F467581

General Info

Members Datasets Scaffolds Average Seq Length
596 264 1192 260

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0151113|Ga0395900_0151113_1415_2305
Length 296
Sequence MAAPSGREMLAAPLAKGRPMTAATASRPALSDGELQKLVALIKDVDSIELKLTVPDPAQLTTARALGLDPLQAQIRQVFFFDTPDLALDKHGVVVRARRSQKKGDDSIVKLRPVVPSELPRAVRRSSSFGVELDASPSGFVCSGSMKGAPADGAVREATSAQRPLRKLFSNEQQALFAEHAPKGITLDELSVLGPIFVLKLKSSPKGFDRKLVTELWLYPDGSRIFELSTKCEPAEAFQVAAETRAFLSSCGIDLEGEQQTKTRTALEYFSKQLGNGPKKRTSTKAHGRAKAAASA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 10.4
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 13.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0151113 3300037418 Bacteria 2372
2 JGI25406J46586_10019550 3300003203 Bacteria 2755
3 JGI25407J50210_10004820 3300003373 Bacteria 3297
4 JGI25407J50210_10006069 3300003373 Bacteria 2994
5 Ga0070658_10303145 3300005327 Bacteria 1362
6 Ga0070683_100094768 3300005329 Bacteria 2806
7 Ga0070683_100125909 3300005329 Unclassified 2422
8 Ga0070690_100138746 3300005330 Bacteria 1649
9 Ga0070690_100231363 3300005330 Bacteria 1300
10 Ga0070670_100300213 3300005331 Bacteria 1405
11 Ga0070670_100497256 3300005331 Eukaryota 1084
12 Ga0070677_10019359 3300005333 Bacteria 2465
13 Ga0070680_100024008 3300005336 Bacteria 4866
14 Ga0070680_100091985 3300005336 Bacteria 2511
15 Ga0070680_100278579 3300005336 Bacteria 1417
16 Ga0070682_100029249 3300005337 Bacteria 3316
17 Ga0070682_100043697 3300005337 Bacteria 2771
18 Ga0070682_100115541 3300005337 Bacteria 1794
19 Ga0070682_100122558 3300005337 Bacteria 1748
20 Ga0068868_100197953 3300005338 Bacteria 1673
21 Ga0068868_100382152 3300005338 Unclassified 1212
22 Ga0070660_100054564 3300005339 Bacteria 3086
23 Ga0070689_100197979 3300005340 Unclassified 1639
24 Ga0070689_100624068 3300005340 Bacteria 935
25 Ga0070692_10202465 3300005345 Bacteria 1163
26 Ga0070668_100287217 3300005347 Bacteria 1376
27 Ga0070675_100035273 3300005354 Bacteria 4064
28 Ga0070675_100108572 3300005354 Bacteria 2343
29 Ga0070671_100084815 3300005355 Bacteria 2649
30 Ga0070674_100116659 3300005356 Bacteria 1970
31 Ga0070674_100197829 3300005356 Unclassified 1550
32 Ga0070674_100233158 3300005356 Bacteria 1438
33 Ga0070674_100748876 3300005356 Unclassified 839
34 Ga0070659_100178757 3300005366 Bacteria 1740
35 Ga0070659_100421551 3300005366 Bacteria 1129
36 Ga0070713_100009484 3300005436 Bacteria 6974
37 Ga0070713_100735890 3300005436 Unclassified 943
38 Ga0070705_100013910 3300005440 Bacteria 4128
39 Ga0070705_100158303 3300005440 Bacteria 1511
40 Ga0070700_100422323 3300005441 Bacteria 1008
41 Ga0070694_100450868 3300005444 Bacteria 1016
42 Ga0070663_100030930 3300005455 Bacteria 3673
43 Ga0070678_100084806 3300005456 Bacteria 2412
44 Ga0070678_100255589 3300005456 Unclassified 1471
45 Ga0070662_100125205 3300005457 Bacteria 1975
46 Ga0070662_100305021 3300005457 Unclassified 1294
47 Ga0070681_10012204 3300005458 Bacteria 8520
48 Ga0068867_100240147 3300005459 Bacteria 1469
49 Ga0070685_10052483 3300005466 Unclassified 2359
50 Ga0070685_10282334 3300005466 Bacteria 1112
51 Ga0070699_100113926 3300005518 Bacteria 2376
52 Ga0070679_100023856 3300005530 Bacteria 5993
53 Ga0070679_100058848 3300005530 Bacteria 3829
54 Ga0070684_100094039 3300005535 Bacteria 2669
55 Ga0070684_100119722 3300005535 Bacteria 2368
56 Ga0070684_100139862 3300005535 Bacteria 2188
57 Ga0070684_100152563 3300005535 Bacteria 2093
58 Ga0070684_100417599 3300005535 Unclassified 1238
59 Ga0068853_100630830 3300005539 Bacteria 1019
60 Ga0070672_100267702 3300005543 Bacteria 1442
61 Ga0070672_100322194 3300005543 Bacteria 1314
62 Ga0070686_100120023 3300005544 Bacteria 1804
63 Ga0070686_100172075 3300005544 Bacteria 1532
64 Ga0070686_100328416 3300005544 Bacteria 1143
65 Ga0070696_100026794 3300005546 Bacteria 3923
66 Ga0070693_100049105 3300005547 Bacteria 2406
67 Ga0070693_100114559 3300005547 Unclassified 1664
68 Ga0070704_100034680 3300005549 Bacteria 3425
69 Ga0068855_100376464 3300005563 Bacteria 1559
70 Ga0070664_100035117 3300005564 Bacteria 4208
71 Ga0070664_100073521 3300005564 Bacteria 2933
72 Ga0070664_100377872 3300005564 Bacteria 1293
73 Ga0070664_100734864 3300005564 Bacteria 921
74 Ga0068857_100086776 3300005577 Bacteria 2799
75 Ga0068857_100205390 3300005577 Bacteria 1797
76 Ga0068856_100029981 3300005614 Bacteria 5316
77 Ga0068856_100033427 3300005614 Bacteria 5035
78 Ga0068856_100237234 3300005614 Bacteria 1839
79 Ga0068856_100297655 3300005614 Unclassified 1631
80 Ga0070702_100229482 3300005615 Bacteria 1246
81 Ga0068852_100270025 3300005616 Bacteria 1636
82 Ga0068852_100318557 3300005616 Bacteria 1510
83 Ga0068852_100961787 3300005616 Bacteria 872
84 Ga0068859_100550866 3300005617 Bacteria 1248
85 Ga0068864_100049174 3300005618 Bacteria 3628
86 Ga0068864_100439164 3300005618 Bacteria 1246
87 Ga0068861_100120239 3300005719 Bacteria 2118
88 Ga0068851_10137816 3300005834 Unclassified 1324
89 Ga0068870_10168122 3300005840 Bacteria 1306
90 Ga0068870_10183249 3300005840 Unclassified 1258
91 Ga0068863_100657491 3300005841 Unclassified 1040
92 Ga0068858_100116306 3300005842 Bacteria 2499
93 Ga0068860_100316671 3300005843 Bacteria 1531
94 Ga0068860_100828038 3300005843 Unclassified 940
95 Ga0068862_100300472 3300005844 Bacteria 1477
96 Ga0081455_10028937 3300005937 Bacteria 5057
97 Ga0081455_10083918 3300005937 Bacteria 2602
98 Ga0081538_10001746 3300005981 Bacteria 22083
99 Ga0081538_10019231 3300005981 Bacteria 5087
100 Ga0081538_10105117 3300005981 Viruses 1406
101 Ga0081540_1000814 3300005983 Bacteria 28551
102 Ga0081539_10001832 3300005985 Bacteria 33546
103 Ga0081539_10002414 3300005985 Bacteria 26436
104 Ga0070717_10043113 3300006028 Bacteria 3681
105 Ga0070717_10105042 3300006028 Unclassified 2403
106 Ga0075365_10156059 3300006038 Bacteria 1589
107 Ga0075432_10030924 3300006058 Bacteria 1852
108 Ga0075432_10044127 3300006058 Bacteria 1563
109 Ga0070716_100007436 3300006173 Bacteria 5395
110 Ga0097621_100187987 3300006237 Bacteria 1787
111 Ga0068871_100040374 3300006358 Bacteria 3737
112 Ga0068871_100331517 3300006358 Unclassified 1342
113 Ga0075428_100059458 3300006844 Bacteria 4185
114 Ga0075430_100163555 3300006846 Bacteria 1852
115 Ga0075431_100031850 3300006847 Bacteria 5431
116 Ga0075431_100158625 3300006847 Bacteria 2327
117 Ga0075431_100295706 3300006847 Bacteria 1637
118 Ga0075433_10115013 3300006852 Bacteria 2387
119 Ga0075433_10302570 3300006852 Bacteria 1416
120 Ga0075434_100014999 3300006871 Bacteria 7419
121 Ga0075434_100061826 3300006871 Bacteria 3727
122 Ga0075434_100217882 3300006871 Bacteria 1929
123 Ga0075429_100038927 3300006880 Bacteria 4139
124 Ga0075429_100325663 3300006880 Bacteria 1345
125 Ga0068865_100046999 3300006881 Bacteria 2964
126 Ga0075436_100185880 3300006914 Bacteria 1469
127 Ga0097620_100550851 3300006931 Bacteria 1248
128 Ga0075435_100117984 3300007076 Bacteria 2212
129 Ga0075435_100229814 3300007076 Bacteria 1576
130 Ga0075435_100405547 3300007076 Bacteria 1173
131 Ga0075435_100623738 3300007076 Unclassified 935
132 Ga0111539_10004088 3300009094 Bacteria 19141
133 Ga0111539_10008017 3300009094 Bacteria 13471
134 Ga0111539_10022339 3300009094 Bacteria 7774
135 Ga0111539_10099047 3300009094 Bacteria 3424
136 Ga0111539_10157725 3300009094 Bacteria 2655
137 Ga0111539_10235496 3300009094 Bacteria 2132
138 Ga0111539_10291790 3300009094 Bacteria 1898
139 Ga0111539_10304939 3300009094 Bacteria 1853
140 Ga0111539_10573986 3300009094 Bacteria 1314
141 Ga0111539_10768153 3300009094 Bacteria 1122
142 Ga0105245_10068938 3300009098 Bacteria 3206
143 Ga0105245_10500109 3300009098 Bacteria 1232
144 Ga0105245_10555264 3300009098 Unclassified 1171
145 Ga0114129_10010166 3300009147 Bacteria 13415
146 Ga0114129_10018237 3300009147 Bacteria 9993
147 Ga0114129_10027522 3300009147 Bacteria 8049
148 Ga0114129_10093608 3300009147 Bacteria 4162
149 Ga0114129_10258127 3300009147 Archaea 2337
150 Ga0114129_10337801 3300009147 Bacteria 1999
151 Ga0114129_10534818 3300009147 Bacteria 1526
152 Ga0105243_10025040 3300009148 Bacteria 4557
153 Ga0105243_10152976 3300009148 Bacteria 1981
154 Ga0105243_10258676 3300009148 Unclassified 1558
155 Ga0105241_10045883 3300009174 Bacteria 3317
156 Ga0105241_10067883 3300009174 Bacteria 2761
157 Ga0105242_10175254 3300009176 Bacteria 1887
158 Ga0105242_10244716 3300009176 Bacteria 1614
159 Ga0105242_10281036 3300009176 Bacteria 1512
160 Ga0105248_10031680 3300009177 Bacteria 5907
161 Ga0105237_10587986 3300009545 Bacteria 1120
162 Ga0105238_10274099 3300009551 Unclassified 1668
163 Ga0105238_10772876 3300009551 Bacteria 975
164 Ga0105249_10115993 3300009553 Unclassified 2538
165 Ga0105249_10312760 3300009553 Unclassified 1580
166 Ga0105249_10463066 3300009553 Bacteria 1308
167 Ga0105239_10208151 3300010375 Bacteria 2192
168 Ga0105239_10357729 3300010375 Bacteria 1648
169 Ga0105246_10012460 3300011119 Bacteria 5309
170 Ga0105246_10057277 3300011119 Bacteria 2696
171 Ga0105246_10285248 3300011119 Bacteria 1326
172 Ga0105246_10354728 3300011119 Bacteria 1203
173 Ga0157373_10039174 3300013100 Bacteria 3394
174 Ga0157371_10206389 3300013102 Unclassified 1409
175 Ga0157371_10282193 3300013102 Unclassified 1200
176 Ga0157378_10194372 3300013297 Bacteria 1916
177 Ga0157372_10059868 3300013307 Bacteria 4261
178 Ga0157372_10325968 3300013307 Bacteria 1788
179 Ga0157375_10067065 3300013308 Bacteria 3585
180 Ga0163163_10067089 3300014325 Bacteria 3566
181 Ga0157380_10278213 3300014326 Bacteria 1530
182 Ga0157377_10025829 3300014745 Bacteria 3136
183 Ga0157379_10000922 3300014968 Bacteria 23757
184 Ga0157379_10006137 3300014968 Bacteria 10347
185 Ga0157379_10097728 3300014968 Bacteria 2636
186 Ga0157376_10304642 3300014969 Unclassified 1509
187 Ga0163161_10176531 3300017792 Bacteria 1636
188 Ga0163161_10252521 3300017792 Bacteria 1375
189 Ga0197907_11286949 3300020069 Bacteria 995
190 Ga0206350_10329102 3300020080 Bacteria 1461
191 Ga0206354_11428740 3300020081 Bacteria 1346
192 Ga0206353_11799932 3300020082 Bacteria 3101
193 Ga0224712_10061846 3300022467 Bacteria 1494
194 Ga0207682_10049398 3300025893 Bacteria 1736
195 Ga0207692_10112951 3300025898 Bacteria 1509
196 Ga0207688_10002994 3300025901 Bacteria 9201
197 Ga0207685_10026462 3300025905 Bacteria 2018
198 Ga0207699_10067066 3300025906 Bacteria 2180
199 Ga0207643_10134781 3300025908 Bacteria 1472
200 Ga0207643_10154012 3300025908 Bacteria 1380
201 Ga0207654_10072094 3300025911 Bacteria 2055
202 Ga0207707_10009789 3300025912 Bacteria 8312
203 Ga0207693_10016514 3300025915 Bacteria 5898
204 Ga0207663_10004702 3300025916 Bacteria 6818
205 Ga0207660_10343311 3300025917 Bacteria 1195
206 Ga0207662_10016393 3300025918 Bacteria 4181
207 Ga0207662_10329330 3300025918 Bacteria 1021
208 Ga0207657_10043682 3300025919 Bacteria 3945
209 Ga0207649_10513334 3300025920 Bacteria 913
210 Ga0207652_10171267 3300025921 Unclassified 1948
211 Ga0207694_10569691 3300025924 Bacteria 951
212 Ga0207650_10097798 3300025925 Unclassified 2254
213 Ga0207650_10217774 3300025925 Bacteria 1535
214 Ga0207687_10057391 3300025927 Bacteria 2735
215 Ga0207687_10482802 3300025927 Bacteria 1032
216 Ga0207687_10561968 3300025927 Unclassified 958
217 Ga0207664_10109377 3300025929 Bacteria 2296
218 Ga0207644_10450586 3300025931 Bacteria 1057
219 Ga0207690_10121368 3300025932 Bacteria 1899
220 Ga0207690_10147677 3300025932 Unclassified 1740
221 Ga0207690_10392259 3300025932 Bacteria 1105
222 Ga0207706_10042313 3300025933 Bacteria 4038
223 Ga0207706_10046296 3300025933 Bacteria 3851
224 Ga0207706_10241393 3300025933 Bacteria 1579
225 Ga0207706_10403643 3300025933 Bacteria 1185
226 Ga0207686_10010698 3300025934 Bacteria 4998
227 Ga0207709_10419441 3300025935 Bacteria 1028
228 Ga0207709_10494463 3300025935 Bacteria 953
229 Ga0207709_10648179 3300025935 Unclassified 841
230 Ga0207704_10206738 3300025938 Unclassified 1441
231 Ga0207704_10308955 3300025938 Bacteria 1215
232 Ga0207665_10001031 3300025939 Bacteria 18776
233 Ga0207691_10009283 3300025940 Bacteria 9437
234 Ga0207691_10630549 3300025940 Bacteria 906
235 Ga0207711_10173377 3300025941 Bacteria 1958
236 Ga0207711_10298823 3300025941 Bacteria 1485
237 Ga0207689_10239737 3300025942 Unclassified 1499
238 Ga0207689_10626637 3300025942 Unclassified 906
239 Ga0207661_10001520 3300025944 Bacteria 15738
240 Ga0207661_10172733 3300025944 Bacteria 1882
241 Ga0207661_10291738 3300025944 Bacteria 1460
242 Ga0207679_10029741 3300025945 Bacteria 3806
243 Ga0207679_10202396 3300025945 Bacteria 1659
244 Ga0207668_10199909 3300025972 Unclassified 1591
245 Ga0207677_10212698 3300026023 Bacteria 1545
246 Ga0207677_10218848 3300026023 Bacteria 1526
247 Ga0207677_10330841 3300026023 Bacteria 1269
248 Ga0207703_10331440 3300026035 Unclassified 1396
249 Ga0207678_10051695 3300026067 Bacteria 3547
250 Ga0207678_10124835 3300026067 Bacteria 2196
251 Ga0207708_10007378 3300026075 Bacteria 8127
252 Ga0207708_10018852 3300026075 Bacteria 5197
253 Ga0207702_10008722 3300026078 Bacteria 8549
254 Ga0207702_10127199 3300026078 Bacteria 2289
255 Ga0207702_10152453 3300026078 Bacteria 2104
256 Ga0207702_10274780 3300026078 Bacteria 1590
257 Ga0207648_10101130 3300026089 Bacteria 2526
258 Ga0207648_10172756 3300026089 Bacteria 1911
259 Ga0207676_10153047 3300026095 Unclassified 1989
260 Ga0207676_10388327 3300026095 Bacteria 1301
261 Ga0207676_10625724 3300026095 Bacteria 1036
262 Ga0207674_10174045 3300026116 Bacteria 2105
263 Ga0207674_10225349 3300026116 Bacteria 1823
264 Ga0207674_10334876 3300026116 Bacteria 1463
265 Ga0207675_100049851 3300026118 Bacteria 3906
266 Ga0207675_100389139 3300026118 Bacteria 1372
267 Ga0207683_10018586 3300026121 Bacteria 5932
268 Ga0207683_10282712 3300026121 Bacteria 1516
269 Ga0207698_10082441 3300026142 Bacteria 2600
270 Ga0207698_10139823 3300026142 Bacteria 2084
271 Ga0207698_10295639 3300026142 Bacteria 1505
272 Ga0207428_10019457 3300027907 Bacteria 5788
273 Ga0207428_10055158 3300027907 Bacteria 3161
274 Ga0207428_10066534 3300027907 Bacteria 2839
275 Ga0207428_10068765 3300027907 Bacteria 2785
276 Ga0207428_10184244 3300027907 Bacteria 1576
277 Ga0307408_100332796 3300031548 Bacteria 1283
278 Ga0307413_10095771 3300031824 Bacteria 1947
279 Ga0307406_10024076 3300031901 Bacteria 3632
280 Ga0307409_100242603 3300031995 Bacteria 1641
281 Ga0307409_100494823 3300031995 Bacteria 1189
282 Ga0307416_100138930 3300032002 Bacteria 2204
283 Ga0307411_10015635 3300032005 Bacteria 4270
284 Ga0373938_0038510 3300034957 Bacteria 1054
285 Ga0373951_0014338 3300035091 Bacteria 1782
286 Ga0373939_0029328 3300035114 Bacteria 1573
287 Ga0373939_0053153 3300035114 Bacteria 1264
288 Ga0373941_0014956 3300035115 Bacteria 2084
289 Ga0373960_0015657 3300035121 Bacteria 1939
290 Ga0373960_0047773 3300035121 Bacteria 1260
291 Ga0373961_0032944 3300035241 Bacteria 1457
292 Ga0373961_0082467 3300035241 Unclassified 1014
293 Ga0373962_0032319 3300035242 Bacteria 1439
294 Ga0373931_0096287 3300035691 Bacteria 1657
295 Ga0395899_0003118 3300037312 Bacteria 13206
296 Ga0395899_0041570 3300037312 Bacteria 3435
297 Ga0395899_0116281 3300037312 Bacteria 1919
298 Ga0395899_0135977 3300037312 Unclassified 1752
299 Ga0395899_0148156 3300037312 Bacteria 1665
300 Ga0395899_0190219 3300037312 Bacteria 1436
301 Ga0395900_0002117 3300037418 Bacteria 22226
302 Ga0395900_0002220 3300037418 Bacteria 21689
303 Ga0395900_0067092 3300037418 Bacteria 3686
304 Ga0395900_0113462 3300037418 Bacteria 2781
305 Ga0395900_0155342 3300037418 Bacteria 2337
306 Ga0395900_0199039 3300037418 Bacteria 2028
307 Ga0395900_0314204 3300037418 Unclassified 1549
308 Ga0395900_0379063 3300037418 Bacteria 1383
309 Ga0395898_0006739 3300037466 Bacteria 12242
310 Ga0395898_0021895 3300037466 Bacteria 6476
311 Ga0395898_0063571 3300037466 Bacteria 3581
312 Ga0395898_0108592 3300037466 Bacteria 2661
313 Ga0395898_0217245 3300037466 Unclassified 1824
314 Ga0395905_0006435 3300037471 Bacteria 11824
315 Ga0395905_0036686 3300037471 Bacteria 4605
316 Ga0395905_0052036 3300037471 Bacteria 3835
317 Ga0395905_0053052 3300037471 Bacteria 3796
318 Ga0395905_0062256 3300037471 Bacteria 3490
319 Ga0395905_0099907 3300037471 Bacteria 2725
320 Ga0395905_0103692 3300037471 Bacteria 2670
321 Ga0395905_0225809 3300037471 Unclassified 1752
322 Ga0395901_0002820 3300038443 Bacteria 17550
323 Ga0395901_0003228 3300038443 Bacteria 16403
324 Ga0395901_0037740 3300038443 Bacteria 4996
325 Ga0395901_0080136 3300038443 Bacteria 3408
326 Ga0395901_0138766 3300038443 Bacteria 2555
327 Ga0395901_0209433 3300038443 Unclassified 2041
328 Ga0395901_0426311 3300038443 Unclassified 1359
329 Ga0395901_1027890 3300038443 Unclassified 798
330 Ga0451807_2436016 3300041486 Bacteria 1793
331 Ga0439463_005572 3300042016 Bacteria 3128
332 Ga0439464_0004344 3300042439 Bacteria 3624
333 Ga0451576_0225309 3300045051 Bacteria 1958
334 Ga0466967_0215423 3300045976 Bacteria 1823
335 Ga0495591_054493 3300046458 Unclassified 1081
336 Ga0495651_0204416 3300046462 Bacteria 1380
337 Ga0495582_0034579 3300046473 Bacteria 2778
338 Ga0495605_0042527 3300046474 Unclassified 2258
339 Ga0495584_0069778 3300046491 Bacteria 1766
340 Ga0495585_0035976 3300046492 Bacteria 2796
341 Ga0495594_0027449 3300046499 Bacteria 3068
342 Ga0495607_0115466 3300046501 Bacteria 1417
343 Ga0495616_0209002 3300046513 Unclassified 854
344 Ga0495637_0038789 3300046520 Bacteria 2060
345 Ga0495643_0213747 3300046522 Unclassified 919
346 Ga0495644_0041292 3300046523 Bacteria 1737
347 Ga0495644_0075433 3300046523 Bacteria 1270
348 Ga0495642_0025604 3300046528 Bacteria 2339
349 Ga0495609_0034462 3300046538 Bacteria 2295
350 Ga0495597_0058007 3300046542 Unclassified 1693
351 Ga0495645_0249370 3300046543 Bacteria 1181
352 Ga0495667_0336741 3300046559 Bacteria 954
353 Ga0495656_0063639 3300046615 Unclassified 1617
354 Ga0495656_0176317 3300046615 Unclassified 1048
355 Ga0495611_0042294 3300046648 Unclassified 2034
356 Ga0495659_0022119 3300046664 Bacteria 2148
357 Ga0495659_0037271 3300046664 Unclassified 1721
358 Ga0495661_0140331 3300046665 Unclassified 1315
359 Ga0495658_0063918 3300046683 Unclassified 2119
360 Ga0495624_0069461 3300046690 Bacteria 2194
361 Ga0495670_0027690 3300046691 Bacteria 2809
362 Ga0495670_0275887 3300046691 Unclassified 899
363 Ga0495671_0030958 3300046692 Bacteria 2738
364 Ga0495589_0084334 3300046794 Unclassified 1544
365 Ga0495589_0095172 3300046794 Bacteria 1445
366 Ga0495660_0034256 3300046810 Bacteria 2843
367 Ga0495636_0084916 3300047318 Unclassified 1368
368 Ga0495677_0119984 3300047445 Unclassified 1002
369 Ga0495685_100950 3300047447 Unclassified 953
370 Ga0495626_0150825 3300048091 Unclassified 980
371 Ga0496100_0062202 3300048903 Bacteria 2462
372 Ga0496100_0088436 3300048903 Bacteria 2108
373 Ga0496100_0172749 3300048903 Unclassified 1558
374 Ga0496100_0210740 3300048903 Bacteria 1421
375 Ga0496100_0344921 3300048903 Bacteria 1124
376 Ga0496100_0437123 3300048903 Bacteria 1001
377 Ga0496101_0029383 3300048904 Bacteria 3845
378 Ga0496101_0039148 3300048904 Unclassified 3370
379 Ga0496102_0052095 3300048905 Bacteria 3728
380 Ga0496102_0227373 3300048905 Bacteria 1759
381 Ga0496102_0281877 3300048905 Bacteria 1566
382 Ga0496102_0734576 3300048905 Unclassified 910
383 Ga0496103_0059648 3300048906 Bacteria 2370
384 Ga0496103_0153973 3300048906 Bacteria 1473
385 Ga0496104_0036720 3300048907 Unclassified 4581
386 Ga0496104_0144231 3300048907 Bacteria 2287
387 Ga0496104_0179593 3300048907 Bacteria 2027
388 Ga0496104_0357603 3300048907 Unclassified 1373
389 Ga0496104_0775022 3300048907 Unclassified 866
390 Ga0496105_0031744 3300048908 Unclassified 4331
391 Ga0496105_0163395 3300048908 Unclassified 1828
392 Ga0496105_0300962 3300048908 Bacteria 1289
393 Ga0496105_0320093 3300048908 Bacteria 1243
394 Ga0496106_0025242 3300048909 Bacteria 4421
395 Ga0496106_0064107 3300048909 Bacteria 2795
396 Ga0496107_0098285 3300048910 Bacteria 2144
397 Ga0496107_0188289 3300048910 Bacteria 1533
398 Ga0496108_0002108 3300048911 Bacteria 15928
399 Ga0496108_0004951 3300048911 Bacteria 10762
400 Ga0496108_0005141 3300048911 Bacteria 10577
401 Ga0496108_0197449 3300048911 Bacteria 1745
402 Ga0496109_0001720 3300048912 Bacteria 18253
403 Ga0496109_0004648 3300048912 Bacteria 11462
404 Ga0496109_0005699 3300048912 Bacteria 10426
405 Ga0496109_0278597 3300048912 Bacteria 1576
406 Ga0496110_0000789 3300048913 Bacteria 22109
407 Ga0496110_0000934 3300048913 Bacteria 20530
408 Ga0496110_0002813 3300048913 Bacteria 13131
409 Ga0496110_0002865 3300048913 Bacteria 13025
410 Ga0496111_0001259 3300048914 Bacteria 14176
411 Ga0496111_0001742 3300048914 Bacteria 12740
412 Ga0496111_0001924 3300048914 Bacteria 12279
413 Ga0496111_0271081 3300048914 Bacteria 1259
414 Ga0496112_0000677 3300048915 Bacteria 23790
415 Ga0496112_0036666 3300048915 Bacteria 4783
416 Ga0496112_0054103 3300048915 Bacteria 3943
417 Ga0496112_0460577 3300048915 Bacteria 1209
418 Ga0496113_0043911 3300048916 Unclassified 3309
419 Ga0496113_0046507 3300048916 Bacteria 3221
420 Ga0496113_0169016 3300048916 Unclassified 1731
421 Ga0496113_0241682 3300048916 Bacteria 1441
422 Ga0496114_0023042 3300048917 Bacteria 5076
423 Ga0496114_0115381 3300048917 Unclassified 2304
424 Ga0496114_0156653 3300048917 Bacteria 1978
425 Ga0496114_0205761 3300048917 Bacteria 1725
426 Ga0496114_0286582 3300048917 Bacteria 1453
427 Ga0496114_0585326 3300048917 Bacteria 985
428 Ga0496115_0001722 3300048918 Bacteria 15696
429 Ga0496115_0030196 3300048918 Bacteria 4262
430 Ga0496115_0121287 3300048918 Bacteria 2151
431 Ga0496115_0173988 3300048918 Bacteria 1780
432 Ga0496119_0097247 3300048922 Bacteria 1660
433 Ga0501031_0016906 3300049568 Bacteria 4738
434 Ga0501031_0057797 3300049568 Bacteria 2527
435 Ga0501031_0095514 3300049568 Unclassified 1939
436 Ga0501031_0099507 3300049568 Bacteria 1897
437 Ga0501032_0000414 3300049569 Bacteria 35226
438 Ga0501032_0019894 3300049569 Bacteria 4687
439 Ga0501032_0026115 3300049569 Bacteria 4022
440 Ga0501033_0007243 3300049570 Bacteria 8656
441 Ga0501033_0057028 3300049570 Bacteria 2887
442 Ga0501034_0155198 3300049571 Bacteria 2263
443 Ga0501036_0003717 3300049572 Bacteria 12234
444 Ga0501036_0013785 3300049572 Bacteria 6723
445 Ga0501036_0029108 3300049572 Bacteria 4669
446 Ga0501036_0058328 3300049572 Bacteria 3270
447 Ga0501037_0002188 3300049573 Bacteria 14141
448 Ga0501037_0006663 3300049573 Bacteria 8445
449 Ga0501038_0002507 3300049574 Bacteria 17099
450 Ga0501038_0070683 3300049574 Bacteria 2962
451 Ga0501038_0097040 3300049574 Bacteria 2459
452 Ga0501039_0003326 3300049575 Bacteria 12016
453 Ga0501039_0003959 3300049575 Bacteria 11129
454 Ga0501039_0011523 3300049575 Bacteria 6730
455 Ga0501039_0135924 3300049575 Bacteria 1930
456 Ga0501040_0000243 3300049576 Bacteria 32069
457 Ga0501040_0001907 3300049576 Bacteria 13410
458 Ga0501040_0005397 3300049576 Bacteria 8272
459 Ga0501040_0013703 3300049576 Bacteria 5332
460 Ga0501040_0030337 3300049576 Bacteria 3652
461 Ga0501041_0000408 3300049577 Bacteria 21713
462 Ga0501041_0001062 3300049577 Bacteria 15033
463 Ga0501041_0025904 3300049577 Bacteria 3526
464 Ga0501041_0030738 3300049577 Bacteria 3242
465 Ga0501041_0051047 3300049577 Bacteria 2520
466 Ga0501041_0358592 3300049577 Bacteria 922
467 Ga0501042_0000154 3300049578 Bacteria 30783
468 Ga0501042_0007069 3300049578 Bacteria 7333
469 Ga0501042_0010593 3300049578 Bacteria 6191
470 Ga0501042_0013114 3300049578 Bacteria 5638
471 Ga0501042_0129772 3300049578 Bacteria 1816
472 Ga0501042_0206594 3300049578 Bacteria 1416
473 Ga0501043_0000284 3300049579 Bacteria 45754
474 Ga0501043_0011936 3300049579 Bacteria 6798
475 Ga0501043_0206968 3300049579 Bacteria 1521
476 Ga0501043_0253039 3300049579 Bacteria 1356
477 Ga0501046_0000901 3300049580 Bacteria 28982
478 Ga0501046_0001158 3300049580 Bacteria 25664
479 Ga0501046_0053462 3300049580 Bacteria 3180
480 Ga0501047_0000949 3300049581 Bacteria 29386
481 Ga0501047_0020432 3300049581 Bacteria 6359
482 Ga0501048_0000676 3300049582 Bacteria 24721
483 Ga0501048_0002304 3300049582 Bacteria 14565
484 Ga0501048_0017895 3300049582 Bacteria 5213
485 Ga0501067_0063010 3300049583 Bacteria 2053
486 Ga0501068_0001187 3300049584 Bacteria 13856
487 Ga0501068_0023904 3300049584 Bacteria 3584
488 Ga0501068_0071809 3300049584 Bacteria 2113
489 Ga0501068_0084191 3300049584 Bacteria 1956
490 Ga0501069_0003176 3300049585 Bacteria 8421
491 Ga0501070_0001903 3300049586 Bacteria 18466
492 Ga0501070_0061815 3300049586 Bacteria 3102
493 Ga0501070_0122429 3300049586 Bacteria 2150
494 Ga0501071_0000057 3300049587 Bacteria 37883
495 Ga0501071_0024691 3300049587 Bacteria 4205
496 Ga0501071_0034836 3300049587 Bacteria 3584
497 Ga0501071_0059841 3300049587 Bacteria 2756
498 Ga0501072_0000387 3300049588 Bacteria 31559
499 Ga0501072_0006432 3300049588 Bacteria 8950
500 Ga0501072_0009258 3300049588 Bacteria 7484
501 Ga0501072_0015067 3300049588 Bacteria 5929
502 Ga0501072_0129570 3300049588 Bacteria 2010
503 Ga0501073_0000148 3300049589 Bacteria 46653
504 Ga0501073_0010873 3300049589 Bacteria 6663
505 Ga0501073_0173206 3300049589 Bacteria 1494
506 Ga0501074_0002447 3300049590 Bacteria 12950
507 Ga0501074_0036638 3300049590 Bacteria 3553
508 Ga0501074_0064668 3300049590 Bacteria 2633
509 Ga0501074_0155072 3300049590 Bacteria 1636
510 Ga0501075_0000510 3300049591 Bacteria 23411
511 Ga0501075_0002590 3300049591 Bacteria 12069
512 Ga0501075_0016667 3300049591 Bacteria 5298
513 Ga0501075_0047681 3300049591 Bacteria 3219
514 Ga0501075_0079626 3300049591 Bacteria 2479
515 Ga0501076_0001165 3300049592 Bacteria 17385
516 Ga0501076_0001770 3300049592 Bacteria 14622
517 Ga0501076_0013167 3300049592 Bacteria 6195
518 Ga0501076_0021626 3300049592 Bacteria 4936
519 Ga0501076_0054604 3300049592 Bacteria 3166
520 Ga0501076_0059232 3300049592 Bacteria 3046
521 Ga0501076_0769411 3300049592 Unclassified 794
522 Ga0501077_0000755 3300049593 Bacteria 19577
523 Ga0501077_0014507 3300049593 Bacteria 4951
524 Ga0501077_0025774 3300049593 Bacteria 3731
525 Ga0501077_0091802 3300049593 Bacteria 1924
526 Ga0501079_0000816 3300049741 Bacteria 21188
527 Ga0501079_0001361 3300049741 Bacteria 17194
528 Ga0501079_0083471 3300049741 Bacteria 2471
529 Ga0501079_0093818 3300049741 Bacteria 2325
530 Ga0501080_0000723 3300049742 Bacteria 26657
531 Ga0501080_0026657 3300049742 Bacteria 5370
532 Ga0501080_0068205 3300049742 Bacteria 3308
533 Ga0501080_0319724 3300049742 Bacteria 1405
534 Ga0501080_0435049 3300049742 Bacteria 1177
535 Ga0501081_0000742 3300049743 Bacteria 19046
536 Ga0501081_0001941 3300049743 Bacteria 12841
537 Ga0501081_0011703 3300049743 Bacteria 5743
538 Ga0501081_0048614 3300049743 Bacteria 2919
539 Ga0501081_0097477 3300049743 Bacteria 2075
540 Ga0501083_0000209 3300049744 Bacteria 38057
541 Ga0501083_0049579 3300049744 Bacteria 2829
542 Ga0501035_0001507 3300049822 Bacteria 23831
543 Ga0501035_0065950 3300049822 Bacteria 3213
544 Ga0501035_0086881 3300049822 Bacteria 2755
545 Ga0501044_0011263 3300049823 Bacteria 9692
546 Ga0501044_0014087 3300049823 Bacteria 8633
547 Ga0501045_0006828 3300049824 Bacteria 7905
548 Ga0501045_0008884 3300049824 Bacteria 7015
549 Ga0501045_0010012 3300049824 Bacteria 6631
550 Ga0501045_0014904 3300049824 Bacteria 5514
551 nmdc:mga0yw44_169517_c1 3300050492 Bacteria 1433
552 nmdc:mga05p37_101611_c1 3300050507 Bacteria 3540
553 nmdc:mga05p37_168722_c1 3300050507 Bacteria 2670
554 nmdc:mga05p37_529986_c1 3300050507 Bacteria 1345
555 nmdc:mga05p37_61874_c1 3300050507 Bacteria 4607
556 nmdc:mga05p37_686080_c1 3300050507 Bacteria 1141
557 nmdc:mga09592_1338_c1 3300050508 Bacteria 19735
558 nmdc:mga09592_168179_c1 3300050508 Bacteria 1895
559 nmdc:mga09592_416339_c1 3300050508 Bacteria 1161
560 nmdc:mga0qj67_280203_c1 3300050509 Bacteria 1351
561 nmdc:mga0qj67_362_c1 3300050509 Bacteria 31322
562 nmdc:mga06r32_103642_c1 3300050510 Bacteria 2793
563 nmdc:mga06r32_216423_c1 3300050510 Bacteria 1903
564 nmdc:mga06r32_93369_c1 3300050510 Bacteria 2943
565 nmdc:mga08y16_19775_c1 3300050511 Bacteria 7100
566 nmdc:mga08y16_23191_c1 3300050511 Bacteria 6551
567 nmdc:mga08y16_305344_c1 3300050511 Bacteria 1640
568 nmdc:mga08y16_314022_c1 3300050511 Bacteria 1614
569 nmdc:mga08y16_83249_c1 3300050511 Bacteria 3334
570 nmdc:mga08y16_886616_c1 3300050511 Bacteria 879
571 nmdc:mga08y16_9626_c1 3300050511 Bacteria 10145
572 nmdc:mga0n895_163501_c1 3300050512 Bacteria 2257
573 nmdc:mga0n895_219085_c1 3300050512 Bacteria 1932
574 nmdc:mga0n895_24821_c1 3300050512 Bacteria 5655
575 nmdc:mga0n895_256049_c1 3300050512 Bacteria 1776
576 nmdc:mga0n895_783989_c1 3300050512 Bacteria 944
577 nmdc:mga0n895_837432_c1 3300050512 Bacteria 908
578 nmdc:mga0rr50_201185_c1 3300050513 Bacteria 1637
579 nmdc:mga0rr50_543181_c1 3300050513 Bacteria 989
580 nmdc:mga08x19_237086_c1 3300050514 Unclassified 1257
581 nmdc:mga0a205_241090_c1 3300050515 Unclassified 1689
582 Ga0500588_0041552 3300053146 Bacteria 1388
583 Ga0500616_0042842 3300053153 Bacteria 2422
584 Ga0501084_0001263 3300054114 Bacteria 19934
585 Ga0501084_0003734 3300054114 Bacteria 12363
586 Ga0501084_0017074 3300054114 Bacteria 6028
587 Ga0501084_0020605 3300054114 Bacteria 5498
588 Ga0501084_0106683 3300054114 Bacteria 2353
589 Ga0501082_0002388 3300060353 Bacteria 16456
590 Ga0501082_0002695 3300060353 Bacteria 15514
591 Ga0501082_0062707 3300060353 Bacteria 3200
592 Ga0501082_0117121 3300060353 Bacteria 2308
593 Ga0530510_0001192 3300061734 Bacteria 17294
594 Ga0530510_0002110 3300061734 Bacteria 13640
595 Ga0530510_0002855 3300061734 Bacteria 11874
596 Ga0530510_0324984 3300061734 Unclassified 1153
597 Ga0395900_0151113
598 JGI25406J46586_10019550
599 JGI25407J50210_10004820
600 JGI25407J50210_10006069
601 Ga0070658_10303145
602 Ga0070683_100094768
603 Ga0070683_100125909
604 Ga0070690_100138746
605 Ga0070690_100231363
606 Ga0070670_100300213
607 Ga0070670_100497256
608 Ga0070677_10019359
609 Ga0070680_100024008
610 Ga0070680_100091985
611 Ga0070680_100278579
612 Ga0070682_100029249
613 Ga0070682_100043697
614 Ga0070682_100115541
615 Ga0070682_100122558
616 Ga0068868_100197953
617 Ga0068868_100382152
618 Ga0070660_100054564
619 Ga0070689_100197979
620 Ga0070689_100624068
621 Ga0070692_10202465
622 Ga0070668_100287217
623 Ga0070675_100035273
624 Ga0070675_100108572
625 Ga0070671_100084815
626 Ga0070674_100116659
627 Ga0070674_100197829
628 Ga0070674_100233158
629 Ga0070674_100748876
630 Ga0070659_100178757
631 Ga0070659_100421551
632 Ga0070713_100009484
633 Ga0070713_100735890
634 Ga0070705_100013910
635 Ga0070705_100158303
636 Ga0070700_100422323
637 Ga0070694_100450868
638 Ga0070663_100030930
639 Ga0070678_100084806
640 Ga0070678_100255589
641 Ga0070662_100125205
642 Ga0070662_100305021
643 Ga0070681_10012204
644 Ga0068867_100240147
645 Ga0070685_10052483
646 Ga0070685_10282334
647 Ga0070699_100113926
648 Ga0070679_100023856
649 Ga0070679_100058848
650 Ga0070684_100094039
651 Ga0070684_100119722
652 Ga0070684_100139862
653 Ga0070684_100152563
654 Ga0070684_100417599
655 Ga0068853_100630830
656 Ga0070672_100267702
657 Ga0070672_100322194
658 Ga0070686_100120023
659 Ga0070686_100172075
660 Ga0070686_100328416
661 Ga0070696_100026794
662 Ga0070693_100049105
663 Ga0070693_100114559
664 Ga0070704_100034680
665 Ga0068855_100376464
666 Ga0070664_100035117
667 Ga0070664_100073521
668 Ga0070664_100377872
669 Ga0070664_100734864
670 Ga0068857_100086776
671 Ga0068857_100205390
672 Ga0068856_100029981
673 Ga0068856_100033427
674 Ga0068856_100237234
675 Ga0068856_100297655
676 Ga0070702_100229482
677 Ga0068852_100270025
678 Ga0068852_100318557
679 Ga0068852_100961787
680 Ga0068859_100550866
681 Ga0068864_100049174
682 Ga0068864_100439164
683 Ga0068861_100120239
684 Ga0068851_10137816
685 Ga0068870_10168122
686 Ga0068870_10183249
687 Ga0068863_100657491
688 Ga0068858_100116306
689 Ga0068860_100316671
690 Ga0068860_100828038
691 Ga0068862_100300472
692 Ga0081455_10028937
693 Ga0081455_10083918
694 Ga0081538_10001746
695 Ga0081538_10019231
696 Ga0081538_10105117
697 Ga0081540_1000814
698 Ga0081539_10001832
699 Ga0081539_10002414
700 Ga0070717_10043113
701 Ga0070717_10105042
702 Ga0075365_10156059
703 Ga0075432_10030924
704 Ga0075432_10044127
705 Ga0070716_100007436
706 Ga0097621_100187987
707 Ga0068871_100040374
708 Ga0068871_100331517
709 Ga0075428_100059458
710 Ga0075430_100163555
711 Ga0075431_100031850
712 Ga0075431_100158625
713 Ga0075431_100295706
714 Ga0075433_10115013
715 Ga0075433_10302570
716 Ga0075434_100014999
717 Ga0075434_100061826
718 Ga0075434_100217882
719 Ga0075429_100038927
720 Ga0075429_100325663
721 Ga0068865_100046999
722 Ga0075436_100185880
723 Ga0097620_100550851
724 Ga0075435_100117984
725 Ga0075435_100229814
726 Ga0075435_100405547
727 Ga0075435_100623738
728 Ga0111539_10004088
729 Ga0111539_10008017
730 Ga0111539_10022339
731 Ga0111539_10099047
732 Ga0111539_10157725
733 Ga0111539_10235496
734 Ga0111539_10291790
735 Ga0111539_10304939
736 Ga0111539_10573986
737 Ga0111539_10768153
738 Ga0105245_10068938
739 Ga0105245_10500109
740 Ga0105245_10555264
741 Ga0114129_10010166
742 Ga0114129_10018237
743 Ga0114129_10027522
744 Ga0114129_10093608
745 Ga0114129_10258127
746 Ga0114129_10337801
747 Ga0114129_10534818
748 Ga0105243_10025040
749 Ga0105243_10152976
750 Ga0105243_10258676
751 Ga0105241_10045883
752 Ga0105241_10067883
753 Ga0105242_10175254
754 Ga0105242_10244716
755 Ga0105242_10281036
756 Ga0105248_10031680
757 Ga0105237_10587986
758 Ga0105238_10274099
759 Ga0105238_10772876
760 Ga0105249_10115993
761 Ga0105249_10312760
762 Ga0105249_10463066
763 Ga0105239_10208151
764 Ga0105239_10357729
765 Ga0105246_10012460
766 Ga0105246_10057277
767 Ga0105246_10285248
768 Ga0105246_10354728
769 Ga0157373_10039174
770 Ga0157371_10206389
771 Ga0157371_10282193
772 Ga0157378_10194372
773 Ga0157372_10059868
774 Ga0157372_10325968
775 Ga0157375_10067065
776 Ga0163163_10067089
777 Ga0157380_10278213
778 Ga0157377_10025829
779 Ga0157379_10000922
780 Ga0157379_10006137
781 Ga0157379_10097728
782 Ga0157376_10304642
783 Ga0163161_10176531
784 Ga0163161_10252521
785 Ga0197907_11286949
786 Ga0206350_10329102
787 Ga0206354_11428740
788 Ga0206353_11799932
789 Ga0224712_10061846
790 Ga0207682_10049398
791 Ga0207692_10112951
792 Ga0207688_10002994
793 Ga0207685_10026462
794 Ga0207699_10067066
795 Ga0207643_10134781
796 Ga0207643_10154012
797 Ga0207654_10072094
798 Ga0207707_10009789
799 Ga0207693_10016514
800 Ga0207663_10004702
801 Ga0207660_10343311
802 Ga0207662_10016393
803 Ga0207662_10329330
804 Ga0207657_10043682
805 Ga0207649_10513334
806 Ga0207652_10171267
807 Ga0207694_10569691
808 Ga0207650_10097798
809 Ga0207650_10217774
810 Ga0207687_10057391
811 Ga0207687_10482802
812 Ga0207687_10561968
813 Ga0207664_10109377
814 Ga0207644_10450586
815 Ga0207690_10121368
816 Ga0207690_10147677
817 Ga0207690_10392259
818 Ga0207706_10042313
819 Ga0207706_10046296
820 Ga0207706_10241393
821 Ga0207706_10403643
822 Ga0207686_10010698
823 Ga0207709_10419441
824 Ga0207709_10494463
825 Ga0207709_10648179
826 Ga0207704_10206738
827 Ga0207704_10308955
828 Ga0207665_10001031
829 Ga0207691_10009283
830 Ga0207691_10630549
831 Ga0207711_10173377
832 Ga0207711_10298823
833 Ga0207689_10239737
834 Ga0207689_10626637
835 Ga0207661_10001520
836 Ga0207661_10172733
837 Ga0207661_10291738
838 Ga0207679_10029741
839 Ga0207679_10202396
840 Ga0207668_10199909
841 Ga0207677_10212698
842 Ga0207677_10218848
843 Ga0207677_10330841
844 Ga0207703_10331440
845 Ga0207678_10051695
846 Ga0207678_10124835
847 Ga0207708_10007378
848 Ga0207708_10018852
849 Ga0207702_10008722
850 Ga0207702_10127199
851 Ga0207702_10152453
852 Ga0207702_10274780
853 Ga0207648_10101130
854 Ga0207648_10172756
855 Ga0207676_10153047
856 Ga0207676_10388327
857 Ga0207676_10625724
858 Ga0207674_10174045
859 Ga0207674_10225349
860 Ga0207674_10334876
861 Ga0207675_100049851
862 Ga0207675_100389139
863 Ga0207683_10018586
864 Ga0207683_10282712
865 Ga0207698_10082441
866 Ga0207698_10139823
867 Ga0207698_10295639
868 Ga0207428_10019457
869 Ga0207428_10055158
870 Ga0207428_10066534
871 Ga0207428_10068765
872 Ga0207428_10184244
873 Ga0307408_100332796
874 Ga0307413_10095771
875 Ga0307406_10024076
876 Ga0307409_100242603
877 Ga0307409_100494823
878 Ga0307416_100138930
879 Ga0307411_10015635
880 Ga0373938_0038510
881 Ga0373951_0014338
882 Ga0373939_0029328
883 Ga0373939_0053153
884 Ga0373941_0014956
885 Ga0373960_0015657
886 Ga0373960_0047773
887 Ga0373961_0032944
888 Ga0373961_0082467
889 Ga0373962_0032319
890 Ga0373931_0096287
891 Ga0395899_0003118
892 Ga0395899_0041570
893 Ga0395899_0116281
894 Ga0395899_0135977
895 Ga0395899_0148156
896 Ga0395899_0190219
897 Ga0395900_0002117
898 Ga0395900_0002220
899 Ga0395900_0067092
900 Ga0395900_0113462
901 Ga0395900_0155342
902 Ga0395900_0199039
903 Ga0395900_0314204
904 Ga0395900_0379063
905 Ga0395898_0006739
906 Ga0395898_0021895
907 Ga0395898_0063571
908 Ga0395898_0108592
909 Ga0395898_0217245
910 Ga0395905_0006435
911 Ga0395905_0036686
912 Ga0395905_0052036
913 Ga0395905_0053052
914 Ga0395905_0062256
915 Ga0395905_0099907
916 Ga0395905_0103692
917 Ga0395905_0225809
918 Ga0395901_0002820
919 Ga0395901_0003228
920 Ga0395901_0037740
921 Ga0395901_0080136
922 Ga0395901_0138766
923 Ga0395901_0209433
924 Ga0395901_0426311
925 Ga0395901_1027890
926 Ga0451807_2436016
927 Ga0439463_005572
928 Ga0439464_0004344
929 Ga0451576_0225309
930 Ga0466967_0215423
931 Ga0495591_054493
932 Ga0495651_0204416
933 Ga0495582_0034579
934 Ga0495605_0042527
935 Ga0495584_0069778
936 Ga0495585_0035976
937 Ga0495594_0027449
938 Ga0495607_0115466
939 Ga0495616_0209002
940 Ga0495637_0038789
941 Ga0495643_0213747
942 Ga0495644_0041292
943 Ga0495644_0075433
944 Ga0495642_0025604
945 Ga0495609_0034462
946 Ga0495597_0058007
947 Ga0495645_0249370
948 Ga0495667_0336741
949 Ga0495656_0063639
950 Ga0495656_0176317
951 Ga0495611_0042294
952 Ga0495659_0022119
953 Ga0495659_0037271
954 Ga0495661_0140331
955 Ga0495658_0063918
956 Ga0495624_0069461
957 Ga0495670_0027690
958 Ga0495670_0275887
959 Ga0495671_0030958
960 Ga0495589_0084334
961 Ga0495589_0095172
962 Ga0495660_0034256
963 Ga0495636_0084916
964 Ga0495677_0119984
965 Ga0495685_100950
966 Ga0495626_0150825
967 Ga0496100_0062202
968 Ga0496100_0088436
969 Ga0496100_0172749
970 Ga0496100_0210740
971 Ga0496100_0344921
972 Ga0496100_0437123
973 Ga0496101_0029383
974 Ga0496101_0039148
975 Ga0496102_0052095
976 Ga0496102_0227373
977 Ga0496102_0281877
978 Ga0496102_0734576
979 Ga0496103_0059648
980 Ga0496103_0153973
981 Ga0496104_0036720
982 Ga0496104_0144231
983 Ga0496104_0179593
984 Ga0496104_0357603
985 Ga0496104_0775022
986 Ga0496105_0031744
987 Ga0496105_0163395
988 Ga0496105_0300962
989 Ga0496105_0320093
990 Ga0496106_0025242
991 Ga0496106_0064107
992 Ga0496107_0098285
993 Ga0496107_0188289
994 Ga0496108_0002108
995 Ga0496108_0004951
996 Ga0496108_0005141
997 Ga0496108_0197449
998 Ga0496109_0001720
999 Ga0496109_0004648
1000 Ga0496109_0005699
1001 Ga0496109_0278597
1002 Ga0496110_0000789
1003 Ga0496110_0000934
1004 Ga0496110_0002813
1005 Ga0496110_0002865
1006 Ga0496111_0001259
1007 Ga0496111_0001742
1008 Ga0496111_0001924
1009 Ga0496111_0271081
1010 Ga0496112_0000677
1011 Ga0496112_0036666
1012 Ga0496112_0054103
1013 Ga0496112_0460577
1014 Ga0496113_0043911
1015 Ga0496113_0046507
1016 Ga0496113_0169016
1017 Ga0496113_0241682
1018 Ga0496114_0023042
1019 Ga0496114_0115381
1020 Ga0496114_0156653
1021 Ga0496114_0205761
1022 Ga0496114_0286582
1023 Ga0496114_0585326
1024 Ga0496115_0001722
1025 Ga0496115_0030196
1026 Ga0496115_0121287
1027 Ga0496115_0173988
1028 Ga0496119_0097247
1029 Ga0501031_0016906
1030 Ga0501031_0057797
1031 Ga0501031_0095514
1032 Ga0501031_0099507
1033 Ga0501032_0000414
1034 Ga0501032_0019894
1035 Ga0501032_0026115
1036 Ga0501033_0007243
1037 Ga0501033_0057028
1038 Ga0501034_0155198
1039 Ga0501036_0003717
1040 Ga0501036_0013785
1041 Ga0501036_0029108
1042 Ga0501036_0058328
1043 Ga0501037_0002188
1044 Ga0501037_0006663
1045 Ga0501038_0002507
1046 Ga0501038_0070683
1047 Ga0501038_0097040
1048 Ga0501039_0003326
1049 Ga0501039_0003959
1050 Ga0501039_0011523
1051 Ga0501039_0135924
1052 Ga0501040_0000243
1053 Ga0501040_0001907
1054 Ga0501040_0005397
1055 Ga0501040_0013703
1056 Ga0501040_0030337
1057 Ga0501041_0000408
1058 Ga0501041_0001062
1059 Ga0501041_0025904
1060 Ga0501041_0030738
1061 Ga0501041_0051047
1062 Ga0501041_0358592
1063 Ga0501042_0000154
1064 Ga0501042_0007069
1065 Ga0501042_0010593
1066 Ga0501042_0013114
1067 Ga0501042_0129772
1068 Ga0501042_0206594
1069 Ga0501043_0000284
1070 Ga0501043_0011936
1071 Ga0501043_0206968
1072 Ga0501043_0253039
1073 Ga0501046_0000901
1074 Ga0501046_0001158
1075 Ga0501046_0053462
1076 Ga0501047_0000949
1077 Ga0501047_0020432
1078 Ga0501048_0000676
1079 Ga0501048_0002304
1080 Ga0501048_0017895
1081 Ga0501067_0063010
1082 Ga0501068_0001187
1083 Ga0501068_0023904
1084 Ga0501068_0071809
1085 Ga0501068_0084191
1086 Ga0501069_0003176
1087 Ga0501070_0001903
1088 Ga0501070_0061815
1089 Ga0501070_0122429
1090 Ga0501071_0000057
1091 Ga0501071_0024691
1092 Ga0501071_0034836
1093 Ga0501071_0059841
1094 Ga0501072_0000387
1095 Ga0501072_0006432
1096 Ga0501072_0009258
1097 Ga0501072_0015067
1098 Ga0501072_0129570
1099 Ga0501073_0000148
1100 Ga0501073_0010873
1101 Ga0501073_0173206
1102 Ga0501074_0002447
1103 Ga0501074_0036638
1104 Ga0501074_0064668
1105 Ga0501074_0155072
1106 Ga0501075_0000510
1107 Ga0501075_0002590
1108 Ga0501075_0016667
1109 Ga0501075_0047681
1110 Ga0501075_0079626
1111 Ga0501076_0001165
1112 Ga0501076_0001770
1113 Ga0501076_0013167
1114 Ga0501076_0021626
1115 Ga0501076_0054604
1116 Ga0501076_0059232
1117 Ga0501076_0769411
1118 Ga0501077_0000755
1119 Ga0501077_0014507
1120 Ga0501077_0025774
1121 Ga0501077_0091802
1122 Ga0501079_0000816
1123 Ga0501079_0001361
1124 Ga0501079_0083471
1125 Ga0501079_0093818
1126 Ga0501080_0000723
1127 Ga0501080_0026657
1128 Ga0501080_0068205
1129 Ga0501080_0319724
1130 Ga0501080_0435049
1131 Ga0501081_0000742
1132 Ga0501081_0001941
1133 Ga0501081_0011703
1134 Ga0501081_0048614
1135 Ga0501081_0097477
1136 Ga0501083_0000209
1137 Ga0501083_0049579
1138 Ga0501035_0001507
1139 Ga0501035_0065950
1140 Ga0501035_0086881
1141 Ga0501044_0011263
1142 Ga0501044_0014087
1143 Ga0501045_0006828
1144 Ga0501045_0008884
1145 Ga0501045_0010012
1146 Ga0501045_0014904
1147 nmdc:mga0yw44_169517_c1
1148 nmdc:mga05p37_101611_c1
1149 nmdc:mga05p37_168722_c1
1150 nmdc:mga05p37_529986_c1
1151 nmdc:mga05p37_61874_c1
1152 nmdc:mga05p37_686080_c1
1153 nmdc:mga09592_1338_c1
1154 nmdc:mga09592_168179_c1
1155 nmdc:mga09592_416339_c1
1156 nmdc:mga0qj67_280203_c1
1157 nmdc:mga0qj67_362_c1
1158 nmdc:mga06r32_103642_c1
1159 nmdc:mga06r32_216423_c1
1160 nmdc:mga06r32_93369_c1
1161 nmdc:mga08y16_19775_c1
1162 nmdc:mga08y16_23191_c1
1163 nmdc:mga08y16_305344_c1
1164 nmdc:mga08y16_314022_c1
1165 nmdc:mga08y16_83249_c1
1166 nmdc:mga08y16_886616_c1
1167 nmdc:mga08y16_9626_c1
1168 nmdc:mga0n895_163501_c1
1169 nmdc:mga0n895_219085_c1
1170 nmdc:mga0n895_24821_c1
1171 nmdc:mga0n895_256049_c1
1172 nmdc:mga0n895_783989_c1
1173 nmdc:mga0n895_837432_c1
1174 nmdc:mga0rr50_201185_c1
1175 nmdc:mga0rr50_543181_c1
1176 nmdc:mga08x19_237086_c1
1177 nmdc:mga0a205_241090_c1
1178 Ga0500588_0041552
1179 Ga0500616_0042842
1180 Ga0501084_0001263
1181 Ga0501084_0003734
1182 Ga0501084_0017074
1183 Ga0501084_0020605
1184 Ga0501084_0106683
1185 Ga0501082_0002388
1186 Ga0501082_0002695
1187 Ga0501082_0062707
1188 Ga0501082_0117121
1189 Ga0530510_0001192
1190 Ga0530510_0002110
1191 Ga0530510_0002855
1192 Ga0530510_0324984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gfg-assembly3.cif.gz_C crystal structure of a putative adenylate cyclase (bh2851) from bacillus halodurans at 2.12 a resolution 0.8234 24 243
6yp4-assembly1.cif.gz_A-2 putative adenylyl cyclase hpac1 from hippeastrum reveals a dominant triphophatase activity 0.8082 28 242
2gfg-assembly3.cif.gz_C crystal structure of a putative adenylate cyclase (bh2851) from bacillus halodurans at 2.12 a resolution 0.7963 24 243
3sy3-assembly2.cif.gz_C gbaa_1210 protein, a putative adenylate cyclase, from bacillus anthracis 0.7889 25 238
3v85-assembly1.cif.gz_A 1.9 angstrom resolution crystal structure of the protein q9siy3 from arabidopsis thaliana 0.7884 26 242
ID Description Score Start End Superfamily
2gfgC00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.8189 24 243 2.40.320.10
af_I1MU21_1_199_2.40.320.10 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.8163 26 242 2.40.320.10
2gfgC00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7956 24 243 2.40.320.10
3sy3C00 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7857 25 238 2.40.320.10
af_I1MU21_1_199_2.40.320.10 Mainly Beta;Beta Barrel;Hypothetical Protein Pfu-838710-001;Hypothetical Protein Pfu-838710-001 0.7795 26 242 2.40.320.10
ID Description Score Start End GO Terms
AF-A0A4T0V873-F1-model_v4 Adenylate cyclase 0.9764 5 250
AF-A0A3C0QAW9-F1-model_v4 Adenylate cyclase 0.971 7 251
AF-A0A4Q6BP51-F1-model_v4 Adenylate cyclase 0.9677 3 253
AF-E3JD48-F1-model_v4 CYTH domain-containing protein 0.9613 11 255
AF-A0A0Q8VBS4-F1-model_v4 Adenylate cyclase 0.961 4 254

Map