F467525

General Info

Members Datasets Scaffolds Average Seq Length
596 224 1192 69

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100995115|Ga0068853_1009951152
Length 70
Sequence MKYIDFAHPEGGRFLVHVDHITSAHYRPGDGGEMKTRLGLDLDERQNEIVIFGEEADRTWEKLQQLMRGT

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
180 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
197 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
198 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
203 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
204 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
205 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
206 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
211 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
212 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
213 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.35
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 40.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100995115 3300005539 Unclassified 807
2 MBSR1b_contig_7739576 2162886012 Bacteria 819
3 JGI24736J21556_1049411 3300001904 Unclassified 647
4 JGI24751J29686_10000178 3300002459 Bacteria 29196
5 JGI25406J46586_10090425 3300003203 Bacteria 925
6 rootH2_10237336 3300003320 Bacteria 1873
7 rootL2_10307743 3300003322 Bacteria 1413
8 Ga0065704_10166589 3300005289 Bacteria 1318
9 Ga0065704_10181516 3300005289 Bacteria 1235
10 Ga0065712_10000866 3300005290 Bacteria 7711
11 Ga0065715_10011189 3300005293 Bacteria 3316
12 Ga0065715_10014582 3300005293 Unclassified 4718
13 Ga0065715_10024148 3300005293 Unclassified 1961
14 Ga0065715_10031349 3300005293 Unclassified 1423
15 Ga0065715_10040697 3300005293 Unclassified 1206
16 Ga0065715_10397165 3300005293 Bacteria 862
17 Ga0065715_10584626 3300005293 Bacteria 718
18 Ga0065715_10747897 3300005293 Unclassified 631
19 Ga0065707_10001165 3300005295 Bacteria 8977
20 Ga0065707_10167754 3300005295 Unclassified 1508
21 Ga0070676_10366416 3300005328 Bacteria 994
22 Ga0070676_10596919 3300005328 Bacteria 796
23 Ga0070690_100244264 3300005330 Bacteria 1267
24 Ga0070690_100245645 3300005330 Unclassified 1264
25 Ga0070690_100628755 3300005330 Unclassified 818
26 Ga0070670_100000114 3300005331 Bacteria 75910
27 Ga0070670_100080224 3300005331 Unclassified 2804
28 Ga0070670_100101162 3300005331 Bacteria 2482
29 Ga0070670_100355365 3300005331 Bacteria 1288
30 Ga0070670_100380931 3300005331 Unclassified 1243
31 Ga0070670_100569245 3300005331 Bacteria 1012
32 Ga0070677_10170602 3300005333 Bacteria 1028
33 Ga0068869_100246829 3300005334 Bacteria 1424
34 Ga0068869_100396899 3300005334 Bacteria 1134
35 Ga0068869_100553456 3300005334 Unclassified 967
36 Ga0068869_100765094 3300005334 Unclassified 828
37 Ga0070680_100560147 3300005336 Bacteria 980
38 Ga0070680_101643033 3300005336 Unclassified 557
39 Ga0070680_101653683 3300005336 Bacteria 555
40 Ga0070682_100006649 3300005337 Bacteria 6483
41 Ga0070682_100020584 3300005337 Bacteria 3884
42 Ga0070682_100980848 3300005337 Bacteria 700
43 Ga0070689_100333042 3300005340 Bacteria 1270
44 Ga0070689_100514978 3300005340 Bacteria 1027
45 Ga0070689_101182678 3300005340 Bacteria 686
46 Ga0070691_10332880 3300005341 Unclassified 838
47 Ga0070691_11020165 3300005341 Unclassified 517
48 Ga0070687_100057537 3300005343 Bacteria 2039
49 Ga0070687_100697772 3300005343 Bacteria 709
50 Ga0070687_101381119 3300005343 Bacteria 526
51 Ga0070692_10001286 3300005345 Bacteria 8986
52 Ga0070692_10040371 3300005345 Unclassified 2386
53 Ga0070692_10062399 3300005345 Bacteria 1967
54 Ga0070692_10320914 3300005345 Bacteria 952
55 Ga0070692_11218224 3300005345 Unclassified 537
56 Ga0070669_100185925 3300005353 Unclassified 1628
57 Ga0070669_100279973 3300005353 Bacteria 1336
58 Ga0070669_101945309 3300005353 Unclassified 514
59 Ga0070675_100272436 3300005354 Unclassified 1486
60 Ga0070675_100567640 3300005354 Bacteria 1027
61 Ga0070671_101070571 3300005355 Unclassified 708
62 Ga0070673_100141943 3300005364 Unclassified 2027
63 Ga0070673_100226129 3300005364 Bacteria 1622
64 Ga0070673_102102441 3300005364 Bacteria 536
65 Ga0070688_100221309 3300005365 Bacteria 1334
66 Ga0070688_101476672 3300005365 Unclassified 553
67 Ga0070659_100118943 3300005366 Unclassified 2138
68 Ga0070659_101253226 3300005366 Unclassified 657
69 Ga0070703_10341585 3300005406 Unclassified 636
70 Ga0070701_10025182 3300005438 Bacteria 2886
71 Ga0070701_10097180 3300005438 Unclassified 1625
72 Ga0070701_11037683 3300005438 Bacteria 574
73 Ga0070705_100017736 3300005440 Bacteria 3720
74 Ga0070705_100057917 3300005440 Unclassified 2288
75 Ga0070705_100474602 3300005440 Bacteria 944
76 Ga0070705_100708195 3300005440 Bacteria 792
77 Ga0070700_100011901 3300005441 Unclassified 4833
78 Ga0070700_100044215 3300005441 Unclassified 2742
79 Ga0070700_100060950 3300005441 Bacteria 2379
80 Ga0070700_100092581 3300005441 Unclassified 1975
81 Ga0070700_100123456 3300005441 Bacteria 1738
82 Ga0070700_100977619 3300005441 Unclassified 694
83 Ga0070700_101747921 3300005441 Unclassified 535
84 Ga0070694_100005508 3300005444 Bacteria 7667
85 Ga0070694_100013829 3300005444 Bacteria 5046
86 Ga0070694_100056821 3300005444 Bacteria 2659
87 Ga0070694_100119775 3300005444 Bacteria 1887
88 Ga0070694_100138754 3300005444 Bacteria 1764
89 Ga0070694_100535616 3300005444 Unclassified 936
90 Ga0070694_100675832 3300005444 Bacteria 838
91 Ga0070694_100713608 3300005444 Unclassified 816
92 Ga0070662_100218945 3300005457 Bacteria 1518
93 Ga0070681_10003436 3300005458 Bacteria 14833
94 Ga0068867_100638837 3300005459 Bacteria 932
95 Ga0068867_101067803 3300005459 Unclassified 736
96 Ga0070706_100102504 3300005467 Bacteria 2660
97 Ga0070707_100154000 3300005468 Bacteria 2239
98 Ga0070707_100785500 3300005468 Unclassified 916
99 Ga0070698_100069621 3300005471 Bacteria 3531
100 Ga0070698_100232844 3300005471 Bacteria 1775
101 Ga0070699_100178835 3300005518 Bacteria 1882
102 Ga0070699_101474068 3300005518 Unclassified 624
103 Ga0070679_100019487 3300005530 Bacteria 6597
104 Ga0070679_100780455 3300005530 Unclassified 899
105 Ga0070684_101186559 3300005535 Unclassified 718
106 Ga0070697_100284240 3300005536 Bacteria 1420
107 Ga0070697_101551392 3300005536 Unclassified 592
108 Ga0068853_100194983 3300005539 Bacteria 1841
109 Ga0068853_100412185 3300005539 Bacteria 1266
110 Ga0068853_101947369 3300005539 Unclassified 570
111 Ga0070672_101174366 3300005543 Unclassified 683
112 Ga0070686_100969042 3300005544 Unclassified 696
113 Ga0070695_100014150 3300005545 Unclassified 4807
114 Ga0070695_100162485 3300005545 Unclassified 1569
115 Ga0070695_100260801 3300005545 Bacteria 1266
116 Ga0070695_100577264 3300005545 Unclassified 880
117 Ga0070695_100918228 3300005545 Bacteria 708
118 Ga0070695_101196087 3300005545 Unclassified 625
119 Ga0070696_100099991 3300005546 Bacteria 2077
120 Ga0070696_100151232 3300005546 Unclassified 1704
121 Ga0070696_100585192 3300005546 Unclassified 898
122 Ga0070696_100834573 3300005546 Bacteria 761
123 Ga0070696_101244773 3300005546 Bacteria 630
124 Ga0070693_100026260 3300005547 Bacteria 3143
125 Ga0070693_100259201 3300005547 Unclassified 1156
126 Ga0070693_100435221 3300005547 Unclassified 917
127 Ga0070693_100483173 3300005547 Unclassified 875
128 Ga0070693_101129173 3300005547 Unclassified 599
129 Ga0070693_101463367 3300005547 Unclassified 533
130 Ga0070693_101682797 3300005547 Unclassified 500
131 Ga0070704_100109427 3300005549 Unclassified 2099
132 Ga0070704_100145474 3300005549 Unclassified 1857
133 Ga0070704_100213701 3300005549 Bacteria 1564
134 Ga0070704_100628665 3300005549 Bacteria 946
135 Ga0070704_100784222 3300005549 Unclassified 850
136 Ga0070704_101151863 3300005549 Unclassified 706
137 Ga0070704_101290920 3300005549 Bacteria 668
138 Ga0068855_101194559 3300005563 Bacteria 791
139 Ga0068855_101380703 3300005563 Unclassified 727
140 Ga0070664_100229222 3300005564 Bacteria 1665
141 Ga0070664_100424646 3300005564 Bacteria 1218
142 Ga0070664_100481685 3300005564 Unclassified 1142
143 Ga0070664_100772120 3300005564 Unclassified 898
144 Ga0068857_100164592 3300005577 Bacteria 2014
145 Ga0068857_100177721 3300005577 Bacteria 1936
146 Ga0068857_100482662 3300005577 Bacteria 1161
147 Ga0068857_100497199 3300005577 Bacteria 1144
148 Ga0068857_101393948 3300005577 Unclassified 682
149 Ga0068857_102466391 3300005577 Unclassified 511
150 Ga0068854_100178983 3300005578 Unclassified 1655
151 Ga0068854_100384879 3300005578 Unclassified 1157
152 Ga0068854_101068987 3300005578 Unclassified 718
153 Ga0068856_100802647 3300005614 Unclassified 961
154 Ga0070702_100003763 3300005615 Bacteria 6846
155 Ga0070702_100052394 3300005615 Bacteria 2340
156 Ga0070702_100061978 3300005615 Bacteria 2179
157 Ga0070702_101350421 3300005615 Unclassified 581
158 Ga0068852_100057667 3300005616 Bacteria 3361
159 Ga0068852_100086887 3300005616 Bacteria 2789
160 Ga0068852_100764667 3300005616 Unclassified 979
161 Ga0068852_101461598 3300005616 Bacteria 706
162 Ga0068859_100013761 3300005617 Bacteria 8111
163 Ga0068859_100036609 3300005617 Unclassified 4927
164 Ga0068859_100122442 3300005617 Bacteria 2668
165 Ga0068859_100164130 3300005617 Bacteria 2300
166 Ga0068859_100260803 3300005617 Bacteria 1824
167 Ga0068859_100269603 3300005617 Unclassified 1794
168 Ga0068859_100441567 3300005617 Bacteria 1397
169 Ga0068859_100485098 3300005617 Bacteria 1331
170 Ga0068859_100538225 3300005617 Unclassified 1263
171 Ga0068859_100889498 3300005617 Bacteria 975
172 Ga0068859_101373187 3300005617 Unclassified 779
173 Ga0068864_100002054 3300005618 Bacteria 16615
174 Ga0068864_100088536 3300005618 Unclassified 2727
175 Ga0068864_100353715 3300005618 Bacteria 1387
176 Ga0068864_100521709 3300005618 Unclassified 1145
177 Ga0068864_101115235 3300005618 Bacteria 785
178 Ga0068866_10112990 3300005718 Unclassified 1519
179 Ga0068861_100002231 3300005719 Bacteria 12572
180 Ga0068861_100062327 3300005719 Unclassified 2864
181 Ga0068861_102523009 3300005719 Unclassified 518
182 Ga0068851_10006507 3300005834 Bacteria 5334
183 Ga0068851_10959931 3300005834 Bacteria 538
184 Ga0068870_10029151 3300005840 Bacteria 2778
185 Ga0068870_10144659 3300005840 Bacteria 1394
186 Ga0068870_10234394 3300005840 Bacteria 1130
187 Ga0068870_10422253 3300005840 Bacteria 873
188 Ga0068870_10590776 3300005840 Bacteria 753
189 Ga0068863_100352289 3300005841 Bacteria 1434
190 Ga0068863_100384120 3300005841 Bacteria 1371
191 Ga0068863_100997505 3300005841 Bacteria 840
192 Ga0068863_101959622 3300005841 Bacteria 596
193 Ga0068858_100140504 3300005842 Bacteria 2267
194 Ga0068858_100166056 3300005842 Bacteria 2080
195 Ga0068858_100425266 3300005842 Unclassified 1278
196 Ga0068858_100442041 3300005842 Bacteria 1252
197 Ga0068858_100449807 3300005842 Unclassified 1241
198 Ga0068858_100539698 3300005842 Unclassified 1129
199 Ga0068858_100559432 3300005842 Bacteria 1107
200 Ga0068858_101201218 3300005842 Bacteria 745
201 Ga0068860_100039143 3300005843 Bacteria 4535
202 Ga0068860_100039260 3300005843 Unclassified 4528
203 Ga0068860_100093026 3300005843 Bacteria 2873
204 Ga0068860_100113698 3300005843 Bacteria 2588
205 Ga0068860_100424953 3300005843 Unclassified 1318
206 Ga0068862_100073922 3300005844 Unclassified 2946
207 Ga0068862_100207174 3300005844 Bacteria 1770
208 Ga0068862_100607341 3300005844 Bacteria 1051
209 Ga0068862_101586841 3300005844 Unclassified 661
210 Ga0081539_10001697 3300005985 Bacteria 35528
211 Ga0075432_10420117 3300006058 Unclassified 581
212 Ga0070716_100244350 3300006173 Unclassified 1219
213 Ga0070716_100612281 3300006173 Unclassified 821
214 Ga0070716_100666687 3300006173 Bacteria 791
215 Ga0070716_100956193 3300006173 Unclassified 674
216 Ga0070712_101459417 3300006175 Unclassified 597
217 Ga0097621_100006542 3300006237 Bacteria 8276
218 Ga0075428_100049079 3300006844 Bacteria 4631
219 Ga0075428_100252786 3300006844 Bacteria 1899
220 Ga0075430_100076761 3300006846 Bacteria 2800
221 Ga0075430_100080828 3300006846 Bacteria 2722
222 Ga0075430_100709603 3300006846 Unclassified 829
223 Ga0075431_100068627 3300006847 Unclassified 3658
224 Ga0075431_100152160 3300006847 Bacteria 2382
225 Ga0075431_101999451 3300006847 Unclassified 535
226 Ga0075433_10015946 3300006852 Bacteria 6179
227 Ga0075433_10164786 3300006852 Bacteria 1973
228 Ga0075433_10251714 3300006852 Bacteria 1567
229 Ga0075433_10706566 3300006852 Bacteria 883
230 Ga0075433_11289472 3300006852 Bacteria 633
231 Ga0075433_11778485 3300006852 Unclassified 530
232 Ga0075434_100003211 3300006871 Bacteria 14574
233 Ga0075434_100385323 3300006871 Bacteria 1423
234 Ga0075434_100796029 3300006871 Bacteria 962
235 Ga0075434_102611998 3300006871 Bacteria 505
236 Ga0075429_100007029 3300006880 Bacteria 9777
237 Ga0075429_100046777 3300006880 Bacteria 3764
238 Ga0075429_100853181 3300006880 Bacteria 797
239 Ga0068865_100234746 3300006881 Unclassified 1440
240 Ga0075436_100048447 3300006914 Unclassified 2932
241 Ga0075436_100456004 3300006914 Unclassified 931
242 Ga0097620_100013760 3300006931 Bacteria 8111
243 Ga0097620_100036609 3300006931 Unclassified 4927
244 Ga0097620_100122453 3300006931 Bacteria 2668
245 Ga0097620_100164142 3300006931 Bacteria 2300
246 Ga0097620_100260795 3300006931 Bacteria 1824
247 Ga0097620_100269594 3300006931 Unclassified 1794
248 Ga0097620_100441588 3300006931 Bacteria 1397
249 Ga0097620_100485115 3300006931 Bacteria 1331
250 Ga0097620_100538220 3300006931 Unclassified 1263
251 Ga0097620_100889490 3300006931 Bacteria 975
252 Ga0097620_101372874 3300006931 Unclassified 779
253 Ga0075435_100006951 3300007076 Bacteria 8031
254 Ga0075435_101937349 3300007076 Unclassified 517
255 Ga0105251_10228588 3300009011 Unclassified 838
256 Ga0105250_10091802 3300009092 Unclassified 1236
257 Ga0105250_10306941 3300009092 Unclassified 687
258 Ga0105240_10049705 3300009093 Bacteria 5291
259 Ga0105240_10153079 3300009093 Unclassified 2745
260 Ga0105240_10921803 3300009093 Unclassified 939
261 Ga0111539_10005260 3300009094 Bacteria 16759
262 Ga0111539_10009029 3300009094 Bacteria 12616
263 Ga0111539_10069379 3300009094 Bacteria 4162
264 Ga0111539_10963868 3300009094 Unclassified 992
265 Ga0105245_10614625 3300009098 Bacteria 1114
266 Ga0105245_11305279 3300009098 Bacteria 775
267 Ga0105245_11966670 3300009098 Bacteria 638
268 Ga0105247_10001363 3300009101 Bacteria 17765
269 Ga0105247_10275036 3300009101 Bacteria 1160
270 Ga0114129_10033109 3300009147 Bacteria 7304
271 Ga0114129_10138330 3300009147 Bacteria 3341
272 Ga0114129_10305551 3300009147 Unclassified 2119
273 Ga0105243_10070464 3300009148 Unclassified 2823
274 Ga0105243_10319643 3300009148 Bacteria 1414
275 Ga0105243_10648088 3300009148 Unclassified 1023
276 Ga0105243_10771603 3300009148 Unclassified 944
277 Ga0105243_10890191 3300009148 Unclassified 885
278 Ga0105243_11343061 3300009148 Unclassified 733
279 Ga0105243_13132432 3300009148 Unclassified 501
280 Ga0105241_10081182 3300009174 Bacteria 2539
281 Ga0105241_10119528 3300009174 Bacteria 2120
282 Ga0105241_10370691 3300009174 Bacteria 1248
283 Ga0105241_10530409 3300009174 Bacteria 1054
284 Ga0105241_10688434 3300009174 Bacteria 932
285 Ga0105241_12308880 3300009174 Unclassified 535
286 Ga0105242_10932017 3300009176 Bacteria 871
287 Ga0105242_12735759 3300009176 Unclassified 543
288 Ga0105242_12909135 3300009176 Unclassified 529
289 Ga0105248_10151697 3300009177 Unclassified 2615
290 Ga0105248_10210457 3300009177 Unclassified 2191
291 Ga0105248_10467913 3300009177 Bacteria 1421
292 Ga0105248_10536775 3300009177 Bacteria 1319
293 Ga0105248_11441378 3300009177 Bacteria 779
294 Ga0105248_11750918 3300009177 Bacteria 704
295 Ga0105248_13032305 3300009177 Unclassified 535
296 Ga0105237_10000767 3300009545 Bacteria 43919
297 Ga0105237_10253880 3300009545 Bacteria 1761
298 Ga0105237_10331236 3300009545 Unclassified 1527
299 Ga0105237_12459978 3300009545 Unclassified 531
300 Ga0105238_10008398 3300009551 Bacteria 10334
301 Ga0105238_10008722 3300009551 Bacteria 10143
302 Ga0105238_10677241 3300009551 Unclassified 1043
303 Ga0105238_12604670 3300009551 Unclassified 542
304 Ga0105249_10101283 3300009553 Bacteria 2709
305 Ga0105249_11234889 3300009553 Unclassified 818
306 Ga0105249_13432961 3300009553 Unclassified 510
307 Ga0105239_10194363 3300010375 Bacteria 2272
308 Ga0105239_10604883 3300010375 Unclassified 1251
309 Ga0105239_10838541 3300010375 Bacteria 1054
310 Ga0105239_11400553 3300010375 Bacteria 807
311 Ga0105246_10036294 3300011119 Bacteria 3301
312 Ga0105246_11590629 3300011119 Unclassified 617
313 Ga0157373_10008498 3300013100 Bacteria 7628
314 Ga0157373_10167383 3300013100 Unclassified 1547
315 Ga0157373_10187173 3300013100 Bacteria 1458
316 Ga0157373_10667231 3300013100 Unclassified 760
317 Ga0157371_10247443 3300013102 Bacteria 1283
318 Ga0157371_10949539 3300013102 Unclassified 654
319 Ga0157374_10864142 3300013296 Unclassified 922
320 Ga0157374_11699157 3300013296 Bacteria 656
321 Ga0157378_10466264 3300013297 Bacteria 1256
322 Ga0157378_10490316 3300013297 Bacteria 1226
323 Ga0157378_11937070 3300013297 Unclassified 639
324 Ga0163162_10462934 3300013306 Bacteria 1399
325 Ga0163162_10565245 3300013306 Bacteria 1265
326 Ga0163162_11330480 3300013306 Unclassified 817
327 Ga0163162_11715596 3300013306 Bacteria 717
328 Ga0157372_10013334 3300013307 Bacteria 8775
329 Ga0157372_10271323 3300013307 Bacteria 1971
330 Ga0157372_10609253 3300013307 Bacteria 1273
331 Ga0157372_10834862 3300013307 Bacteria 1070
332 Ga0157372_11406776 3300013307 Bacteria 804
333 Ga0157372_12105037 3300013307 Unclassified 648
334 Ga0157372_12132228 3300013307 Bacteria 644
335 Ga0157375_10006616 3300013308 Bacteria 10086
336 Ga0157375_10168492 3300013308 Unclassified 2336
337 Ga0157375_10332511 3300013308 Bacteria 1684
338 Ga0163163_10005030 3300014325 Bacteria 11393
339 Ga0163163_10005896 3300014325 Bacteria 10662
340 Ga0163163_10366422 3300014325 Bacteria 1498
341 Ga0163163_10760640 3300014325 Bacteria 1032
342 Ga0163163_11351414 3300014325 Unclassified 774
343 Ga0163163_11938368 3300014325 Bacteria 649
344 Ga0163163_12844158 3300014325 Unclassified 540
345 Ga0157380_10321471 3300014326 Bacteria 1435
346 Ga0157380_11098267 3300014326 Unclassified 834
347 Ga0157380_11357355 3300014326 Bacteria 760
348 Ga0157377_10078425 3300014745 Unclassified 1925
349 Ga0157377_10340032 3300014745 Bacteria 1003
350 Ga0157379_10481828 3300014968 Unclassified 1148
351 Ga0157379_12286359 3300014968 Unclassified 538
352 Ga0157379_12497018 3300014968 Unclassified 517
353 Ga0163161_10386300 3300017792 Bacteria 1120
354 Ga0207697_10464113 3300025315 Unclassified 561
355 Ga0207656_10008094 3300025321 Bacteria 3856
356 Ga0207656_10389244 3300025321 Bacteria 700
357 Ga0207653_10025249 3300025885 Unclassified 1900
358 Ga0207653_10423488 3300025885 Unclassified 522
359 Ga0207642_11068167 3300025899 Unclassified 521
360 Ga0207710_10001253 3300025900 Bacteria 12861
361 Ga0207710_10691737 3300025900 Unclassified 535
362 Ga0207688_10278675 3300025901 Bacteria 1018
363 Ga0207647_10033966 3300025904 Bacteria 3260
364 Ga0207647_10105967 3300025904 Unclassified 1665
365 Ga0207647_10116690 3300025904 Bacteria 1576
366 Ga0207647_10201765 3300025904 Bacteria 1150
367 Ga0207647_10227850 3300025904 Bacteria 1073
368 Ga0207699_10618971 3300025906 Bacteria 789
369 Ga0207645_10302576 3300025907 Bacteria 1065
370 Ga0207645_10377186 3300025907 Bacteria 952
371 Ga0207645_11050685 3300025907 Unclassified 550
372 Ga0207643_10018925 3300025908 Bacteria 3771
373 Ga0207643_10021688 3300025908 Bacteria 3532
374 Ga0207643_10085706 3300025908 Bacteria 1830
375 Ga0207643_10262674 3300025908 Bacteria 1066
376 Ga0207643_10345747 3300025908 Bacteria 933
377 Ga0207654_10058501 3300025911 Bacteria 2244
378 Ga0207654_10300024 3300025911 Bacteria 1092
379 Ga0207654_10399376 3300025911 Unclassified 955
380 Ga0207654_11374829 3300025911 Bacteria 515
381 Ga0207707_10018026 3300025912 Bacteria 6151
382 Ga0207707_10275143 3300025912 Bacteria 1459
383 Ga0207695_10097098 3300025913 Bacteria 2947
384 Ga0207695_10197734 3300025913 Bacteria 1926
385 Ga0207695_10381435 3300025913 Bacteria 1295
386 Ga0207671_10012031 3300025914 Bacteria 6990
387 Ga0207671_10426871 3300025914 Unclassified 1055
388 Ga0207660_10046359 3300025917 Bacteria 3067
389 Ga0207660_10978365 3300025917 Unclassified 690
390 Ga0207660_11656643 3300025917 Bacteria 515
391 Ga0207662_10331695 3300025918 Bacteria 1018
392 Ga0207662_10443916 3300025918 Bacteria 886
393 Ga0207649_10363344 3300025920 Bacteria 1075
394 Ga0207649_10422225 3300025920 Bacteria 1002
395 Ga0207652_11253042 3300025921 Unclassified 644
396 Ga0207646_10022463 3300025922 Bacteria 5811
397 Ga0207646_10526983 3300025922 Unclassified 1063
398 Ga0207681_10238093 3300025923 Unclassified 1415
399 Ga0207681_10370321 3300025923 Bacteria 1151
400 Ga0207694_10004349 3300025924 Bacteria 11065
401 Ga0207694_10033118 3300025924 Bacteria 3958
402 Ga0207650_10000022 3300025925 Bacteria 318878
403 Ga0207650_10140173 3300025925 Bacteria 1900
404 Ga0207650_10163217 3300025925 Bacteria 1766
405 Ga0207650_11629498 3300025925 Bacteria 547
406 Ga0207659_10288874 3300025926 Bacteria 1343
407 Ga0207659_10674216 3300025926 Unclassified 884
408 Ga0207659_11516177 3300025926 Unclassified 573
409 Ga0207687_10337071 3300025927 Bacteria 1225
410 Ga0207644_10382061 3300025931 Unclassified 1149
411 Ga0207644_11540726 3300025931 Unclassified 558
412 Ga0207690_10078234 3300025932 Unclassified 2301
413 Ga0207690_10182350 3300025932 Bacteria 1582
414 Ga0207690_10537516 3300025932 Bacteria 949
415 Ga0207690_11761229 3300025932 Unclassified 517
416 Ga0207706_10207221 3300025933 Bacteria 1719
417 Ga0207706_10207739 3300025933 Bacteria 1717
418 Ga0207686_10037590 3300025934 Unclassified 2923
419 Ga0207709_10040022 3300025935 Unclassified 2804
420 Ga0207709_10339899 3300025935 Bacteria 1129
421 Ga0207709_10693873 3300025935 Unclassified 814
422 Ga0207709_10749527 3300025935 Bacteria 785
423 Ga0207709_10850244 3300025935 Unclassified 739
424 Ga0207670_10675406 3300025936 Unclassified 853
425 Ga0207665_10293649 3300025939 Bacteria 1213
426 Ga0207665_10942399 3300025939 Unclassified 686
427 Ga0207691_10788130 3300025940 Bacteria 799
428 Ga0207711_10249513 3300025941 Bacteria 1629
429 Ga0207711_10628936 3300025941 Unclassified 1001
430 Ga0207711_11202964 3300025941 Unclassified 699
431 Ga0207711_11233195 3300025941 Unclassified 690
432 Ga0207689_10182327 3300025942 Bacteria 1731
433 Ga0207689_10300606 3300025942 Bacteria 1330
434 Ga0207689_10491661 3300025942 Bacteria 1028
435 Ga0207679_10153805 3300025945 Bacteria 1876
436 Ga0207679_10189185 3300025945 Bacteria 1710
437 Ga0207679_10217476 3300025945 Unclassified 1606
438 Ga0207679_10227380 3300025945 Bacteria 1573
439 Ga0207679_10312615 3300025945 Bacteria 1358
440 Ga0207651_10147862 3300025960 Bacteria 1825
441 Ga0207651_10253605 3300025960 Bacteria 1441
442 Ga0207651_11818677 3300025960 Unclassified 548
443 Ga0207651_12094199 3300025960 Unclassified 508
444 Ga0207712_10049807 3300025961 Bacteria 2922
445 Ga0207712_10377087 3300025961 Unclassified 1186
446 Ga0207640_10701707 3300025981 Unclassified 868
447 Ga0207640_10806808 3300025981 Unclassified 813
448 Ga0207677_12277104 3300026023 Unclassified 504
449 Ga0207703_10110373 3300026035 Bacteria 2346
450 Ga0207703_10249186 3300026035 Bacteria 1600
451 Ga0207703_10654090 3300026035 Unclassified 997
452 Ga0207703_10721759 3300026035 Unclassified 948
453 Ga0207703_11314902 3300026035 Unclassified 695
454 Ga0207639_10352945 3300026041 Bacteria 1314
455 Ga0207639_10427793 3300026041 Unclassified 1198
456 Ga0207639_10569513 3300026041 Bacteria 1042
457 Ga0207639_11528397 3300026041 Unclassified 626
458 Ga0207678_11925005 3300026067 Unclassified 516
459 Ga0207708_10007271 3300026075 Bacteria 8186
460 Ga0207708_10011116 3300026075 Bacteria 6694
461 Ga0207708_10013926 3300026075 Bacteria 6010
462 Ga0207708_10060796 3300026075 Bacteria 2884
463 Ga0207708_10463190 3300026075 Unclassified 1057
464 Ga0207708_10533092 3300026075 Bacteria 988
465 Ga0207708_11021921 3300026075 Unclassified 719
466 Ga0207708_11282021 3300026075 Unclassified 642
467 Ga0207702_10941205 3300026078 Unclassified 856
468 Ga0207641_10213473 3300026088 Bacteria 1786
469 Ga0207641_11008544 3300026088 Unclassified 829
470 Ga0207648_10038219 3300026089 Unclassified 4224
471 Ga0207648_10141622 3300026089 Bacteria 2119
472 Ga0207676_10029453 3300026095 Bacteria 4111
473 Ga0207676_10119348 3300026095 Bacteria 2221
474 Ga0207676_10157665 3300026095 Bacteria 1963
475 Ga0207676_10908278 3300026095 Unclassified 864
476 Ga0207676_11524168 3300026095 Unclassified 666
477 Ga0207676_12032573 3300026095 Unclassified 573
478 Ga0207674_10315205 3300026116 Bacteria 1513
479 Ga0207674_10415197 3300026116 Bacteria 1300
480 Ga0207674_10827965 3300026116 Bacteria 893
481 Ga0207674_10867732 3300026116 Bacteria 870
482 Ga0207675_100004925 3300026118 Bacteria 12866
483 Ga0207675_100033919 3300026118 Bacteria 4757
484 Ga0207675_100198009 3300026118 Bacteria 1929
485 Ga0207675_100314388 3300026118 Bacteria 1528
486 Ga0207675_102350958 3300026118 Unclassified 546
487 Ga0207698_10059374 3300026142 Bacteria 2970
488 Ga0207698_10108922 3300026142 Unclassified 2317
489 Ga0207698_10517517 3300026142 Bacteria 1164
490 Ga0207698_10697257 3300026142 Bacteria 1010
491 Ga0207428_10009114 3300027907 Bacteria 8918
492 Ga0207428_10317884 3300027907 Bacteria 1150
493 Ga0207428_10465714 3300027907 Bacteria 920
494 Ga0268265_10130853 3300028380 Bacteria 2085
495 Ga0268265_10330102 3300028380 Bacteria 1385
496 Ga0268265_10566308 3300028380 Unclassified 1081
497 Ga0268265_11530429 3300028380 Bacteria 671
498 Ga0268265_12645694 3300028380 Unclassified 507
499 Ga0268264_10018563 3300028381 Bacteria 5688
500 Ga0268264_10037863 3300028381 Unclassified 3978
501 Ga0268264_10085847 3300028381 Bacteria 2702
502 Ga0268264_10111873 3300028381 Bacteria 2393
503 Ga0268264_10205298 3300028381 Bacteria 1805
504 Ga0268264_10525427 3300028381 Unclassified 1157
505 Ga0307408_100020418 3300031548 Unclassified 4472
506 Ga0307408_100056939 3300031548 Bacteria 2836
507 Ga0307405_10094246 3300031731 Bacteria 1991
508 Ga0307405_10310879 3300031731 Bacteria 1200
509 Ga0307405_10402491 3300031731 Bacteria 1072
510 Ga0307406_12092511 3300031901 Bacteria 507
511 Ga0307412_10445311 3300031911 Bacteria 1066
512 Ga0307412_11992516 3300031911 Unclassified 537
513 Ga0307409_100511129 3300031995 Unclassified 1172
514 Ga0307416_100154029 3300032002 Bacteria 2113
515 Ga0373940_0203802 3300035088 Unclassified 651
516 Ga0373940_0210349 3300035088 Bacteria 643
517 Ga0373949_0023288 3300035090 Bacteria 1433
518 Ga0373951_0005932 3300035091 Bacteria 2818
519 Ga0373932_0031318 3300035112 Unclassified 1481
520 Ga0373932_0094886 3300035112 Unclassified 963
521 Ga0373941_0047895 3300035115 Unclassified 1348
522 Ga0373942_0055598 3300035207 Bacteria 1121
523 Ga0373962_0289170 3300035242 Unclassified 579
524 Ga0395900_1890251 3300037418 Bacteria 507
525 Ga0395898_0261475 3300037466 Bacteria 1651
526 Ga0395901_0057928 3300038443 Bacteria 4030
527 Ga0242419_010744 3300038698 Unclassified 702
528 Ga0242422_00942 3300038699 Bacteria 1972
529 Ga0242420_018062 3300038996 Bacteria 1239
530 Ga0439444_0169562 3300042437 Unclassified 537
531 Ga0439464_0306757 3300042439 Bacteria 519
532 Ga0453683_1174825 3300044673 Unclassified 513
533 Ga0451576_0151703 3300045051 Bacteria 2417
534 Ga0451576_1495350 3300045051 Bacteria 702
535 Ga0495668_0709270 3300046616 Unclassified 557
536 Ga0495672_0250563 3300047320 Bacteria 860
537 Ga0496102_0282055 3300048905 Unclassified 1566
538 Ga0496102_1703867 3300048905 Unclassified 548
539 Ga0496106_0114494 3300048909 Bacteria 2103
540 Ga0496108_0310295 3300048911 Bacteria 1374
541 Ga0496108_0456919 3300048911 Unclassified 1116
542 Ga0496109_1453502 3300048912 Unclassified 621
543 Ga0496110_1783079 3300048913 Unclassified 526
544 Ga0496111_0499932 3300048914 Bacteria 895
545 Ga0496112_0180322 3300048915 Bacteria 2076
546 Ga0496112_0227223 3300048915 Bacteria 1821
547 Ga0496112_1005076 3300048915 Bacteria 754
548 Ga0496113_0048393 3300048916 Unclassified 3163
549 Ga0496113_0095979 3300048916 Unclassified 2292
550 Ga0496113_0697977 3300048916 Unclassified 810
551 Ga0501292_064993 3300049515 Bacteria 669
552 Ga0501296_052013 3300049519 Unclassified 602
553 Ga0501299_067394 3300049522 Bacteria 770
554 Ga0501032_0862530 3300049569 Bacteria 571
555 Ga0501048_0309837 3300049582 Bacteria 1124
556 Ga0501202_076767 3300049652 Unclassified 778
557 Ga0501206_040011 3300049653 Unclassified 721
558 Ga0501216_049192 3300049660 Bacteria 825
559 Ga0501217_054303 3300049661 Bacteria 1055
560 Ga0501217_110962 3300049661 Bacteria 788
561 Ga0501224_009400 3300049664 Bacteria 1430
562 Ga0501233_136026 3300049668 Unclassified 675
563 Ga0501235_043623 3300049669 Bacteria 1029
564 Ga0501247_005263 3300049677 Bacteria 1436
565 Ga0501249_026043 3300049679 Bacteria 1291
566 Ga0501249_088766 3300049679 Bacteria 731
567 Ga0501253_176272 3300049683 Unclassified 553
568 Ga0501221_247280 3300049704 Bacteria 511
569 Ga0501225_0080928 3300049705 Bacteria 933
570 Ga0501273_002090 3300049770 Bacteria 2002
571 Ga0501045_0214447 3300049824 Bacteria 1434
572 nmdc:mga05p37_192644_c1 3300050507 Bacteria 2474
573 nmdc:mga05p37_242537_c1 3300050507 Unclassified 2166
574 nmdc:mga05p37_562930_c1 3300050507 Unclassified 1295
575 nmdc:mga09592_1614361_c1 3300050508 Unclassified 525
576 nmdc:mga09592_288941_c1 3300050508 Unclassified 1422
577 nmdc:mga0qj67_441358_c1 3300050509 Unclassified 1049
578 nmdc:mga0qj67_546196_c1 3300050509 Unclassified 929
579 nmdc:mga0qj67_911608_c1 3300050509 Unclassified 692
580 nmdc:mga06r32_178955_c1 3300050510 Unclassified 2106
581 nmdc:mga08y16_116073_c1 3300050511 Unclassified 2787
582 nmdc:mga08y16_6584_c1 3300050511 Bacteria 12181
583 nmdc:mga08y16_692262_c1 3300050511 Bacteria 1020
584 nmdc:mga0n895_122706_c1 3300050512 Bacteria 2620
585 nmdc:mga0n895_1332921_c1 3300050512 Bacteria 688
586 nmdc:mga0n895_339898_c1 3300050512 Bacteria 1520
587 nmdc:mga0rr50_1548089_c1 3300050513 Unclassified 560
588 nmdc:mga08x19_11652_c1 3300050514 Bacteria 5293
589 nmdc:mga08x19_436744_c1 3300050514 Unclassified 920
590 nmdc:mga0a205_1036944_c1 3300050515 Bacteria 667
591 nmdc:mga0a205_1254990_c1 3300050515 Unclassified 589
592 nmdc:mga0a205_213594_c1 3300050515 Unclassified 1817
593 nmdc:mga0a205_253091_c1 3300050515 Bacteria 1640
594 nmdc:mga0a205_7821_c1 3300050515 Bacteria 6233
595 nmdc:mga0a205_93069_c1 3300050515 Bacteria 2912
596 Ga0501084_0154967 3300054114 Bacteria 1932
597 Ga0068853_100995115
598 MBSR1b_contig_7739576
599 JGI24736J21556_1049411
600 JGI24751J29686_10000178
601 JGI25406J46586_10090425
602 rootH2_10237336
603 rootL2_10307743
604 Ga0065704_10166589
605 Ga0065704_10181516
606 Ga0065712_10000866
607 Ga0065715_10011189
608 Ga0065715_10014582
609 Ga0065715_10024148
610 Ga0065715_10031349
611 Ga0065715_10040697
612 Ga0065715_10397165
613 Ga0065715_10584626
614 Ga0065715_10747897
615 Ga0065707_10001165
616 Ga0065707_10167754
617 Ga0070676_10366416
618 Ga0070676_10596919
619 Ga0070690_100244264
620 Ga0070690_100245645
621 Ga0070690_100628755
622 Ga0070670_100000114
623 Ga0070670_100080224
624 Ga0070670_100101162
625 Ga0070670_100355365
626 Ga0070670_100380931
627 Ga0070670_100569245
628 Ga0070677_10170602
629 Ga0068869_100246829
630 Ga0068869_100396899
631 Ga0068869_100553456
632 Ga0068869_100765094
633 Ga0070680_100560147
634 Ga0070680_101643033
635 Ga0070680_101653683
636 Ga0070682_100006649
637 Ga0070682_100020584
638 Ga0070682_100980848
639 Ga0070689_100333042
640 Ga0070689_100514978
641 Ga0070689_101182678
642 Ga0070691_10332880
643 Ga0070691_11020165
644 Ga0070687_100057537
645 Ga0070687_100697772
646 Ga0070687_101381119
647 Ga0070692_10001286
648 Ga0070692_10040371
649 Ga0070692_10062399
650 Ga0070692_10320914
651 Ga0070692_11218224
652 Ga0070669_100185925
653 Ga0070669_100279973
654 Ga0070669_101945309
655 Ga0070675_100272436
656 Ga0070675_100567640
657 Ga0070671_101070571
658 Ga0070673_100141943
659 Ga0070673_100226129
660 Ga0070673_102102441
661 Ga0070688_100221309
662 Ga0070688_101476672
663 Ga0070659_100118943
664 Ga0070659_101253226
665 Ga0070703_10341585
666 Ga0070701_10025182
667 Ga0070701_10097180
668 Ga0070701_11037683
669 Ga0070705_100017736
670 Ga0070705_100057917
671 Ga0070705_100474602
672 Ga0070705_100708195
673 Ga0070700_100011901
674 Ga0070700_100044215
675 Ga0070700_100060950
676 Ga0070700_100092581
677 Ga0070700_100123456
678 Ga0070700_100977619
679 Ga0070700_101747921
680 Ga0070694_100005508
681 Ga0070694_100013829
682 Ga0070694_100056821
683 Ga0070694_100119775
684 Ga0070694_100138754
685 Ga0070694_100535616
686 Ga0070694_100675832
687 Ga0070694_100713608
688 Ga0070662_100218945
689 Ga0070681_10003436
690 Ga0068867_100638837
691 Ga0068867_101067803
692 Ga0070706_100102504
693 Ga0070707_100154000
694 Ga0070707_100785500
695 Ga0070698_100069621
696 Ga0070698_100232844
697 Ga0070699_100178835
698 Ga0070699_101474068
699 Ga0070679_100019487
700 Ga0070679_100780455
701 Ga0070684_101186559
702 Ga0070697_100284240
703 Ga0070697_101551392
704 Ga0068853_100194983
705 Ga0068853_100412185
706 Ga0068853_101947369
707 Ga0070672_101174366
708 Ga0070686_100969042
709 Ga0070695_100014150
710 Ga0070695_100162485
711 Ga0070695_100260801
712 Ga0070695_100577264
713 Ga0070695_100918228
714 Ga0070695_101196087
715 Ga0070696_100099991
716 Ga0070696_100151232
717 Ga0070696_100585192
718 Ga0070696_100834573
719 Ga0070696_101244773
720 Ga0070693_100026260
721 Ga0070693_100259201
722 Ga0070693_100435221
723 Ga0070693_100483173
724 Ga0070693_101129173
725 Ga0070693_101463367
726 Ga0070693_101682797
727 Ga0070704_100109427
728 Ga0070704_100145474
729 Ga0070704_100213701
730 Ga0070704_100628665
731 Ga0070704_100784222
732 Ga0070704_101151863
733 Ga0070704_101290920
734 Ga0068855_101194559
735 Ga0068855_101380703
736 Ga0070664_100229222
737 Ga0070664_100424646
738 Ga0070664_100481685
739 Ga0070664_100772120
740 Ga0068857_100164592
741 Ga0068857_100177721
742 Ga0068857_100482662
743 Ga0068857_100497199
744 Ga0068857_101393948
745 Ga0068857_102466391
746 Ga0068854_100178983
747 Ga0068854_100384879
748 Ga0068854_101068987
749 Ga0068856_100802647
750 Ga0070702_100003763
751 Ga0070702_100052394
752 Ga0070702_100061978
753 Ga0070702_101350421
754 Ga0068852_100057667
755 Ga0068852_100086887
756 Ga0068852_100764667
757 Ga0068852_101461598
758 Ga0068859_100013761
759 Ga0068859_100036609
760 Ga0068859_100122442
761 Ga0068859_100164130
762 Ga0068859_100260803
763 Ga0068859_100269603
764 Ga0068859_100441567
765 Ga0068859_100485098
766 Ga0068859_100538225
767 Ga0068859_100889498
768 Ga0068859_101373187
769 Ga0068864_100002054
770 Ga0068864_100088536
771 Ga0068864_100353715
772 Ga0068864_100521709
773 Ga0068864_101115235
774 Ga0068866_10112990
775 Ga0068861_100002231
776 Ga0068861_100062327
777 Ga0068861_102523009
778 Ga0068851_10006507
779 Ga0068851_10959931
780 Ga0068870_10029151
781 Ga0068870_10144659
782 Ga0068870_10234394
783 Ga0068870_10422253
784 Ga0068870_10590776
785 Ga0068863_100352289
786 Ga0068863_100384120
787 Ga0068863_100997505
788 Ga0068863_101959622
789 Ga0068858_100140504
790 Ga0068858_100166056
791 Ga0068858_100425266
792 Ga0068858_100442041
793 Ga0068858_100449807
794 Ga0068858_100539698
795 Ga0068858_100559432
796 Ga0068858_101201218
797 Ga0068860_100039143
798 Ga0068860_100039260
799 Ga0068860_100093026
800 Ga0068860_100113698
801 Ga0068860_100424953
802 Ga0068862_100073922
803 Ga0068862_100207174
804 Ga0068862_100607341
805 Ga0068862_101586841
806 Ga0081539_10001697
807 Ga0075432_10420117
808 Ga0070716_100244350
809 Ga0070716_100612281
810 Ga0070716_100666687
811 Ga0070716_100956193
812 Ga0070712_101459417
813 Ga0097621_100006542
814 Ga0075428_100049079
815 Ga0075428_100252786
816 Ga0075430_100076761
817 Ga0075430_100080828
818 Ga0075430_100709603
819 Ga0075431_100068627
820 Ga0075431_100152160
821 Ga0075431_101999451
822 Ga0075433_10015946
823 Ga0075433_10164786
824 Ga0075433_10251714
825 Ga0075433_10706566
826 Ga0075433_11289472
827 Ga0075433_11778485
828 Ga0075434_100003211
829 Ga0075434_100385323
830 Ga0075434_100796029
831 Ga0075434_102611998
832 Ga0075429_100007029
833 Ga0075429_100046777
834 Ga0075429_100853181
835 Ga0068865_100234746
836 Ga0075436_100048447
837 Ga0075436_100456004
838 Ga0097620_100013760
839 Ga0097620_100036609
840 Ga0097620_100122453
841 Ga0097620_100164142
842 Ga0097620_100260795
843 Ga0097620_100269594
844 Ga0097620_100441588
845 Ga0097620_100485115
846 Ga0097620_100538220
847 Ga0097620_100889490
848 Ga0097620_101372874
849 Ga0075435_100006951
850 Ga0075435_101937349
851 Ga0105251_10228588
852 Ga0105250_10091802
853 Ga0105250_10306941
854 Ga0105240_10049705
855 Ga0105240_10153079
856 Ga0105240_10921803
857 Ga0111539_10005260
858 Ga0111539_10009029
859 Ga0111539_10069379
860 Ga0111539_10963868
861 Ga0105245_10614625
862 Ga0105245_11305279
863 Ga0105245_11966670
864 Ga0105247_10001363
865 Ga0105247_10275036
866 Ga0114129_10033109
867 Ga0114129_10138330
868 Ga0114129_10305551
869 Ga0105243_10070464
870 Ga0105243_10319643
871 Ga0105243_10648088
872 Ga0105243_10771603
873 Ga0105243_10890191
874 Ga0105243_11343061
875 Ga0105243_13132432
876 Ga0105241_10081182
877 Ga0105241_10119528
878 Ga0105241_10370691
879 Ga0105241_10530409
880 Ga0105241_10688434
881 Ga0105241_12308880
882 Ga0105242_10932017
883 Ga0105242_12735759
884 Ga0105242_12909135
885 Ga0105248_10151697
886 Ga0105248_10210457
887 Ga0105248_10467913
888 Ga0105248_10536775
889 Ga0105248_11441378
890 Ga0105248_11750918
891 Ga0105248_13032305
892 Ga0105237_10000767
893 Ga0105237_10253880
894 Ga0105237_10331236
895 Ga0105237_12459978
896 Ga0105238_10008398
897 Ga0105238_10008722
898 Ga0105238_10677241
899 Ga0105238_12604670
900 Ga0105249_10101283
901 Ga0105249_11234889
902 Ga0105249_13432961
903 Ga0105239_10194363
904 Ga0105239_10604883
905 Ga0105239_10838541
906 Ga0105239_11400553
907 Ga0105246_10036294
908 Ga0105246_11590629
909 Ga0157373_10008498
910 Ga0157373_10167383
911 Ga0157373_10187173
912 Ga0157373_10667231
913 Ga0157371_10247443
914 Ga0157371_10949539
915 Ga0157374_10864142
916 Ga0157374_11699157
917 Ga0157378_10466264
918 Ga0157378_10490316
919 Ga0157378_11937070
920 Ga0163162_10462934
921 Ga0163162_10565245
922 Ga0163162_11330480
923 Ga0163162_11715596
924 Ga0157372_10013334
925 Ga0157372_10271323
926 Ga0157372_10609253
927 Ga0157372_10834862
928 Ga0157372_11406776
929 Ga0157372_12105037
930 Ga0157372_12132228
931 Ga0157375_10006616
932 Ga0157375_10168492
933 Ga0157375_10332511
934 Ga0163163_10005030
935 Ga0163163_10005896
936 Ga0163163_10366422
937 Ga0163163_10760640
938 Ga0163163_11351414
939 Ga0163163_11938368
940 Ga0163163_12844158
941 Ga0157380_10321471
942 Ga0157380_11098267
943 Ga0157380_11357355
944 Ga0157377_10078425
945 Ga0157377_10340032
946 Ga0157379_10481828
947 Ga0157379_12286359
948 Ga0157379_12497018
949 Ga0163161_10386300
950 Ga0207697_10464113
951 Ga0207656_10008094
952 Ga0207656_10389244
953 Ga0207653_10025249
954 Ga0207653_10423488
955 Ga0207642_11068167
956 Ga0207710_10001253
957 Ga0207710_10691737
958 Ga0207688_10278675
959 Ga0207647_10033966
960 Ga0207647_10105967
961 Ga0207647_10116690
962 Ga0207647_10201765
963 Ga0207647_10227850
964 Ga0207699_10618971
965 Ga0207645_10302576
966 Ga0207645_10377186
967 Ga0207645_11050685
968 Ga0207643_10018925
969 Ga0207643_10021688
970 Ga0207643_10085706
971 Ga0207643_10262674
972 Ga0207643_10345747
973 Ga0207654_10058501
974 Ga0207654_10300024
975 Ga0207654_10399376
976 Ga0207654_11374829
977 Ga0207707_10018026
978 Ga0207707_10275143
979 Ga0207695_10097098
980 Ga0207695_10197734
981 Ga0207695_10381435
982 Ga0207671_10012031
983 Ga0207671_10426871
984 Ga0207660_10046359
985 Ga0207660_10978365
986 Ga0207660_11656643
987 Ga0207662_10331695
988 Ga0207662_10443916
989 Ga0207649_10363344
990 Ga0207649_10422225
991 Ga0207652_11253042
992 Ga0207646_10022463
993 Ga0207646_10526983
994 Ga0207681_10238093
995 Ga0207681_10370321
996 Ga0207694_10004349
997 Ga0207694_10033118
998 Ga0207650_10000022
999 Ga0207650_10140173
1000 Ga0207650_10163217
1001 Ga0207650_11629498
1002 Ga0207659_10288874
1003 Ga0207659_10674216
1004 Ga0207659_11516177
1005 Ga0207687_10337071
1006 Ga0207644_10382061
1007 Ga0207644_11540726
1008 Ga0207690_10078234
1009 Ga0207690_10182350
1010 Ga0207690_10537516
1011 Ga0207690_11761229
1012 Ga0207706_10207221
1013 Ga0207706_10207739
1014 Ga0207686_10037590
1015 Ga0207709_10040022
1016 Ga0207709_10339899
1017 Ga0207709_10693873
1018 Ga0207709_10749527
1019 Ga0207709_10850244
1020 Ga0207670_10675406
1021 Ga0207665_10293649
1022 Ga0207665_10942399
1023 Ga0207691_10788130
1024 Ga0207711_10249513
1025 Ga0207711_10628936
1026 Ga0207711_11202964
1027 Ga0207711_11233195
1028 Ga0207689_10182327
1029 Ga0207689_10300606
1030 Ga0207689_10491661
1031 Ga0207679_10153805
1032 Ga0207679_10189185
1033 Ga0207679_10217476
1034 Ga0207679_10227380
1035 Ga0207679_10312615
1036 Ga0207651_10147862
1037 Ga0207651_10253605
1038 Ga0207651_11818677
1039 Ga0207651_12094199
1040 Ga0207712_10049807
1041 Ga0207712_10377087
1042 Ga0207640_10701707
1043 Ga0207640_10806808
1044 Ga0207677_12277104
1045 Ga0207703_10110373
1046 Ga0207703_10249186
1047 Ga0207703_10654090
1048 Ga0207703_10721759
1049 Ga0207703_11314902
1050 Ga0207639_10352945
1051 Ga0207639_10427793
1052 Ga0207639_10569513
1053 Ga0207639_11528397
1054 Ga0207678_11925005
1055 Ga0207708_10007271
1056 Ga0207708_10011116
1057 Ga0207708_10013926
1058 Ga0207708_10060796
1059 Ga0207708_10463190
1060 Ga0207708_10533092
1061 Ga0207708_11021921
1062 Ga0207708_11282021
1063 Ga0207702_10941205
1064 Ga0207641_10213473
1065 Ga0207641_11008544
1066 Ga0207648_10038219
1067 Ga0207648_10141622
1068 Ga0207676_10029453
1069 Ga0207676_10119348
1070 Ga0207676_10157665
1071 Ga0207676_10908278
1072 Ga0207676_11524168
1073 Ga0207676_12032573
1074 Ga0207674_10315205
1075 Ga0207674_10415197
1076 Ga0207674_10827965
1077 Ga0207674_10867732
1078 Ga0207675_100004925
1079 Ga0207675_100033919
1080 Ga0207675_100198009
1081 Ga0207675_100314388
1082 Ga0207675_102350958
1083 Ga0207698_10059374
1084 Ga0207698_10108922
1085 Ga0207698_10517517
1086 Ga0207698_10697257
1087 Ga0207428_10009114
1088 Ga0207428_10317884
1089 Ga0207428_10465714
1090 Ga0268265_10130853
1091 Ga0268265_10330102
1092 Ga0268265_10566308
1093 Ga0268265_11530429
1094 Ga0268265_12645694
1095 Ga0268264_10018563
1096 Ga0268264_10037863
1097 Ga0268264_10085847
1098 Ga0268264_10111873
1099 Ga0268264_10205298
1100 Ga0268264_10525427
1101 Ga0307408_100020418
1102 Ga0307408_100056939
1103 Ga0307405_10094246
1104 Ga0307405_10310879
1105 Ga0307405_10402491
1106 Ga0307406_12092511
1107 Ga0307412_10445311
1108 Ga0307412_11992516
1109 Ga0307409_100511129
1110 Ga0307416_100154029
1111 Ga0373940_0203802
1112 Ga0373940_0210349
1113 Ga0373949_0023288
1114 Ga0373951_0005932
1115 Ga0373932_0031318
1116 Ga0373932_0094886
1117 Ga0373941_0047895
1118 Ga0373942_0055598
1119 Ga0373962_0289170
1120 Ga0395900_1890251
1121 Ga0395898_0261475
1122 Ga0395901_0057928
1123 Ga0242419_010744
1124 Ga0242422_00942
1125 Ga0242420_018062
1126 Ga0439444_0169562
1127 Ga0439464_0306757
1128 Ga0453683_1174825
1129 Ga0451576_0151703
1130 Ga0451576_1495350
1131 Ga0495668_0709270
1132 Ga0495672_0250563
1133 Ga0496102_0282055
1134 Ga0496102_1703867
1135 Ga0496106_0114494
1136 Ga0496108_0310295
1137 Ga0496108_0456919
1138 Ga0496109_1453502
1139 Ga0496110_1783079
1140 Ga0496111_0499932
1141 Ga0496112_0180322
1142 Ga0496112_0227223
1143 Ga0496112_1005076
1144 Ga0496113_0048393
1145 Ga0496113_0095979
1146 Ga0496113_0697977
1147 Ga0501292_064993
1148 Ga0501296_052013
1149 Ga0501299_067394
1150 Ga0501032_0862530
1151 Ga0501048_0309837
1152 Ga0501202_076767
1153 Ga0501206_040011
1154 Ga0501216_049192
1155 Ga0501217_054303
1156 Ga0501217_110962
1157 Ga0501224_009400
1158 Ga0501233_136026
1159 Ga0501235_043623
1160 Ga0501247_005263
1161 Ga0501249_026043
1162 Ga0501249_088766
1163 Ga0501253_176272
1164 Ga0501221_247280
1165 Ga0501225_0080928
1166 Ga0501273_002090
1167 Ga0501045_0214447
1168 nmdc:mga05p37_192644_c1
1169 nmdc:mga05p37_242537_c1
1170 nmdc:mga05p37_562930_c1
1171 nmdc:mga09592_1614361_c1
1172 nmdc:mga09592_288941_c1
1173 nmdc:mga0qj67_441358_c1
1174 nmdc:mga0qj67_546196_c1
1175 nmdc:mga0qj67_911608_c1
1176 nmdc:mga06r32_178955_c1
1177 nmdc:mga08y16_116073_c1
1178 nmdc:mga08y16_6584_c1
1179 nmdc:mga08y16_692262_c1
1180 nmdc:mga0n895_122706_c1
1181 nmdc:mga0n895_1332921_c1
1182 nmdc:mga0n895_339898_c1
1183 nmdc:mga0rr50_1548089_c1
1184 nmdc:mga08x19_11652_c1
1185 nmdc:mga08x19_436744_c1
1186 nmdc:mga0a205_1036944_c1
1187 nmdc:mga0a205_1254990_c1
1188 nmdc:mga0a205_213594_c1
1189 nmdc:mga0a205_253091_c1
1190 nmdc:mga0a205_7821_c1
1191 nmdc:mga0a205_93069_c1
1192 Ga0501084_0154967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4q-assembly1.cif.gz_B crystal structure of the sec-ph domain of the human neurofibromatosis type 1 protein 0.7274 13 68
3zdt-assembly2.cif.gz_B crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a 0.7246 16 62
4cye-assembly1.cif.gz_A crystal structure of avian fak ferm domain fak31-405 at 3.2a 0.7199 16 62
3peg-assembly1.cif.gz_A crystal structure of neurofibromins sec14-ph module containing a patient derived duplication (td) 0.7157 13 68
4ny0-assembly2.cif.gz_A crystal structure of ferm domain of human focal adhesion kinase 0.7133 16 62
ID Description Score Start End Superfamily
af_Q4DQB8_165_278_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7119 14 68 2.30.29.30
af_O43038_2_109_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7117 2 46 2.30.29.30
af_Q4DEP3_15_153_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7032 10 68 2.30.29.30
6cb0B03 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.697 16 62 2.30.29.30
af_Q60F73_533_635_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6949 9 67 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A838PEC1-F1-model_v4 Uncharacterized protein 0.9716 1 68
AF-A0A838PEC1-F1-model_v4 Uncharacterized protein 0.9445 1 68
AF-A0A6V8EMD7-F1-model_v4 Uncharacterized protein 0.8157 3 68
AF-A0A359CAD3-F1-model_v4 FERM domain-containing protein 0.8084 12 68 GO:0016020
AF-A0A0E3ZEE2-F1-model_v4 Lipoprotein 0.8038 13 69

Map