F467648

General Info

Members Datasets Scaffolds Average Seq Length
597 267 1194 358

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10132952|Ga0070717_101329522
Length 412
Sequence MLSRPQQGGFLVLRRNLSSYRTLEHLASAPVTLPPPSTTATPPIAPLPAPAILAPVRFPLSWLLEHASAPIRYRAMTEVARLPSQSADRLSFLPFTHRAALMLAMLQSTDGTWNHSMLTVPAVRAEHFEGVGTISAVRRLLEYGWDRETPPLLLARRILFRLLAEDEDPEWLFEFGAKGPADEDAARRGRAILREAAAAALAQAGYEGDPRLRGAAKRIIERVVGYLRSPLAQKPFVRVGNQHVLAAEAAPPSMFALLMLAYMPLFRTEHHDAMDRLYQHLAQPLPRQEPVQLCGQKVMAQPHLVLGDLLANRNVADADVPFAMMWLELVARLGFMRRNENWSKLFDRFLDDRDQDGVWHPHKGMTVARSANPIVWPFYPLEENLSGDERWADVTFRLGLIARVIGRTIEIA

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
235 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
236 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
237 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
238 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
244 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
245 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
249 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
250 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
251 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
252 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 98.66
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10132952 3300006028 Unclassified 2141
2 MBSR1b_contig_10279081 2162886012 Unclassified 1590
3 Ga0065712_10107274 3300005290 Bacteria 1899
4 Ga0065715_10092603 3300005293 Bacteria 5031
5 Ga0065715_10132560 3300005293 Unclassified 1988
6 Ga0065707_10086002 3300005295 Bacteria 5725
7 Ga0070658_10004216 3300005327 Bacteria 11768
8 Ga0070658_10047772 3300005327 Bacteria 3463
9 Ga0070658_10111999 3300005327 Bacteria 2262
10 Ga0070676_10037765 3300005328 Unclassified 2786
11 Ga0070676_10067316 3300005328 Bacteria 2141
12 Ga0070683_100001402 3300005329 Bacteria 18509
13 Ga0070683_100005334 3300005329 Bacteria 10718
14 Ga0070683_100058907 3300005329 Bacteria 3568
15 Ga0070683_100073623 3300005329 Bacteria 3190
16 Ga0070683_100091202 3300005329 Bacteria 2861
17 Ga0070683_100137009 3300005329 Bacteria 2318
18 Ga0070690_100031738 3300005330 Unclassified 3293
19 Ga0070670_100005229 3300005331 Bacteria 10927
20 Ga0070670_100012450 3300005331 Bacteria 7279
21 Ga0070670_100024335 3300005331 Bacteria 5207
22 Ga0070670_100028999 3300005331 Bacteria 4763
23 Ga0070670_100057976 3300005331 Unclassified 3324
24 Ga0068869_100001049 3300005334 Bacteria 16102
25 Ga0068869_100027103 3300005334 Bacteria 3993
26 Ga0070666_10031908 3300005335 Bacteria 3479
27 Ga0070666_10092775 3300005335 Bacteria 2076
28 Ga0070680_100000211 3300005336 Bacteria 38342
29 Ga0070680_100002193 3300005336 Bacteria 14397
30 Ga0070680_100002464 3300005336 Bacteria 13711
31 Ga0070680_100002688 3300005336 Bacteria 13181
32 Ga0070680_100011383 3300005336 Bacteria 6879
33 Ga0070680_100036579 3300005336 Bacteria 3966
34 Ga0070680_100095170 3300005336 Unclassified 2468
35 Ga0070680_100168995 3300005336 Bacteria 1839
36 Ga0070680_100188902 3300005336 Bacteria 1736
37 Ga0070682_100000790 3300005337 Bacteria 18593
38 Ga0070682_100001451 3300005337 Bacteria 13334
39 Ga0070682_100010720 3300005337 Bacteria 5212
40 Ga0070682_100016215 3300005337 Bacteria 4329
41 Ga0068868_100265507 3300005338 Bacteria 1449
42 Ga0070660_100006624 3300005339 Bacteria 8037
43 Ga0070660_100077782 3300005339 Bacteria 2600
44 Ga0070689_100022167 3300005340 Bacteria 4739
45 Ga0070689_100184804 3300005340 Bacteria 1695
46 Ga0070687_100001962 3300005343 Bacteria 7523
47 Ga0070687_100013033 3300005343 Bacteria 3692
48 Ga0070661_100000965 3300005344 Bacteria 20487
49 Ga0070661_100004675 3300005344 Bacteria 9429
50 Ga0070661_100004701 3300005344 Bacteria 9400
51 Ga0070661_100033959 3300005344 Unclassified 3698
52 Ga0070661_100049438 3300005344 Bacteria 3078
53 Ga0070661_100140097 3300005344 Bacteria 1822
54 Ga0070661_100141228 3300005344 Bacteria 1815
55 Ga0070692_10003678 3300005345 Bacteria 6275
56 Ga0070692_10020119 3300005345 Bacteria 3232
57 Ga0070668_100159543 3300005347 Bacteria 1829
58 Ga0070669_100002801 3300005353 Bacteria 12586
59 Ga0070669_100012282 3300005353 Bacteria 6077
60 Ga0070669_100120633 3300005353 Bacteria 2000
61 Ga0070675_100001287 3300005354 Bacteria 18342
62 Ga0070675_100011812 3300005354 Bacteria 6843
63 Ga0070675_100038842 3300005354 Bacteria 3882
64 Ga0070675_100042358 3300005354 Bacteria 3720
65 Ga0070675_100258840 3300005354 Bacteria 1524
66 Ga0070671_100024347 3300005355 Unclassified 4955
67 Ga0070671_100050572 3300005355 Bacteria 3456
68 Ga0070674_100245600 3300005356 Unclassified 1404
69 Ga0070673_100076469 3300005364 Bacteria 2703
70 Ga0070673_100129174 3300005364 Bacteria 2118
71 Ga0070673_100295373 3300005364 Bacteria 1425
72 Ga0070688_100005871 3300005365 Bacteria 6496
73 Ga0070659_100003646 3300005366 Bacteria 10969
74 Ga0070659_100004835 3300005366 Bacteria 9622
75 Ga0070659_100013565 3300005366 Bacteria 6069
76 Ga0070659_100022685 3300005366 Bacteria 4794
77 Ga0070659_100335729 3300005366 Unclassified 1266
78 Ga0070667_100008417 3300005367 Bacteria 8557
79 Ga0070667_100067093 3300005367 Unclassified 3049
80 Ga0070703_10013658 3300005406 Bacteria 2308
81 Ga0070714_100012956 3300005435 Bacteria 6669
82 Ga0070714_100077656 3300005435 Bacteria 2884
83 Ga0070711_100172282 3300005439 Bacteria 1650
84 Ga0070708_100000849 3300005445 Bacteria 22993
85 Ga0070708_100018454 3300005445 Bacteria 5839
86 Ga0070663_100076849 3300005455 Bacteria 2443
87 Ga0070662_100000424 3300005457 Bacteria 25043
88 Ga0070662_100042621 3300005457 Bacteria 3242
89 Ga0070662_100178612 3300005457 Bacteria 1672
90 Ga0070681_10002407 3300005458 Bacteria 17106
91 Ga0070681_10005269 3300005458 Bacteria 12487
92 Ga0070681_10005393 3300005458 Bacteria 12347
93 Ga0070681_10008249 3300005458 Bacteria 10193
94 Ga0070681_10023997 3300005458 Bacteria 6140
95 Ga0070681_10321787 3300005458 Bacteria 1456
96 Ga0068867_100014698 3300005459 Bacteria 5547
97 Ga0070685_10022157 3300005466 Bacteria 3459
98 Ga0070685_10040313 3300005466 Bacteria 2657
99 Ga0070685_10135584 3300005466 Unclassified 1544
100 Ga0070706_100035147 3300005467 Bacteria 4627
101 Ga0070706_100092829 3300005467 Bacteria 2800
102 Ga0070707_100002115 3300005468 Bacteria 19017
103 Ga0070707_100095400 3300005468 Bacteria 2881
104 Ga0070707_100109433 3300005468 Unclassified 2680
105 Ga0070707_100122482 3300005468 Bacteria 2525
106 Ga0070707_100203054 3300005468 Bacteria 1932
107 Ga0070698_100015754 3300005471 Bacteria 7985
108 Ga0070698_100023353 3300005471 Bacteria 6464
109 Ga0070699_100016562 3300005518 Bacteria 6327
110 Ga0070699_100020754 3300005518 Bacteria 5666
111 Ga0070679_100000085 3300005530 Bacteria 70740
112 Ga0070679_100000355 3300005530 Bacteria 39034
113 Ga0070679_100002038 3300005530 Bacteria 18142
114 Ga0070679_100002972 3300005530 Bacteria 15467
115 Ga0070679_100003613 3300005530 Bacteria 14133
116 Ga0070679_100004960 3300005530 Bacteria 12285
117 Ga0070679_100032603 3300005530 Bacteria 5154
118 Ga0070679_100035763 3300005530 Bacteria 4927
119 Ga0070679_100155728 3300005530 Bacteria 2260
120 Ga0070684_100001085 3300005535 Bacteria 19504
121 Ga0070684_100002564 3300005535 Bacteria 13418
122 Ga0070684_100007288 3300005535 Bacteria 8599
123 Ga0070684_100010548 3300005535 Bacteria 7325
124 Ga0070684_100025041 3300005535 Bacteria 5011
125 Ga0070684_100098467 3300005535 Bacteria 2609
126 Ga0070684_100142985 3300005535 Bacteria 2164
127 Ga0070684_100162472 3300005535 Bacteria 2027
128 Ga0070697_100097679 3300005536 Bacteria 2437
129 Ga0068853_100038666 3300005539 Bacteria 4065
130 Ga0068853_100051795 3300005539 Unclassified 3534
131 Ga0068853_100130969 3300005539 Bacteria 2245
132 Ga0070672_100014501 3300005543 Bacteria 5587
133 Ga0070672_100185686 3300005543 Unclassified 1734
134 Ga0070695_100008476 3300005545 Bacteria 6100
135 Ga0070695_100090258 3300005545 Bacteria 2044
136 Ga0070696_100004808 3300005546 Bacteria 9029
137 Ga0068855_100001420 3300005563 Bacteria 29751
138 Ga0068855_100007089 3300005563 Bacteria 13596
139 Ga0068855_100026460 3300005563 Bacteria 6939
140 Ga0068855_100034889 3300005563 Bacteria 5995
141 Ga0068855_100048604 3300005563 Bacteria 5006
142 Ga0068855_100216579 3300005563 Bacteria 2149
143 Ga0070664_100000313 3300005564 Bacteria 35339
144 Ga0070664_100002171 3300005564 Bacteria 15749
145 Ga0070664_100005882 3300005564 Bacteria 9903
146 Ga0070664_100028013 3300005564 Bacteria 4685
147 Ga0070664_100040470 3300005564 Unclassified 3929
148 Ga0070664_100058501 3300005564 Bacteria 3278
149 Ga0070664_100073209 3300005564 Unclassified 2939
150 Ga0070664_100210528 3300005564 Unclassified 1737
151 Ga0068857_100000179 3300005577 Bacteria 40362
152 Ga0068857_100000495 3300005577 Bacteria 28278
153 Ga0068857_100008030 3300005577 Bacteria 9102
154 Ga0068857_100011370 3300005577 Bacteria 7743
155 Ga0068857_100039204 3300005577 Bacteria 4195
156 Ga0068857_100064552 3300005577 Bacteria 3255
157 Ga0068857_100249439 3300005577 Bacteria 1627
158 Ga0068854_100009904 3300005578 Bacteria 6166
159 Ga0068854_100056769 3300005578 Bacteria 2823
160 Ga0068854_100120090 3300005578 Bacteria 1994
161 Ga0068856_100003777 3300005614 Bacteria 15169
162 Ga0070702_100018912 3300005615 Bacteria 3581
163 Ga0068852_100020098 3300005616 Bacteria 5304
164 Ga0068852_100022032 3300005616 Bacteria 5100
165 Ga0068852_100025845 3300005616 Bacteria 4764
166 Ga0068852_100167219 3300005616 Unclassified 2058
167 Ga0068859_100021114 3300005617 Bacteria 6534
168 Ga0068859_100069586 3300005617 Bacteria 3554
169 Ga0068864_100008261 3300005618 Bacteria 8586
170 Ga0068864_100014535 3300005618 Bacteria 6540
171 Ga0068866_10004619 3300005718 Bacteria 5646
172 Ga0068861_100007253 3300005719 Bacteria 7597
173 Ga0068851_10029991 3300005834 Bacteria 2695
174 Ga0068870_10031641 3300005840 Unclassified 2682
175 Ga0068863_100079094 3300005841 Bacteria 3114
176 Ga0068863_100128028 3300005841 Bacteria 2423
177 Ga0068858_100027021 3300005842 Bacteria 5330
178 Ga0068858_100050059 3300005842 Unclassified 3867
179 Ga0068860_100012629 3300005843 Bacteria 8311
180 Ga0068860_100037303 3300005843 Bacteria 4653
181 Ga0068862_100037198 3300005844 Bacteria 4125
182 Ga0070716_100093868 3300006173 Bacteria 1822
183 Ga0070712_100218371 3300006175 Bacteria 1508
184 Ga0068871_100034443 3300006358 Bacteria 4018
185 Ga0068871_100193081 3300006358 Bacteria 1755
186 Ga0075428_100393821 3300006844 Bacteria 1485
187 Ga0075430_100002736 3300006846 Bacteria 14720
188 Ga0075430_100009941 3300006846 Bacteria 8046
189 Ga0075430_100056995 3300006846 Bacteria 3286
190 Ga0075430_100193614 3300006846 Bacteria 1689
191 Ga0075431_100055741 3300006847 Bacteria 4078
192 Ga0075431_100330921 3300006847 Unclassified 1534
193 Ga0075433_10021167 3300006852 Bacteria 5450
194 Ga0075434_100017657 3300006871 Bacteria 6877
195 Ga0068865_100019525 3300006881 Bacteria 4386
196 Ga0068865_100213199 3300006881 Unclassified 1506
197 Ga0075436_100009980 3300006914 Bacteria 6496
198 Ga0075436_100016778 3300006914 Bacteria 5013
199 Ga0075436_100021637 3300006914 Bacteria 4414
200 Ga0097620_100021115 3300006931 Bacteria 6534
201 Ga0097620_100069590 3300006931 Bacteria 3554
202 Ga0075435_100008656 3300007076 Bacteria 7316
203 Ga0099795_10003411 3300007788 Bacteria 3928
204 Ga0105240_10124670 3300009093 Bacteria 3097
205 Ga0105240_10152084 3300009093 Unclassified 2755
206 Ga0105240_10275034 3300009093 Bacteria 1937
207 Ga0111539_10036945 3300009094 Bacteria 5902
208 Ga0105245_10024020 3300009098 Bacteria 5351
209 Ga0105245_10042292 3300009098 Bacteria 4065
210 Ga0105245_10048195 3300009098 Bacteria 3811
211 Ga0105245_10062529 3300009098 Bacteria 3359
212 Ga0114129_10012586 3300009147 Bacteria 12048
213 Ga0105241_10057235 3300009174 Unclassified 2990
214 Ga0105241_10071396 3300009174 Unclassified 2695
215 Ga0105241_10183727 3300009174 Bacteria 1736
216 Ga0105242_10040329 3300009176 Bacteria 3763
217 Ga0105248_10011861 3300009177 Bacteria 9615
218 Ga0105248_10019314 3300009177 Bacteria 7541
219 Ga0105248_10026436 3300009177 Bacteria 6457
220 Ga0105248_10153149 3300009177 Bacteria 2601
221 Ga0105248_10261374 3300009177 Unclassified 1949
222 Ga0105237_10046545 3300009545 Bacteria 4363
223 Ga0105237_10121199 3300009545 Unclassified 2610
224 Ga0105238_10061051 3300009551 Bacteria 3773
225 Ga0105238_10068486 3300009551 Bacteria 3550
226 Ga0105238_10149251 3300009551 Bacteria 2313
227 Ga0105238_10278908 3300009551 Bacteria 1652
228 Ga0105249_10006039 3300009553 Bacteria 10494
229 Ga0105249_10060953 3300009553 Bacteria 3462
230 Ga0105249_10133713 3300009553 Bacteria 2371
231 Ga0099796_10001176 3300010159 Bacteria 5079
232 Ga0105239_10053701 3300010375 Bacteria 4419
233 Ga0105246_10001757 3300011119 Bacteria 12961
234 Ga0157373_10037965 3300013100 Bacteria 3451
235 Ga0157373_10117608 3300013100 Bacteria 1868
236 Ga0157371_10011933 3300013102 Bacteria 6663
237 Ga0157371_10133390 3300013102 Bacteria 1767
238 Ga0157370_10131534 3300013104 Unclassified 2334
239 Ga0157370_10205822 3300013104 Unclassified 1824
240 Ga0157369_10021605 3300013105 Bacteria 7197
241 Ga0157369_10109205 3300013105 Bacteria 2941
242 Ga0157369_10154431 3300013105 Bacteria 2425
243 Ga0157369_10238699 3300013105 Bacteria 1899
244 Ga0157369_10302341 3300013105 Bacteria 1664
245 Ga0157369_10314072 3300013105 Bacteria 1629
246 Ga0157374_10024538 3300013296 Bacteria 5407
247 Ga0157374_10032088 3300013296 Unclassified 4780
248 Ga0157374_10075153 3300013296 Bacteria 3193
249 Ga0157374_10216611 3300013296 Bacteria 1878
250 Ga0157378_10002336 3300013297 Bacteria 16841
251 Ga0157378_10023731 3300013297 Bacteria 5395
252 Ga0157378_10099905 3300013297 Bacteria 2648
253 Ga0157378_10139188 3300013297 Bacteria 2253
254 Ga0157378_10163930 3300013297 Bacteria 2080
255 Ga0163162_10002048 3300013306 Bacteria 18939
256 Ga0157372_10003799 3300013307 Bacteria 16216
257 Ga0157372_10021660 3300013307 Bacteria 6948
258 Ga0157372_10025111 3300013307 Bacteria 6476
259 Ga0157372_10036633 3300013307 Bacteria 5408
260 Ga0157372_10038903 3300013307 Bacteria 5249
261 Ga0157372_10047871 3300013307 Bacteria 4752
262 Ga0157372_10134245 3300013307 Bacteria 2849
263 Ga0157372_10168563 3300013307 Bacteria 2533
264 Ga0157372_10203259 3300013307 Bacteria 2295
265 Ga0157372_10269240 3300013307 Unclassified 1979
266 Ga0157375_10005804 3300013308 Bacteria 10743
267 Ga0157375_10008124 3300013308 Bacteria 9183
268 Ga0157375_10162236 3300013308 Unclassified 2378
269 Ga0163163_10002127 3300014325 Bacteria 16729
270 Ga0163163_10073490 3300014325 Bacteria 3410
271 Ga0163163_10150316 3300014325 Bacteria 2373
272 Ga0163163_10385663 3300014325 Bacteria 1459
273 Ga0157377_10011964 3300014745 Bacteria 4350
274 Ga0157377_10193262 3300014745 Bacteria 1287
275 Ga0157379_10007606 3300014968 Bacteria 9379
276 Ga0182007_10015980 3300015262 Bacteria 2781
277 Ga0163161_10012618 3300017792 Bacteria 5871
278 Ga0206353_11062776 3300020082 Bacteria 1588
279 Ga0207697_10005401 3300025315 Bacteria 5942
280 Ga0207642_10043498 3300025899 Bacteria 1981
281 Ga0207645_10001996 3300025907 Bacteria 16406
282 Ga0207645_10063986 3300025907 Bacteria 2350
283 Ga0207645_10076616 3300025907 Bacteria 2142
284 Ga0207643_10020267 3300025908 Unclassified 3649
285 Ga0207705_10002919 3300025909 Bacteria 13064
286 Ga0207705_10013095 3300025909 Bacteria 5985
287 Ga0207654_10021822 3300025911 Unclassified 3410
288 Ga0207707_10000303 3300025912 Bacteria 51777
289 Ga0207707_10000872 3300025912 Bacteria 29454
290 Ga0207707_10002037 3300025912 Bacteria 18342
291 Ga0207707_10019607 3300025912 Bacteria 5902
292 Ga0207707_10039036 3300025912 Bacteria 4150
293 Ga0207707_10041828 3300025912 Bacteria 4001
294 Ga0207707_10069981 3300025912 Bacteria 3058
295 Ga0207695_10022331 3300025913 Bacteria 7187
296 Ga0207695_10067295 3300025913 Bacteria 3675
297 Ga0207695_10172476 3300025913 Unclassified 2088
298 Ga0207671_10063170 3300025914 Unclassified 2751
299 Ga0207671_10162167 3300025914 Unclassified 1732
300 Ga0207693_10088255 3300025915 Unclassified 2431
301 Ga0207660_10001634 3300025917 Bacteria 15030
302 Ga0207660_10011842 3300025917 Bacteria 5687
303 Ga0207660_10016634 3300025917 Bacteria 4873
304 Ga0207660_10022288 3300025917 Bacteria 4267
305 Ga0207662_10001793 3300025918 Bacteria 10538
306 Ga0207662_10003880 3300025918 Bacteria 7782
307 Ga0207657_10013223 3300025919 Bacteria 8100
308 Ga0207657_10043399 3300025919 Bacteria 3961
309 Ga0207657_10046442 3300025919 Bacteria 3803
310 Ga0207657_10062627 3300025919 Bacteria 3184
311 Ga0207649_10002406 3300025920 Bacteria 10487
312 Ga0207649_10011144 3300025920 Bacteria 4948
313 Ga0207649_10036228 3300025920 Bacteria 2970
314 Ga0207649_10042157 3300025920 Unclassified 2783
315 Ga0207649_10059317 3300025920 Bacteria 2400
316 Ga0207649_10071532 3300025920 Bacteria 2216
317 Ga0207652_10000526 3300025921 Bacteria 38877
318 Ga0207652_10002073 3300025921 Bacteria 17266
319 Ga0207652_10002917 3300025921 Bacteria 14310
320 Ga0207652_10005853 3300025921 Bacteria 9959
321 Ga0207652_10034175 3300025921 Bacteria 4284
322 Ga0207646_10048666 3300025922 Unclassified 3800
323 Ga0207646_10123672 3300025922 Bacteria 2326
324 Ga0207681_10012803 3300025923 Bacteria 5184
325 Ga0207681_10013491 3300025923 Bacteria 5058
326 Ga0207681_10033533 3300025923 Bacteria 3367
327 Ga0207694_10062333 3300025924 Bacteria 2903
328 Ga0207694_10087633 3300025924 Unclassified 2453
329 Ga0207694_10215448 3300025924 Bacteria 1565
330 Ga0207650_10004261 3300025925 Bacteria 9761
331 Ga0207650_10012067 3300025925 Bacteria 5957
332 Ga0207650_10057237 3300025925 Bacteria 2899
333 Ga0207650_10058215 3300025925 Bacteria 2877
334 Ga0207659_10022835 3300025926 Bacteria 4170
335 Ga0207659_10039822 3300025926 Unclassified 3281
336 Ga0207659_10060602 3300025926 Bacteria 2724
337 Ga0207687_10075709 3300025927 Bacteria 2416
338 Ga0207687_10107386 3300025927 Bacteria 2065
339 Ga0207664_10001170 3300025929 Bacteria 17446
340 Ga0207664_10026494 3300025929 Bacteria 4384
341 Ga0207664_10156640 3300025929 Bacteria 1940
342 Ga0207644_10136962 3300025931 Unclassified 1881
343 Ga0207690_10024198 3300025932 Bacteria 3801
344 Ga0207690_10024833 3300025932 Bacteria 3757
345 Ga0207690_10025295 3300025932 Bacteria 3725
346 Ga0207690_10130931 3300025932 Unclassified 1836
347 Ga0207706_10000323 3300025933 Bacteria 51731
348 Ga0207706_10016185 3300025933 Bacteria 6738
349 Ga0207706_10021738 3300025933 Bacteria 5758
350 Ga0207686_10081311 3300025934 Bacteria 2115
351 Ga0207670_10079842 3300025936 Bacteria 2285
352 Ga0207669_10032838 3300025937 Bacteria 2921
353 Ga0207669_10215795 3300025937 Unclassified 1404
354 Ga0207691_10003612 3300025940 Bacteria 15028
355 Ga0207691_10004648 3300025940 Bacteria 13296
356 Ga0207691_10057706 3300025940 Unclassified 3532
357 Ga0207711_10015445 3300025941 Bacteria 6337
358 Ga0207711_10258708 3300025941 Bacteria 1599
359 Ga0207689_10001442 3300025942 Bacteria 22737
360 Ga0207689_10019703 3300025942 Bacteria 5684
361 Ga0207689_10051357 3300025942 Bacteria 3399
362 Ga0207661_10000242 3300025944 Bacteria 35489
363 Ga0207661_10000342 3300025944 Bacteria 29828
364 Ga0207661_10004112 3300025944 Bacteria 10169
365 Ga0207661_10034692 3300025944 Bacteria 3926
366 Ga0207661_10065353 3300025944 Bacteria 2953
367 Ga0207661_10148792 3300025944 Bacteria 2022
368 Ga0207679_10000498 3300025945 Bacteria 27060
369 Ga0207679_10001124 3300025945 Bacteria 17078
370 Ga0207679_10008327 3300025945 Bacteria 6605
371 Ga0207679_10009176 3300025945 Bacteria 6325
372 Ga0207679_10018472 3300025945 Unclassified 4672
373 Ga0207679_10067805 3300025945 Bacteria 2678
374 Ga0207679_10147413 3300025945 Unclassified 1911
375 Ga0207667_10103863 3300025949 Bacteria 2930
376 Ga0207667_10122882 3300025949 Bacteria 2675
377 Ga0207667_10123187 3300025949 Unclassified 2671
378 Ga0207651_10049697 3300025960 Unclassified 2842
379 Ga0207651_10093774 3300025960 Bacteria 2205
380 Ga0207651_10255500 3300025960 Unclassified 1436
381 Ga0207712_10002381 3300025961 Bacteria 12182
382 Ga0207668_10012005 3300025972 Bacteria 5286
383 Ga0207640_10017119 3300025981 Bacteria 4233
384 Ga0207640_10083306 3300025981 Bacteria 2192
385 Ga0207640_10104183 3300025981 Bacteria 1996
386 Ga0207640_10169213 3300025981 Bacteria 1626
387 Ga0207658_10055909 3300025986 Bacteria 2927
388 Ga0207658_10183875 3300025986 Bacteria 1732
389 Ga0207677_10037705 3300026023 Bacteria 3162
390 Ga0207677_10086793 3300026023 Bacteria 2263
391 Ga0207677_10100367 3300026023 Bacteria 2128
392 Ga0207703_10070038 3300026035 Bacteria 2894
393 Ga0207639_10086232 3300026041 Unclassified 2499
394 Ga0207639_10241135 3300026041 Bacteria 1572
395 Ga0207641_10054611 3300026088 Bacteria 3390
396 Ga0207641_10089255 3300026088 Bacteria 2693
397 Ga0207641_10161084 3300026088 Bacteria 2040
398 Ga0207648_10008328 3300026089 Bacteria 10059
399 Ga0207648_10018714 3300026089 Bacteria 6264
400 Ga0207676_10020265 3300026095 Bacteria 4863
401 Ga0207676_10029857 3300026095 Bacteria 4086
402 Ga0207676_10037558 3300026095 Bacteria 3692
403 Ga0207676_10175835 3300026095 Unclassified 1869
404 Ga0207674_10000387 3300026116 Bacteria 57349
405 Ga0207674_10000842 3300026116 Bacteria 39994
406 Ga0207674_10001900 3300026116 Bacteria 26581
407 Ga0207674_10003885 3300026116 Bacteria 18191
408 Ga0207674_10019410 3300026116 Bacteria 7363
409 Ga0207674_10090003 3300026116 Bacteria 3061
410 Ga0207675_100000372 3300026118 Bacteria 43036
411 Ga0207698_10088078 3300026142 Unclassified 2531
412 Ga0207698_10162705 3300026142 Unclassified 1954
413 Ga0207698_10184811 3300026142 Unclassified 1850
414 Ga0209179_1003005 3300027512 Bacteria 2368
415 Ga0209998_10001045 3300027717 Bacteria 6943
416 Ga0268265_10021415 3300028380 Bacteria 4528
417 Ga0268265_10065843 3300028380 Bacteria 2798
418 Ga0268264_10017322 3300028381 Bacteria 5903
419 Ga0268264_10095140 3300028381 Bacteria 2577
420 Ga0307408_100213587 3300031548 Bacteria 1569
421 Ga0307405_10010806 3300031731 Bacteria 4750
422 Ga0307405_10103641 3300031731 Bacteria 1913
423 Ga0307405_10131695 3300031731 Bacteria 1729
424 Ga0307413_10082940 3300031824 Bacteria 2061
425 Ga0307410_10001914 3300031852 Bacteria 9749
426 Ga0307410_10075375 3300031852 Bacteria 2351
427 Ga0307406_10014765 3300031901 Bacteria 4500
428 Ga0307406_10061290 3300031901 Bacteria 2429
429 Ga0307406_10062487 3300031901 Unclassified 2409
430 Ga0307406_10077393 3300031901 Bacteria 2200
431 Ga0307406_10084611 3300031901 Bacteria 2118
432 Ga0307407_10000304 3300031903 Bacteria 14506
433 Ga0307407_10030242 3300031903 Bacteria 2920
434 Ga0307407_10055561 3300031903 Bacteria 2288
435 Ga0307412_10002031 3300031911 Bacteria 11248
436 Ga0307412_10004846 3300031911 Bacteria 7509
437 Ga0307412_10011032 3300031911 Bacteria 5221
438 Ga0307412_10046366 3300031911 Bacteria 2848
439 Ga0307412_10049666 3300031911 Bacteria 2765
440 Ga0307412_10099037 3300031911 Unclassified 2057
441 Ga0307409_100001171 3300031995 Bacteria 12521
442 Ga0307409_100012398 3300031995 Bacteria 5431
443 Ga0307409_100098393 3300031995 Bacteria 2419
444 Ga0307409_100128865 3300031995 Bacteria 2158
445 Ga0307416_100008551 3300032002 Bacteria 6615
446 Ga0307416_100029322 3300032002 Bacteria 4108
447 Ga0307416_100030920 3300032002 Bacteria 4024
448 Ga0307416_100069096 3300032002 Bacteria 2922
449 Ga0307416_100164578 3300032002 Bacteria 2055
450 Ga0307411_10000924 3300032005 Bacteria 11173
451 Ga0307411_10022666 3300032005 Bacteria 3702
452 Ga0307411_10037201 3300032005 Unclassified 3058
453 Ga0307411_10060132 3300032005 Bacteria 2521
454 Ga0307411_10116857 3300032005 Bacteria 1921
455 Ga0307411_10169732 3300032005 Bacteria 1644
456 Ga0307415_100002151 3300032126 Bacteria 9764
457 Ga0307415_100019164 3300032126 Bacteria 4148
458 Ga0307415_100077917 3300032126 Unclassified 2355
459 Ga0307415_100213268 3300032126 Bacteria 1542
460 Ga0373934_0000730 3300035086 Bacteria 11748
461 Ga0373953_0000876 3300035117 Bacteria 8440
462 Ga0373957_0031223 3300035120 Unclassified 1956
463 Ga0373955_0001343 3300035172 Bacteria 10443
464 Ga0373955_0040724 3300035172 Bacteria 2486
465 Ga0373924_0064900 3300035410 Unclassified 1533
466 Ga0373931_0003938 3300035691 Bacteria 6719
467 Ga0373935_0022863 3300035692 Bacteria 3838
468 Ga0373927_0046018 3300035695 Unclassified 2824
469 Ga0373927_0102956 3300035695 Bacteria 1857
470 Ga0373927_0120722 3300035695 Unclassified 1710
471 Ga0373933_0000183 3300035724 Bacteria 41364
472 Ga0373933_0028129 3300035724 Unclassified 3241
473 Ga0373937_0000101 3300036401 Bacteria 81054
474 Ga0373937_0000533 3300036401 Bacteria 34025
475 Ga0373925_0097537 3300037068 Bacteria 2254
476 Ga0436364_0274025 3300037853 Bacteria 1474
477 Ga0439446_0052595 3300042156 Bacteria 1219
478 Ga0451577_0025189 3300042876 Bacteria 5399
479 Ga0451577_0131919 3300042876 Unclassified 2242
480 Ga0453684_0039668 3300044712 Bacteria 6410
481 Ga0466967_0036446 3300045976 Bacteria 4199
482 Ga0495592_0128939 3300046454 Unclassified 1771
483 Ga0495629_0015420 3300046459 Bacteria 5488
484 Ga0495629_0085993 3300046459 Bacteria 2194
485 Ga0495651_0000911 3300046462 Bacteria 22936
486 Ga0495651_0078262 3300046462 Bacteria 2501
487 Ga0495653_0000271 3300046463 Bacteria 41959
488 Ga0495580_0011023 3300046472 Bacteria 7006
489 Ga0495580_0109690 3300046472 Unclassified 1916
490 Ga0495662_0002568 3300046476 Bacteria 9168
491 Ga0495664_0118044 3300046477 Bacteria 1604
492 Ga0495594_0003439 3300046499 Bacteria 8173
493 Ga0495596_0039657 3300046500 Unclassified 1860
494 Ga0495608_0000232 3300046511 Bacteria 40250
495 Ga0495628_0000358 3300046516 Bacteria 41642
496 Ga0495628_0011653 3300046516 Bacteria 7427
497 Ga0495628_0032366 3300046516 Bacteria 4221
498 Ga0495628_0116706 3300046516 Bacteria 2050
499 Ga0495630_0036356 3300046517 Bacteria 3681
500 Ga0495630_0056829 3300046517 Bacteria 2932
501 Ga0495652_0004164 3300046529 Bacteria 13942
502 Ga0495665_0022579 3300046531 Bacteria 3382
503 Ga0495640_0044853 3300046533 Bacteria 3071
504 Ga0495640_0100104 3300046533 Bacteria 1904
505 Ga0495586_0014366 3300046535 Bacteria 4207
506 Ga0495586_0191776 3300046535 Bacteria 1157
507 Ga0495587_0000229 3300046536 Bacteria 41448
508 Ga0495587_0003098 3300046536 Bacteria 11113
509 Ga0495587_0094779 3300046536 Unclassified 1723
510 Ga0495645_0000066 3300046543 Bacteria 73132
511 Ga0495645_0057181 3300046543 Unclassified 2832
512 Ga0495645_0158314 3300046543 Bacteria 1567
513 Ga0495667_0024824 3300046559 Bacteria 4038
514 Ga0495667_0055974 3300046559 Bacteria 2594
515 Ga0495634_0027875 3300046642 Bacteria 3926
516 Ga0495635_0000260 3300046663 Bacteria 33902
517 Ga0495635_0021470 3300046663 Bacteria 4501
518 Ga0495588_0003711 3300046674 Bacteria 6686
519 Ga0495657_0000794 3300046675 Bacteria 28070
520 Ga0495657_0112076 3300046675 Bacteria 1727
521 Ga0495599_0000280 3300046678 Bacteria 31273
522 Ga0495599_0037141 3300046678 Unclassified 3060
523 Ga0495599_0149234 3300046678 Unclassified 1448
524 Ga0495623_0000151 3300046679 Bacteria 42876
525 Ga0495623_0007045 3300046679 Bacteria 7306
526 Ga0495623_0083187 3300046679 Bacteria 1977
527 Ga0495646_0000547 3300046680 Bacteria 20285
528 Ga0495646_0065257 3300046680 Bacteria 2156
529 Ga0495613_0107300 3300046689 Bacteria 2014
530 Ga0495613_0120525 3300046689 Bacteria 1884
531 Ga0495600_0000207 3300046809 Bacteria 33867
532 Ga0495581_0038045 3300047315 Unclassified 2784
533 Ga0495604_0000633 3300047317 Bacteria 30242
534 Ga0495674_0042232 3300047319 Bacteria 4068
535 Ga0495674_0062955 3300047319 Bacteria 3228
536 Ga0495680_0041861 3300047322 Bacteria 3638
537 Ga0495680_0047098 3300047322 Bacteria 3394
538 Ga0495680_0152975 3300047322 Bacteria 1680
539 Ga0495675_0001467 3300047444 Bacteria 14265
540 Ga0495675_0007513 3300047444 Bacteria 6718
541 Ga0495675_0014533 3300047444 Bacteria 4977
542 Ga0495675_0131376 3300047444 Unclassified 1556
543 Ga0495685_049190 3300047447 Unclassified 1432
544 Ga0495684_0000428 3300047471 Bacteria 34287
545 Ga0495684_0023109 3300047471 Bacteria 4782
546 Ga0495602_0000545 3300048088 Bacteria 35134
547 Ga0496104_0220651 3300048907 Unclassified 1808
548 Ga0496105_0152252 3300048908 Unclassified 1901
549 Ga0496108_0103884 3300048911 Bacteria 2425
550 Ga0496112_0000846 3300048915 Bacteria 21835
551 Ga0496112_0117561 3300048915 Bacteria 2629
552 Ga0496113_0014546 3300048916 Bacteria 5372
553 Ga0496115_0017289 3300048918 Bacteria 5509
554 Ga0501038_0021601 3300049574 Bacteria 5776
555 Ga0501038_0051923 3300049574 Bacteria 3536
556 Ga0501038_0101527 3300049574 Bacteria 2394
557 Ga0501047_0028778 3300049581 Bacteria 5359
558 Ga0501067_0079575 3300049583 Unclassified 1816
559 Ga0501075_0069668 3300049591 Bacteria 2658
560 Ga0501076_0121273 3300049592 Unclassified 2117
561 Ga0501202_001891 3300049652 Bacteria 3437
562 Ga0501207_002545 3300049654 Unclassified 2368
563 Ga0501209_005853 3300049656 Bacteria 2251
564 Ga0501216_011208 3300049660 Bacteria 1453
565 Ga0501227_007308 3300049665 Unclassified 2366
566 Ga0501233_017174 3300049668 Bacteria 1508
567 Ga0501235_000394 3300049669 Bacteria 8378
568 Ga0501247_003929 3300049677 Bacteria 1611
569 Ga0501249_004913 3300049679 Bacteria 2727
570 Ga0501257_006527 3300049686 Unclassified 2590
571 Ga0501259_003834 3300049688 Bacteria 2391
572 Ga0501221_002958 3300049704 Unclassified 2799
573 Ga0501080_0251639 3300049742 Unclassified 1611
574 Ga0501081_0041404 3300049743 Bacteria 3155
575 Ga0501262_006853 3300049759 Bacteria 1369
576 Ga0501266_005487 3300049763 Bacteria 1576
577 Ga0501268_000450 3300049765 Bacteria 4448
578 Ga0501272_001806 3300049769 Unclassified 2080
579 Ga0501274_001599 3300049771 Bacteria 1737
580 Ga0501035_0156388 3300049822 Bacteria 1976
581 Ga0501212_000692 3300049851 Bacteria 3426
582 nmdc:mga05p37_24424_c1 3300050507 Bacteria 7345
583 nmdc:mga09592_72317_c1 3300050508 Bacteria 2928
584 nmdc:mga0qj67_112725_c1 3300050509 Bacteria 2196
585 nmdc:mga0qj67_1382_c1 3300050509 Bacteria 17005
586 nmdc:mga0qj67_84077_c1 3300050509 Unclassified 2552
587 nmdc:mga06r32_49191_c1 3300050510 Bacteria 4031
588 nmdc:mga08y16_70444_c1 3300050511 Bacteria 3645
589 nmdc:mga0n895_6143_c1 3300050512 Bacteria 10147
590 nmdc:mga0rr50_172416_c1 3300050513 Bacteria 1764
591 nmdc:mga0rr50_45706_c1 3300050513 Unclassified 3220
592 nmdc:mga08x19_26228_c1 3300050514 Bacteria 3635
593 nmdc:mga0a205_1390_c1 3300050515 Bacteria 20471
594 Ga0495601_0056482 3300053077 Unclassified 2486
595 Ga0495612_0000937 3300053078 Bacteria 11962
596 Ga0495619_0010425 3300053085 Bacteria 5848
597 Ga0501084_0026360 3300054114 Bacteria 4850
598 Ga0070717_10132952
599 MBSR1b_contig_10279081
600 Ga0065712_10107274
601 Ga0065715_10092603
602 Ga0065715_10132560
603 Ga0065707_10086002
604 Ga0070658_10004216
605 Ga0070658_10047772
606 Ga0070658_10111999
607 Ga0070676_10037765
608 Ga0070676_10067316
609 Ga0070683_100001402
610 Ga0070683_100005334
611 Ga0070683_100058907
612 Ga0070683_100073623
613 Ga0070683_100091202
614 Ga0070683_100137009
615 Ga0070690_100031738
616 Ga0070670_100005229
617 Ga0070670_100012450
618 Ga0070670_100024335
619 Ga0070670_100028999
620 Ga0070670_100057976
621 Ga0068869_100001049
622 Ga0068869_100027103
623 Ga0070666_10031908
624 Ga0070666_10092775
625 Ga0070680_100000211
626 Ga0070680_100002193
627 Ga0070680_100002464
628 Ga0070680_100002688
629 Ga0070680_100011383
630 Ga0070680_100036579
631 Ga0070680_100095170
632 Ga0070680_100168995
633 Ga0070680_100188902
634 Ga0070682_100000790
635 Ga0070682_100001451
636 Ga0070682_100010720
637 Ga0070682_100016215
638 Ga0068868_100265507
639 Ga0070660_100006624
640 Ga0070660_100077782
641 Ga0070689_100022167
642 Ga0070689_100184804
643 Ga0070687_100001962
644 Ga0070687_100013033
645 Ga0070661_100000965
646 Ga0070661_100004675
647 Ga0070661_100004701
648 Ga0070661_100033959
649 Ga0070661_100049438
650 Ga0070661_100140097
651 Ga0070661_100141228
652 Ga0070692_10003678
653 Ga0070692_10020119
654 Ga0070668_100159543
655 Ga0070669_100002801
656 Ga0070669_100012282
657 Ga0070669_100120633
658 Ga0070675_100001287
659 Ga0070675_100011812
660 Ga0070675_100038842
661 Ga0070675_100042358
662 Ga0070675_100258840
663 Ga0070671_100024347
664 Ga0070671_100050572
665 Ga0070674_100245600
666 Ga0070673_100076469
667 Ga0070673_100129174
668 Ga0070673_100295373
669 Ga0070688_100005871
670 Ga0070659_100003646
671 Ga0070659_100004835
672 Ga0070659_100013565
673 Ga0070659_100022685
674 Ga0070659_100335729
675 Ga0070667_100008417
676 Ga0070667_100067093
677 Ga0070703_10013658
678 Ga0070714_100012956
679 Ga0070714_100077656
680 Ga0070711_100172282
681 Ga0070708_100000849
682 Ga0070708_100018454
683 Ga0070663_100076849
684 Ga0070662_100000424
685 Ga0070662_100042621
686 Ga0070662_100178612
687 Ga0070681_10002407
688 Ga0070681_10005269
689 Ga0070681_10005393
690 Ga0070681_10008249
691 Ga0070681_10023997
692 Ga0070681_10321787
693 Ga0068867_100014698
694 Ga0070685_10022157
695 Ga0070685_10040313
696 Ga0070685_10135584
697 Ga0070706_100035147
698 Ga0070706_100092829
699 Ga0070707_100002115
700 Ga0070707_100095400
701 Ga0070707_100109433
702 Ga0070707_100122482
703 Ga0070707_100203054
704 Ga0070698_100015754
705 Ga0070698_100023353
706 Ga0070699_100016562
707 Ga0070699_100020754
708 Ga0070679_100000085
709 Ga0070679_100000355
710 Ga0070679_100002038
711 Ga0070679_100002972
712 Ga0070679_100003613
713 Ga0070679_100004960
714 Ga0070679_100032603
715 Ga0070679_100035763
716 Ga0070679_100155728
717 Ga0070684_100001085
718 Ga0070684_100002564
719 Ga0070684_100007288
720 Ga0070684_100010548
721 Ga0070684_100025041
722 Ga0070684_100098467
723 Ga0070684_100142985
724 Ga0070684_100162472
725 Ga0070697_100097679
726 Ga0068853_100038666
727 Ga0068853_100051795
728 Ga0068853_100130969
729 Ga0070672_100014501
730 Ga0070672_100185686
731 Ga0070695_100008476
732 Ga0070695_100090258
733 Ga0070696_100004808
734 Ga0068855_100001420
735 Ga0068855_100007089
736 Ga0068855_100026460
737 Ga0068855_100034889
738 Ga0068855_100048604
739 Ga0068855_100216579
740 Ga0070664_100000313
741 Ga0070664_100002171
742 Ga0070664_100005882
743 Ga0070664_100028013
744 Ga0070664_100040470
745 Ga0070664_100058501
746 Ga0070664_100073209
747 Ga0070664_100210528
748 Ga0068857_100000179
749 Ga0068857_100000495
750 Ga0068857_100008030
751 Ga0068857_100011370
752 Ga0068857_100039204
753 Ga0068857_100064552
754 Ga0068857_100249439
755 Ga0068854_100009904
756 Ga0068854_100056769
757 Ga0068854_100120090
758 Ga0068856_100003777
759 Ga0070702_100018912
760 Ga0068852_100020098
761 Ga0068852_100022032
762 Ga0068852_100025845
763 Ga0068852_100167219
764 Ga0068859_100021114
765 Ga0068859_100069586
766 Ga0068864_100008261
767 Ga0068864_100014535
768 Ga0068866_10004619
769 Ga0068861_100007253
770 Ga0068851_10029991
771 Ga0068870_10031641
772 Ga0068863_100079094
773 Ga0068863_100128028
774 Ga0068858_100027021
775 Ga0068858_100050059
776 Ga0068860_100012629
777 Ga0068860_100037303
778 Ga0068862_100037198
779 Ga0070716_100093868
780 Ga0070712_100218371
781 Ga0068871_100034443
782 Ga0068871_100193081
783 Ga0075428_100393821
784 Ga0075430_100002736
785 Ga0075430_100009941
786 Ga0075430_100056995
787 Ga0075430_100193614
788 Ga0075431_100055741
789 Ga0075431_100330921
790 Ga0075433_10021167
791 Ga0075434_100017657
792 Ga0068865_100019525
793 Ga0068865_100213199
794 Ga0075436_100009980
795 Ga0075436_100016778
796 Ga0075436_100021637
797 Ga0097620_100021115
798 Ga0097620_100069590
799 Ga0075435_100008656
800 Ga0099795_10003411
801 Ga0105240_10124670
802 Ga0105240_10152084
803 Ga0105240_10275034
804 Ga0111539_10036945
805 Ga0105245_10024020
806 Ga0105245_10042292
807 Ga0105245_10048195
808 Ga0105245_10062529
809 Ga0114129_10012586
810 Ga0105241_10057235
811 Ga0105241_10071396
812 Ga0105241_10183727
813 Ga0105242_10040329
814 Ga0105248_10011861
815 Ga0105248_10019314
816 Ga0105248_10026436
817 Ga0105248_10153149
818 Ga0105248_10261374
819 Ga0105237_10046545
820 Ga0105237_10121199
821 Ga0105238_10061051
822 Ga0105238_10068486
823 Ga0105238_10149251
824 Ga0105238_10278908
825 Ga0105249_10006039
826 Ga0105249_10060953
827 Ga0105249_10133713
828 Ga0099796_10001176
829 Ga0105239_10053701
830 Ga0105246_10001757
831 Ga0157373_10037965
832 Ga0157373_10117608
833 Ga0157371_10011933
834 Ga0157371_10133390
835 Ga0157370_10131534
836 Ga0157370_10205822
837 Ga0157369_10021605
838 Ga0157369_10109205
839 Ga0157369_10154431
840 Ga0157369_10238699
841 Ga0157369_10302341
842 Ga0157369_10314072
843 Ga0157374_10024538
844 Ga0157374_10032088
845 Ga0157374_10075153
846 Ga0157374_10216611
847 Ga0157378_10002336
848 Ga0157378_10023731
849 Ga0157378_10099905
850 Ga0157378_10139188
851 Ga0157378_10163930
852 Ga0163162_10002048
853 Ga0157372_10003799
854 Ga0157372_10021660
855 Ga0157372_10025111
856 Ga0157372_10036633
857 Ga0157372_10038903
858 Ga0157372_10047871
859 Ga0157372_10134245
860 Ga0157372_10168563
861 Ga0157372_10203259
862 Ga0157372_10269240
863 Ga0157375_10005804
864 Ga0157375_10008124
865 Ga0157375_10162236
866 Ga0163163_10002127
867 Ga0163163_10073490
868 Ga0163163_10150316
869 Ga0163163_10385663
870 Ga0157377_10011964
871 Ga0157377_10193262
872 Ga0157379_10007606
873 Ga0182007_10015980
874 Ga0163161_10012618
875 Ga0206353_11062776
876 Ga0207697_10005401
877 Ga0207642_10043498
878 Ga0207645_10001996
879 Ga0207645_10063986
880 Ga0207645_10076616
881 Ga0207643_10020267
882 Ga0207705_10002919
883 Ga0207705_10013095
884 Ga0207654_10021822
885 Ga0207707_10000303
886 Ga0207707_10000872
887 Ga0207707_10002037
888 Ga0207707_10019607
889 Ga0207707_10039036
890 Ga0207707_10041828
891 Ga0207707_10069981
892 Ga0207695_10022331
893 Ga0207695_10067295
894 Ga0207695_10172476
895 Ga0207671_10063170
896 Ga0207671_10162167
897 Ga0207693_10088255
898 Ga0207660_10001634
899 Ga0207660_10011842
900 Ga0207660_10016634
901 Ga0207660_10022288
902 Ga0207662_10001793
903 Ga0207662_10003880
904 Ga0207657_10013223
905 Ga0207657_10043399
906 Ga0207657_10046442
907 Ga0207657_10062627
908 Ga0207649_10002406
909 Ga0207649_10011144
910 Ga0207649_10036228
911 Ga0207649_10042157
912 Ga0207649_10059317
913 Ga0207649_10071532
914 Ga0207652_10000526
915 Ga0207652_10002073
916 Ga0207652_10002917
917 Ga0207652_10005853
918 Ga0207652_10034175
919 Ga0207646_10048666
920 Ga0207646_10123672
921 Ga0207681_10012803
922 Ga0207681_10013491
923 Ga0207681_10033533
924 Ga0207694_10062333
925 Ga0207694_10087633
926 Ga0207694_10215448
927 Ga0207650_10004261
928 Ga0207650_10012067
929 Ga0207650_10057237
930 Ga0207650_10058215
931 Ga0207659_10022835
932 Ga0207659_10039822
933 Ga0207659_10060602
934 Ga0207687_10075709
935 Ga0207687_10107386
936 Ga0207664_10001170
937 Ga0207664_10026494
938 Ga0207664_10156640
939 Ga0207644_10136962
940 Ga0207690_10024198
941 Ga0207690_10024833
942 Ga0207690_10025295
943 Ga0207690_10130931
944 Ga0207706_10000323
945 Ga0207706_10016185
946 Ga0207706_10021738
947 Ga0207686_10081311
948 Ga0207670_10079842
949 Ga0207669_10032838
950 Ga0207669_10215795
951 Ga0207691_10003612
952 Ga0207691_10004648
953 Ga0207691_10057706
954 Ga0207711_10015445
955 Ga0207711_10258708
956 Ga0207689_10001442
957 Ga0207689_10019703
958 Ga0207689_10051357
959 Ga0207661_10000242
960 Ga0207661_10000342
961 Ga0207661_10004112
962 Ga0207661_10034692
963 Ga0207661_10065353
964 Ga0207661_10148792
965 Ga0207679_10000498
966 Ga0207679_10001124
967 Ga0207679_10008327
968 Ga0207679_10009176
969 Ga0207679_10018472
970 Ga0207679_10067805
971 Ga0207679_10147413
972 Ga0207667_10103863
973 Ga0207667_10122882
974 Ga0207667_10123187
975 Ga0207651_10049697
976 Ga0207651_10093774
977 Ga0207651_10255500
978 Ga0207712_10002381
979 Ga0207668_10012005
980 Ga0207640_10017119
981 Ga0207640_10083306
982 Ga0207640_10104183
983 Ga0207640_10169213
984 Ga0207658_10055909
985 Ga0207658_10183875
986 Ga0207677_10037705
987 Ga0207677_10086793
988 Ga0207677_10100367
989 Ga0207703_10070038
990 Ga0207639_10086232
991 Ga0207639_10241135
992 Ga0207641_10054611
993 Ga0207641_10089255
994 Ga0207641_10161084
995 Ga0207648_10008328
996 Ga0207648_10018714
997 Ga0207676_10020265
998 Ga0207676_10029857
999 Ga0207676_10037558
1000 Ga0207676_10175835
1001 Ga0207674_10000387
1002 Ga0207674_10000842
1003 Ga0207674_10001900
1004 Ga0207674_10003885
1005 Ga0207674_10019410
1006 Ga0207674_10090003
1007 Ga0207675_100000372
1008 Ga0207698_10088078
1009 Ga0207698_10162705
1010 Ga0207698_10184811
1011 Ga0209179_1003005
1012 Ga0209998_10001045
1013 Ga0268265_10021415
1014 Ga0268265_10065843
1015 Ga0268264_10017322
1016 Ga0268264_10095140
1017 Ga0307408_100213587
1018 Ga0307405_10010806
1019 Ga0307405_10103641
1020 Ga0307405_10131695
1021 Ga0307413_10082940
1022 Ga0307410_10001914
1023 Ga0307410_10075375
1024 Ga0307406_10014765
1025 Ga0307406_10061290
1026 Ga0307406_10062487
1027 Ga0307406_10077393
1028 Ga0307406_10084611
1029 Ga0307407_10000304
1030 Ga0307407_10030242
1031 Ga0307407_10055561
1032 Ga0307412_10002031
1033 Ga0307412_10004846
1034 Ga0307412_10011032
1035 Ga0307412_10046366
1036 Ga0307412_10049666
1037 Ga0307412_10099037
1038 Ga0307409_100001171
1039 Ga0307409_100012398
1040 Ga0307409_100098393
1041 Ga0307409_100128865
1042 Ga0307416_100008551
1043 Ga0307416_100029322
1044 Ga0307416_100030920
1045 Ga0307416_100069096
1046 Ga0307416_100164578
1047 Ga0307411_10000924
1048 Ga0307411_10022666
1049 Ga0307411_10037201
1050 Ga0307411_10060132
1051 Ga0307411_10116857
1052 Ga0307411_10169732
1053 Ga0307415_100002151
1054 Ga0307415_100019164
1055 Ga0307415_100077917
1056 Ga0307415_100213268
1057 Ga0373934_0000730
1058 Ga0373953_0000876
1059 Ga0373957_0031223
1060 Ga0373955_0001343
1061 Ga0373955_0040724
1062 Ga0373924_0064900
1063 Ga0373931_0003938
1064 Ga0373935_0022863
1065 Ga0373927_0046018
1066 Ga0373927_0102956
1067 Ga0373927_0120722
1068 Ga0373933_0000183
1069 Ga0373933_0028129
1070 Ga0373937_0000101
1071 Ga0373937_0000533
1072 Ga0373925_0097537
1073 Ga0436364_0274025
1074 Ga0439446_0052595
1075 Ga0451577_0025189
1076 Ga0451577_0131919
1077 Ga0453684_0039668
1078 Ga0466967_0036446
1079 Ga0495592_0128939
1080 Ga0495629_0015420
1081 Ga0495629_0085993
1082 Ga0495651_0000911
1083 Ga0495651_0078262
1084 Ga0495653_0000271
1085 Ga0495580_0011023
1086 Ga0495580_0109690
1087 Ga0495662_0002568
1088 Ga0495664_0118044
1089 Ga0495594_0003439
1090 Ga0495596_0039657
1091 Ga0495608_0000232
1092 Ga0495628_0000358
1093 Ga0495628_0011653
1094 Ga0495628_0032366
1095 Ga0495628_0116706
1096 Ga0495630_0036356
1097 Ga0495630_0056829
1098 Ga0495652_0004164
1099 Ga0495665_0022579
1100 Ga0495640_0044853
1101 Ga0495640_0100104
1102 Ga0495586_0014366
1103 Ga0495586_0191776
1104 Ga0495587_0000229
1105 Ga0495587_0003098
1106 Ga0495587_0094779
1107 Ga0495645_0000066
1108 Ga0495645_0057181
1109 Ga0495645_0158314
1110 Ga0495667_0024824
1111 Ga0495667_0055974
1112 Ga0495634_0027875
1113 Ga0495635_0000260
1114 Ga0495635_0021470
1115 Ga0495588_0003711
1116 Ga0495657_0000794
1117 Ga0495657_0112076
1118 Ga0495599_0000280
1119 Ga0495599_0037141
1120 Ga0495599_0149234
1121 Ga0495623_0000151
1122 Ga0495623_0007045
1123 Ga0495623_0083187
1124 Ga0495646_0000547
1125 Ga0495646_0065257
1126 Ga0495613_0107300
1127 Ga0495613_0120525
1128 Ga0495600_0000207
1129 Ga0495581_0038045
1130 Ga0495604_0000633
1131 Ga0495674_0042232
1132 Ga0495674_0062955
1133 Ga0495680_0041861
1134 Ga0495680_0047098
1135 Ga0495680_0152975
1136 Ga0495675_0001467
1137 Ga0495675_0007513
1138 Ga0495675_0014533
1139 Ga0495675_0131376
1140 Ga0495685_049190
1141 Ga0495684_0000428
1142 Ga0495684_0023109
1143 Ga0495602_0000545
1144 Ga0496104_0220651
1145 Ga0496105_0152252
1146 Ga0496108_0103884
1147 Ga0496112_0000846
1148 Ga0496112_0117561
1149 Ga0496113_0014546
1150 Ga0496115_0017289
1151 Ga0501038_0021601
1152 Ga0501038_0051923
1153 Ga0501038_0101527
1154 Ga0501047_0028778
1155 Ga0501067_0079575
1156 Ga0501075_0069668
1157 Ga0501076_0121273
1158 Ga0501202_001891
1159 Ga0501207_002545
1160 Ga0501209_005853
1161 Ga0501216_011208
1162 Ga0501227_007308
1163 Ga0501233_017174
1164 Ga0501235_000394
1165 Ga0501247_003929
1166 Ga0501249_004913
1167 Ga0501257_006527
1168 Ga0501259_003834
1169 Ga0501221_002958
1170 Ga0501080_0251639
1171 Ga0501081_0041404
1172 Ga0501262_006853
1173 Ga0501266_005487
1174 Ga0501268_000450
1175 Ga0501272_001806
1176 Ga0501274_001599
1177 Ga0501035_0156388
1178 Ga0501212_000692
1179 nmdc:mga05p37_24424_c1
1180 nmdc:mga09592_72317_c1
1181 nmdc:mga0qj67_112725_c1
1182 nmdc:mga0qj67_1382_c1
1183 nmdc:mga0qj67_84077_c1
1184 nmdc:mga06r32_49191_c1
1185 nmdc:mga08y16_70444_c1
1186 nmdc:mga0n895_6143_c1
1187 nmdc:mga0rr50_172416_c1
1188 nmdc:mga0rr50_45706_c1
1189 nmdc:mga08x19_26228_c1
1190 nmdc:mga0a205_1390_c1
1191 Ga0495601_0056482
1192 Ga0495612_0000937
1193 Ga0495619_0010425
1194 Ga0501084_0026360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sqc-assembly3.cif.gz_C squalene-hopene cyclase 0.5029 23 222
6o60-assembly1.cif.gz_B crystal structure of ggtase3-fbxl2-skp1 complex 0.4927 23 224
3c72-assembly1.cif.gz_B engineered rabggtase in complex with a peptidomimetic inhibitor 0.4844 23 257
1gxo-assembly1.cif.gz_A mutant d189a of family 10 polysaccharide lyase from cellvibrio cellulosa in complex with trigalaturonic acid 0.4457 20 204
8enu-assembly1.cif.gz_H structure of the c3bb proconvertase in complex with lufaxin 0.4422 58 321
ID Description Score Start End Superfamily
af_A0A1D6LG90_353_536_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5608 25 196 1.50.10.20
af_Q4DDP3_167_393_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.5156 58 209 2.60.40.1230
af_Q9URV2_1077_1221_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5074 59 191 1.25.10.10
1h35A01 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.4749 24 332 1.50.10.20
af_A0A1D6LG90_353_536_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.4595 25 196 1.50.10.20
ID Description Score Start End GO Terms
AF-A0A2V7RYQ0-F1-model_v4 Uncharacterized protein 0.9785 153 336
AF-A0A2V7RYQ0-F1-model_v4 Uncharacterized protein 0.9733 153 336
AF-A0A2V7SZ84-F1-model_v4 Uncharacterized protein 0.973 42 336
AF-A0A7Y5QND2-F1-model_v4 Uncharacterized protein 0.9695 21 336
AF-A0A2V7EFG4-F1-model_v4 Uncharacterized protein 0.9692 100 336

Map