmdc:mga05p37_1358_c1 3300050507 Bacteria 28465
544 nmdc:mga05p37_26622_c1 3300050507 Bacteria 7032
545 nmdc:mga05p37_291949_c1 3300050507 Bacteria 1941
546 nmdc:mga05p37_316628_c1 3300050507 Bacteria 1848
547 nmdc:mga05p37_3422_c1 3300050507 Bacteria 18519
548 nmdc:mga05p37_364825_c1 3300050507 Bacteria 1697
549 nmdc:mga09592_163174_c1 3300050508 Unclassified 1925
550 nmdc:mga09592_4707_c1 3300050508 Bacteria 11050
551 nmdc:mga09592_484189_c1 3300050508 Bacteria 1066
552 nmdc:mga09592_58025_c1 3300050508 Bacteria 3273
553 nmdc:mga09592_79864_c2 3300050508 Bacteria 1960
554 nmdc:mga09592_93871_c1 3300050508 Bacteria 2566
555 nmdc:mga0qj67_35929_c1 3300050509 Bacteria 3875
556 nmdc:mga0qj67_6509_c1 3300050509 Bacteria 8581
557 nmdc:mga06r32_116515_c1 3300050510 Bacteria 2632
558 nmdc:mga06r32_278572_c1 3300050510 Bacteria 1660
559 nmdc:mga06r32_2825_c1 3300050510 Bacteria 15577
560 nmdc:mga06r32_49564_c1 3300050510 Bacteria 4016
561 nmdc:mga08y16_107187_c1 3300050511 Bacteria 2908
562 nmdc:mga08y16_11370_c1 3300050511 Bacteria 9353
563 nmdc:mga08y16_16162_c1 3300050511 Bacteria 7846
564 nmdc:mga08y16_308838_c1 3300050511 Unclassified 1629
565 nmdc:mga08y16_4298_c1 3300050511 Bacteria 14875
566 nmdc:mga08y16_62425_c1 3300050511 Bacteria 3891
567 nmdc:mga08y16_632_c1 3300050511 Bacteria 33000
568 nmdc:mga08y16_635_c1 3300050511 Bacteria 32952
569 nmdc:mga08y16_6914_c1 3300050511 Bacteria 11895
570 nmdc:mga08y16_91770_c1 3300050511 Bacteria 3165
571 nmdc:mga0n895_136332_c1 3300050512 Unclassified 2481
572 nmdc:mga0n895_1444_c1 3300050512 Bacteria 17764
573 nmdc:mga0n895_208597_c1 3300050512 Bacteria 1984
574 nmdc:mga0n895_31484_c1 3300050512 Bacteria 5080
575 nmdc:mga0n895_3741_c1 3300050512 Bacteria 12312
576 nmdc:mga0rr50_16307_c1 3300050513 Bacteria 4930
577 nmdc:mga0rr50_3496_c1 3300050513 Bacteria 9050
578 nmdc:mga0rr50_84200_c1 3300050513 Bacteria 2461
579 nmdc:mga0a205_10110_c1 3300050515 Bacteria 8660
580 nmdc:mga0a205_1202_c1 3300050515 Bacteria 21664
581 nmdc:mga0a205_130438_c1 3300050515 Bacteria 2414
582 nmdc:mga0a205_159262_c1 3300050515 Bacteria 2155
583 nmdc:mga0a205_2224_c1 3300050515 Bacteria 17074
584 nmdc:mga0a205_47_c1 3300050515 Bacteria 65667
585 Ga0501084_0011303 3300054114 Bacteria 7391
586 Ga0501084_0021751 3300054114 Bacteria 5349
587 Ga0501084_0387602 3300054114 Bacteria 1181
588 Ga0590071_000222 3300059421 Bacteria 16802
589 Ga0590071_000785 3300059421 Bacteria 8886
590 Ga0590074_005132 3300059423 Bacteria 2164
591 Ga0590075_000259 3300059424 Bacteria 14841
592 Ga0590075_001626 3300059424 Bacteria 5550
593 Ga0590077_000655 3300059426 Bacteria 9207
594 Ga0590077_000839 3300059426 Bacteria 7922
595 Ga0501082_0003739 3300060353 Bacteria 13297
596 Ga0501082_0522881 3300060353 Unclassified 1037
597 Ga0530510_0005302 3300061734 Bacteria 8911
598 Ga0307409_100200005
599 SwRhRL2b_contig_216420
600 JGI24746J21847_1000226
601 JGI25406J46586_10013354
602 Ga0065704_10080442
603 Ga0065704_10162790
604 Ga0065712_10068725
605 Ga0065715_10001981
606 Ga0065715_10020771
607 Ga0065715_10094912
608 Ga0065707_10005732
609 Ga0065707_10008899
610 Ga0065707_10100582
611 Ga0065707_10164961
612 Ga0070676_10001466
613 Ga0070676_10037451
614 Ga0070683_100015415
615 Ga0070690_100010100
616 Ga0070690_100212109
617 Ga0070690_100223336
618 Ga0070670_100008844
619 Ga0070670_100029899
620 Ga0070670_100280048
621 Ga0070677_10001081
622 Ga0070677_10006996
623 Ga0070677_10010959
624 Ga0070677_10015193
625 Ga0068869_100002788
626 Ga0068869_100009091
627 Ga0068869_100299484
628 Ga0068869_100314601
629 Ga0070666_10009970
630 Ga0070666_10112097
631 Ga0070666_10134612
632 Ga0070666_10296048
633 Ga0068868_100201282
634 Ga0070660_100206083
635 Ga0070689_100079436
636 Ga0070689_100120089
637 Ga0070689_100283479
638 Ga0070691_10015469
639 Ga0070687_100024707
640 Ga0070687_100235485
641 Ga0070661_100016578
642 Ga0070692_10115409
643 Ga0070692_10154727
644 Ga0070668_100019404
645 Ga0070668_100093953
646 Ga0070669_100000448
647 Ga0070669_100039000
648 Ga0070669_100050635
649 Ga0070669_100256271
650 Ga0070669_100399604
651 Ga0070675_100001092
652 Ga0070675_100004445
653 Ga0070675_100012301
654 Ga0070675_100030474
655 Ga0070675_100035828
656 Ga0070675_100054795
657 Ga0070675_100101770
658 Ga0070675_100248111
659 Ga0070675_100582838
660 Ga0070671_100009064
661 Ga0070671_100187266
662 Ga0070674_100000386
663 Ga0070673_100004167
664 Ga0070673_100018920
665 Ga0070673_100024924
666 Ga0070673_100031267
667 Ga0070673_100133589
668 Ga0070673_100159181
669 Ga0070688_100110713
670 Ga0070688_100126926
671 Ga0070667_100061774
672 Ga0070667_100396315
673 Ga0070713_100031949
674 Ga0070701_10103656
675 Ga0070700_100032864
676 Ga0070700_100033669
677 Ga0070700_100205271
678 Ga0070694_100001458
679 Ga0070694_100074751
680 Ga0070694_100117938
681 Ga0070694_100175563
682 Ga0070708_100122550
683 Ga0070663_100261907
684 Ga0070678_100105343
685 Ga0070678_100126238
686 Ga0070678_100171296
687 Ga0070662_100026026
688 Ga0070662_100388727
689 Ga0070681_10058384
690 Ga0070681_10326520
691 Ga0068867_100000717
692 Ga0068867_100049639
693 Ga0068867_100062056
694 Ga0068867_100107615
695 Ga0068867_100305608
696 Ga0070685_10073276
697 Ga0070707_100597369
698 Ga0070698_100069783
699 Ga0070698_100164127
700 Ga0070699_100000611
701 Ga0070699_100005713
702 Ga0070699_100062092
703 Ga0070679_100272916
704 Ga0070684_100033881
705 Ga0070672_100006035
706 Ga0070672_100023510
707 Ga0070672_100026801
708 Ga0070672_100028344
709 Ga0070672_100048842
710 Ga0070672_100053452
711 Ga0070686_100009860
712 Ga0070686_100027233
713 Ga0070695_100000171
714 Ga0070695_100002328
715 Ga0070696_100000124
716 Ga0070696_100042294
717 Ga0070696_100052776
718 Ga0070704_100000145
719 Ga0070704_100012307
720 Ga0070704_100046030
721 Ga0070704_100522635
722 Ga0070664_100014926
723 Ga0070664_100017324
724 Ga0068857_100047972
725 Ga0068857_100066111
726 Ga0068857_100428719
727 Ga0068854_100217390
728 Ga0068859_100002171
729 Ga0068859_100010368
730 Ga0068859_100029009
731 Ga0068859_100062605
732 Ga0068859_100076839
733 Ga0068859_100079850
734 Ga0068859_100120299
735 Ga0068859_100377325
736 Ga0068864_100049911
737 Ga0068864_100069093
738 Ga0068864_100135869
739 Ga0068866_10003215
740 Ga0068861_100009126
741 Ga0068861_100020574
742 Ga0068861_100061969
743 Ga0068861_100476255
744 Ga0068870_10008434
745 Ga0068870_10021410
746 Ga0068870_10026594
747 Ga0068870_10026654
748 Ga0068870_10043491
749 Ga0068870_10052357
750 Ga0068863_100027693
751 Ga0068863_100074278
752 Ga0068863_100120134
753 Ga0068863_100142998
754 Ga0068858_100006973
755 Ga0068858_100018755
756 Ga0068858_100080752
757 Ga0068858_100140435
758 Ga0068858_100256955
759 Ga0068858_100300064
760 Ga0068860_100017502
761 Ga0068860_100134778
762 Ga0068860_100276902
763 Ga0068860_100428139
764 Ga0068862_100004218
765 Ga0068862_100016672
766 Ga0068862_100078824
767 Ga0068862_100172155
768 Ga0068862_100381435
769 Ga0081539_10000122
770 Ga0081539_10001218
771 Ga0070716_100039639
772 Ga0097621_100031186
773 Ga0097621_100202829
774 Ga0097621_100290218
775 Ga0068871_100013495
776 Ga0068871_100090495
777 Ga0075428_100008246
778 Ga0075428_100170607
779 Ga0075428_100439791
780 Ga0075428_100615951
781 Ga0075430_100000792
782 Ga0075430_100021205
783 Ga0075430_100024023
784 Ga0075430_100041873
785 Ga0075430_100100333
786 Ga0075431_100041233
787 Ga0075431_100068901
788 Ga0075431_100277476
789 Ga0075433_10000117
790 Ga0075433_10001282
791 Ga0075433_10010140
792 Ga0075433_10018837
793 Ga0075433_10034343
794 Ga0075433_10058585
795 Ga0075434_100001628
796 Ga0075434_100002292
797 Ga0075434_100007494
798 Ga0075434_100087930
799 Ga0075434_100466830
800 Ga0075429_100006146
801 Ga0075429_100034414
802 Ga0075429_100097712
803 Ga0075429_100125570
804 Ga0075429_100249891
805 Ga0068865_100016311
806 Ga0068865_100023946
807 Ga0068865_100181838
808 Ga0075436_100185007
809 Ga0097620_100002171
810 Ga0097620_100010367
811 Ga0097620_100029008
812 Ga0097620_100062605
813 Ga0097620_100076838
814 Ga0097620_100079847
815 Ga0097620_100120306
816 Ga0097620_100377335
817 Ga0075435_100005321
818 Ga0075435_100019524
819 Ga0075435_100053459
820 Ga0075435_100053466
821 Ga0075435_100056659
822 Ga0111539_10000058
823 Ga0111539_10000325
824 Ga0111539_10001074
825 Ga0111539_10001176
826 Ga0111539_10006888
827 Ga0111539_10007219
828 Ga0111539_10008450
829 Ga0111539_10035555
830 Ga0111539_10135947
831 Ga0111539_10386350
832 Ga0111539_10870640
833 Ga0111539_10917376
834 Ga0114129_10000535
835 Ga0114129_10002137
836 Ga0114129_10049856
837 Ga0114129_10054838
838 Ga0114129_10146551
839 Ga0114129_10453300
840 Ga0114129_10623182
841 Ga0105243_10066813
842 Ga0105242_10021699
843 Ga0105248_10019433
844 Ga0105238_10215879
845 Ga0105249_10001652
846 Ga0105249_10101865
847 Ga0105249_10448971
848 Ga0105239_10410286
849 Ga0105246_10306215
850 Ga0157378_10240796
851 Ga0163162_10084095
852 Ga0157375_10198155
853 Ga0157375_10209664
854 Ga0157375_10258984
855 Ga0157375_10371334
856 Ga0157375_10520678
857 Ga0163163_10016032
858 Ga0163163_10047257
859 Ga0163163_10106417
860 Ga0163163_10144152
861 Ga0163163_10286761
862 Ga0157380_10012940
863 Ga0157380_10016184
864 Ga0157380_10019788
865 Ga0157380_10054191
866 Ga0157380_10078615
867 Ga0157380_10773576
868 Ga0157377_10031567
869 Ga0157377_10068869
870 Ga0157377_10107806
871 Ga0157377_10222270
872 Ga0157379_10027066
873 Ga0157379_10334439
874 Ga0157376_10044295
875 Ga0157376_10714415
876 Ga0163161_10005036
877 Ga0163161_10005471
878 Ga0163161_10217362
879 Ga0207673_1007388
880 Ga0207697_10000205
881 Ga0207682_10000463
882 Ga0207682_10015566
883 Ga0207682_10016176
884 Ga0207642_10034042
885 Ga0207688_10001136
886 Ga0207688_10241605
887 Ga0207680_10038326
888 Ga0207680_10057584
889 Ga0207680_10062350
890 Ga0207680_10098927
891 Ga0207645_10000604
892 Ga0207645_10020178
893 Ga0207645_10049326
894 Ga0207645_10075909
895 Ga0207643_10000388
896 Ga0207643_10001982
897 Ga0207643_10006413
898 Ga0207643_10017916
899 Ga0207643_10028364
900 Ga0207643_10054176
901 Ga0207643_10232605
902 Ga0207707_10276842
903 Ga0207662_10000796
904 Ga0207662_10007461
905 Ga0207662_10065324
906 Ga0207662_10244287
907 Ga0207657_10128389
908 Ga0207652_10422203
909 Ga0207646_10071544
910 Ga0207646_10085682
911 Ga0207646_10389177
912 Ga0207681_10003972
913 Ga0207681_10004122
914 Ga0207681_10026254
915 Ga0207681_10155353
916 Ga0207694_10018424
917 Ga0207650_10069584
918 Ga0207659_10000293
919 Ga0207659_10000326
920 Ga0207659_10024251
921 Ga0207659_10039077
922 Ga0207659_10052293
923 Ga0207659_10072369
924 Ga0207659_10091915
925 Ga0207659_10102530
926 Ga0207659_10199532
927 Ga0207700_10036310
928 Ga0207644_10002251
929 Ga0207644_10029483
930 Ga0207644_10106582
931 Ga0207644_10185334
932 Ga0207690_10438323
933 Ga0207706_10005654
934 Ga0207706_10014400
935 Ga0207706_10027132
936 Ga0207706_10237930
937 Ga0207686_10018704
938 Ga0207686_10277772
939 Ga0207670_10059553
940 Ga0207670_10261587
941 Ga0207670_10328270
942 Ga0207670_10450956
943 Ga0207669_10019925
944 Ga0207669_10160630
945 Ga0207704_10101093
946 Ga0207704_10289390
947 Ga0207704_10314546
948 Ga0207704_10454274
949 Ga0207691_10003596
950 Ga0207691_10009207
951 Ga0207691_10028129
952 Ga0207691_10057108
953 Ga0207691_10081247
954 Ga0207691_10107007
955 Ga0207689_10000493
956 Ga0207689_10015328
957 Ga0207689_10051283
958 Ga0207689_10067714
959 Ga0207689_10166406
960 Ga0207679_10021147
961 Ga0207679_10026642
962 Ga0207651_10005824
963 Ga0207651_10019020
964 Ga0207651_10026638
965 Ga0207651_10039920
966 Ga0207651_10063133
967 Ga0207651_10092507
968 Ga0207651_10128470
969 Ga0207651_10133831
970 Ga0207651_10154471
971 Ga0207651_10383207
972 Ga0207712_10426296
973 Ga0207668_10044066
974 Ga0207640_10229151
975 Ga0207658_10029230
976 Ga0207658_10040609
977 Ga0207677_10034222
978 Ga0207677_10114736
979 Ga0207677_10161468
980 Ga0207677_10168254
981 Ga0207677_10526832
982 Ga0207703_10026361
983 Ga0207703_10118710
984 Ga0207703_10275826
985 Ga0207703_10321796
986 Ga0207678_10064313
987 Ga0207678_10107286
988 Ga0207678_10230412
989 Ga0207708_10005513
990 Ga0207708_10005619
991 Ga0207708_10036463
992 Ga0207708_10041795
993 Ga0207708_10290472
994 Ga0207708_10362961
995 Ga0207708_10424085
996 Ga0207641_10098598
997 Ga0207641_10259503
998 Ga0207648_10000066
999 Ga0207648_10001196
1000 Ga0207648_10039451
1001 Ga0207648_10041336
1002 Ga0207648_10132214
1003 Ga0207648_10178827
1004 Ga0207676_10026424
1005 Ga0207676_10032807
1006 Ga0207676_10035881
1007 Ga0207676_10168080
1008 Ga0207676_10788806
1009 Ga0207674_10008960
1010 Ga0207674_10073205
1011 Ga0207674_10076651
1012 Ga0207674_10092297
1013 Ga0207674_10294572
1014 Ga0207675_100003750
1015 Ga0207675_100006154
1016 Ga0207675_100017966
1017 Ga0207675_100141153
1018 Ga0207683_10057124
1019 Ga0207683_10093579
1020 Ga0207683_10207219
1021 Ga0207683_10273444
1022 Ga0207683_10346523
1023 Ga0207683_10619767
1024 Ga0207428_10002555
1025 Ga0207428_10004178
1026 Ga0207428_10038890
1027 Ga0207428_10096297
1028 Ga0207428_10105173
1029 Ga0268265_10000073
1030 Ga0268265_10029337
1031 Ga0268265_10056730
1032 Ga0268265_10624134
1033 Ga0268264_10077925
1034 Ga0268264_10310517
1035 Ga0268264_10347264
1036 Ga0307408_100294912
1037 Ga0307413_10008660
1038 Ga0307413_10178479
1039 Ga0307410_10083625
1040 Ga0307410_10104944
1041 Ga0307407_10223685
1042 Ga0307412_10018353
1043 Ga0307412_10416743
1044 Ga0307409_100007833
1045 Ga0307409_100019967
1046 Ga0307409_100151264
1047 Ga0307409_100431131
1048 Ga0307409_100439872
1049 Ga0307416_100016422
1050 Ga0307416_100877993
1051 Ga0307414_10056993
1052 Ga0307414_10063282
1053 Ga0307414_10084609
1054 Ga0307414_10144366
1055 Ga0307414_10157122
1056 Ga0307411_10014236
1057 Ga0307411_10156803
1058 Ga0307411_10172879
1059 Ga0307411_10180704
1060 Ga0307411_10354210
1061 Ga0307411_10392039
1062 Ga0307415_100228098
1063 Ga0373940_0031268
1064 Ga0373932_0011491
1065 Ga0373937_0029325
1066 Ga0373925_0315650
1067 Ga0439435_0028300
1068 Ga0439464_0062991
1069 Ga0453683_0273605
1070 Ga0451576_0070732
1071 Ga0451576_0103400
1072 Ga0451576_0145432
1073 Ga0451576_0367688
1074 Ga0495592_0053608
1075 Ga0495592_0244813
1076 Ga0495603_0038413
1077 Ga0495584_0036713
1078 Ga0495594_0065941
1079 Ga0495630_0284238
1080 Ga0495663_0060661
1081 Ga0495642_0043701
1082 Ga0495609_0067901
1083 Ga0495621_0032752
1084 Ga0495621_0070301
1085 Ga0495633_0055353
1086 Ga0495656_0004734
1087 Ga0495659_0007730
1088 Ga0495659_0030383
1089 Ga0495659_0038247
1090 Ga0495659_0070159
1091 Ga0495659_0081970
1092 Ga0495646_0195300
1093 Ga0495613_0048660
1094 Ga0495670_0043877
1095 Ga0495600_0090856
1096 Ga0495636_0002541
1097 Ga0496104_0260768
1098 Ga0496108_0087988
1099 Ga0496108_0275132
1100 Ga0496109_0082018
1101 Ga0496114_0002165
1102 Ga0496114_0090657
1103 Ga0496115_0049192
1104 Ga0501036_0019387
1105 Ga0501038_0008228
1106 Ga0501040_0001382
1107 Ga0501041_0000597
1108 Ga0501042_0013619
1109 Ga0501043_0028175
1110 Ga0501046_0003486
1111 Ga0501048_0034141
1112 Ga0501048_0045508
1113 Ga0501048_0172402
1114 Ga0501071_0424995
1115 Ga0501072_0009683
1116 Ga0501072_0031440
1117 Ga0501072_0033825
1118 Ga0501073_0183137
1119 Ga0501074_0173422
1120 Ga0501075_0000178
1121 Ga0501075_0033842
1122 Ga0501076_0001119
1123 Ga0501076_0252036
1124 Ga0501077_0092965
1125 Ga0501217_045482
1126 Ga0501249_016970
1127 Ga0501079_0000603
1128 Ga0501079_0287663
1129 Ga0501080_0024517
1130 Ga0501080_0195337
1131 Ga0501081_0000629
1132 Ga0501081_0007117
1133 Ga0501081_0139064
1134 Ga0501283_011409
1135 Ga0501035_0341181
1136 Ga0501045_0002740
1137 Ga0501045_0098148
1138 nmdc:mga05p37_12306_c1
1139 nmdc:mga05p37_126813_c1
1140 nmdc:mga05p37_1358_c1
1141 nmdc:mga05p37_26622_c1
1142 nmdc:mga05p37_291949_c1
1143 nmdc:mga05p37_316628_c1
1144 nmdc:mga05p37_3422_c1
1145 nmdc:mga05p37_364825_c1
1146 nmdc:mga09592_163174_c1
1147 nmdc:mga09592_4707_c1
1148 nmdc:mga09592_484189_c1
1149 nmdc:mga09592_58025_c1
1150 nmdc:mga09592_79864_c2
1151 nmdc:mga09592_93871_c1
1152 nmdc:mga0qj67_35929_c1
1153 nmdc:mga0qj67_6509_c1
1154 nmdc:mga06r32_116515_c1
1155 nmdc:mga06r32_278572_c1
1156 nmdc:mga06r32_2825_c1
1157 nmdc:mga06r32_49564_c1
1158 nmdc:mga08y16_107187_c1
1159 nmdc:mga08y16_11370_c1
1160 nmdc:mga08y16_16162_c1
1161 nmdc:mga08y16_308838_c1
1162 nmdc:mga08y16_4298_c1
1163 nmdc:mga08y16_62425_c1
1164 nmdc:mga08y16_632_c1
1165 nmdc:mga08y16_635_c1
1166 nmdc:mga08y16_6914_c1
1167 nmdc:mga08y16_91770_c1
1168 nmdc:mga0n895_136332_c1
1169 nmdc:mga0n895_1444_c1
1170 nmdc:mga0n895_208597_c1
1171 nmdc:mga0n895_31484_c1
1172 nmdc:mga0n895_3741_c1
1173 nmdc:mga0rr50_16307_c1
1174 nmdc:mga0rr50_3496_c1
1175 nmdc:mga0rr50_84200_c1
1176 nmdc:mga0a205_10110_c1
1177 nmdc:mga0a205_1202_c1
1178 nmdc:mga0a205_130438_c1
1179 nmdc:mga0a205_159262_c1
1180 nmdc:mga0a205_2224_c1
1181 nmdc:mga0a205_47_c1
1182 Ga0501084_0011303
1183 Ga0501084_0021751
1184 Ga0501084_0387602
1185 Ga0590071_000222
1186 Ga0590071_000785
1187 Ga0590074_005132
1188 Ga0590075_000259
1189 Ga0590075_001626
1190 Ga0590077_000655
1191 Ga0590077_000839
1192 Ga0501082_0003739
1193 Ga0501082_0522881
1194 Ga0530510_0005302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

19

274

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9149 17 283
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8867 17 283
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7738 5 282
4tq6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7723 9 280
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7685 4 282
ID Description Score Start End Superfamily
4od5A01 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9623 17 156 1.10.357.140
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9305 17 156 1.10.357.140
af_K8ES01_95_243_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9216 17 156 1.10.357.140
af_Q54U71_333_454_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9213 169 285 1.20.120.1780
af_Q8I7J4_224_349_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9209 164 285 1.20.120.1780
ID Description Score Start End GO Terms
AF-A0A836UBU6-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9856 7 156 GO:0005886
GO:0006744
GO:0016765
AF-A0A838HKW1-F1-model_v4 UbiA family prenyltransferase 0.9844 7 157 GO:0005886
GO:0006744
GO:0016765
AF-A0A7V8WEA2-F1-model_v4 UbiA family prenyltransferase 0.984 94 286 GO:0005886
GO:0006744
GO:0016765
AF-A0A4Q3BCU5-F1-model_v4 deleted 0.9824 8 207
AF-A0A7Y5U2X4-F1-model_v4 UbiA family prenyltransferase 0.9821 1 286 GO:0005886
GO:0006744
GO:0016765

Map