F467440

General Info

Members Datasets Scaffolds Average Seq Length
595 270 1190 115

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10708189|Ga0157380_107081892
Length 140
Sequence MAGGHAGPAQPVRSGYTDLFYERLLVVAVVWQLTIHENSTEQFERFYGADGEWTQLSRRSRSFLGSSFLRDLATPTRYLLVEYWSEMLVYEKHTADFDAQIKALEERRQEFTASVESLGLFSALDVPSRVGPTWSRRSGV

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
169 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
170 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
171 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
172 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
173 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
174 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
175 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
204 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
205 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
206 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
207 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
208 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
228 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
229 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
230 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
231 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
234 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
235 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
236 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
241 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
242 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
243 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
244 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 0
Rhizoplane 4.54
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 24.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10708189 3300014326 Bacteria 1013
2 JGI24748J21848_1016042 3300002074 Unclassified 894
3 JGI24744J21845_10034457 3300002077 Unclassified 960
4 JGI24742J22300_10082540 3300002244 Unclassified 609
5 Ga0058859_11185663 3300004798 Bacteria 704
6 Ga0058860_11686437 3300004801 Unclassified 560
7 Ga0065714_10090209 3300005288 Bacteria 1952
8 Ga0065714_10099833 3300005288 Bacteria 1678
9 Ga0065712_10000519 3300005290 Bacteria 11663
10 Ga0065712_10069421 3300005290 Bacteria 7332
11 Ga0065712_10316481 3300005290 Bacteria 831
12 Ga0065712_10523977 3300005290 Bacteria 634
13 Ga0065715_10091032 3300005293 Bacteria 6194
14 Ga0065715_10095576 3300005293 Bacteria 4054
15 Ga0065715_10172797 3300005293 Bacteria 1534
16 Ga0065707_10648364 3300005295 Unclassified 664
17 Ga0070683_100000305 3300005329 Bacteria 33656
18 Ga0070683_100114729 3300005329 Bacteria 2543
19 Ga0070690_100087325 3300005330 Bacteria 2048
20 Ga0070690_100301499 3300005330 Bacteria 1149
21 Ga0070670_100022375 3300005331 Bacteria 5441
22 Ga0070670_100044085 3300005331 Unclassified 3835
23 Ga0070677_10104259 3300005333 Bacteria 1256
24 Ga0070677_10353574 3300005333 Bacteria 762
25 Ga0068869_101307728 3300005334 Unclassified 640
26 Ga0070666_10108080 3300005335 Unclassified 1922
27 Ga0070666_10196085 3300005335 Bacteria 1420
28 Ga0068868_100036422 3300005338 Bacteria 3808
29 Ga0068868_100830992 3300005338 Unclassified 835
30 Ga0070660_100783816 3300005339 Unclassified 801
31 Ga0070689_100233366 3300005340 Bacteria 1513
32 Ga0070687_100136594 3300005343 Unclassified 1422
33 Ga0070661_100004814 3300005344 Bacteria 9293
34 Ga0070692_10319424 3300005345 Bacteria 954
35 Ga0070668_100232072 3300005347 Bacteria 1526
36 Ga0070668_100664625 3300005347 Unclassified 916
37 Ga0070668_101086038 3300005347 Unclassified 722
38 Ga0070669_100319293 3300005353 Bacteria 1254
39 Ga0070669_101640185 3300005353 Bacteria 560
40 Ga0070669_101838360 3300005353 Bacteria 529
41 Ga0070675_100014408 3300005354 Bacteria 6234
42 Ga0070675_100023191 3300005354 Bacteria 4959
43 Ga0070675_100099666 3300005354 Bacteria 2446
44 Ga0070675_100338759 3300005354 Bacteria 1332
45 Ga0070675_100384396 3300005354 Bacteria 1250
46 Ga0070675_101877651 3300005354 Bacteria 553
47 Ga0070675_102001353 3300005354 Bacteria 534
48 Ga0070671_100075164 3300005355 Bacteria 2822
49 Ga0070671_100090678 3300005355 Bacteria 2559
50 Ga0070671_100251032 3300005355 Bacteria 1503
51 Ga0070671_100385789 3300005355 Bacteria 1197
52 Ga0070671_100464103 3300005355 Unclassified 1087
53 Ga0070674_100062272 3300005356 Bacteria 2607
54 Ga0070674_100143719 3300005356 Bacteria 1793
55 Ga0070674_100284476 3300005356 Bacteria 1312
56 Ga0070674_100875755 3300005356 Unclassified 781
57 Ga0070673_100034343 3300005364 Bacteria 3837
58 Ga0070673_100036240 3300005364 Bacteria 3747
59 Ga0070673_100073457 3300005364 Bacteria 2753
60 Ga0070673_100279122 3300005364 Bacteria 1465
61 Ga0070673_100546011 3300005364 Unclassified 1052
62 Ga0070673_100552996 3300005364 Unclassified 1046
63 Ga0070673_100818375 3300005364 Bacteria 861
64 Ga0070673_100969535 3300005364 Bacteria 791
65 Ga0070688_100004342 3300005365 Bacteria 7373
66 Ga0070659_100603573 3300005366 Bacteria 943
67 Ga0070667_100172676 3300005367 Bacteria 1909
68 Ga0070667_100251845 3300005367 Unclassified 1579
69 Ga0070667_100579553 3300005367 Bacteria 1033
70 Ga0070709_10473623 3300005434 Unclassified 947
71 Ga0070705_100853707 3300005440 Bacteria 729
72 Ga0070705_101491585 3300005440 Bacteria 566
73 Ga0070700_100748098 3300005441 Unclassified 782
74 Ga0070663_100139563 3300005455 Bacteria 1849
75 Ga0070663_100178717 3300005455 Bacteria 1645
76 Ga0070663_100308392 3300005455 Bacteria 1269
77 Ga0070663_100823280 3300005455 Unclassified 797
78 Ga0070663_101008342 3300005455 Bacteria 724
79 Ga0070663_101723007 3300005455 Bacteria 560
80 Ga0070678_100109572 3300005456 Bacteria 2157
81 Ga0070678_100111195 3300005456 Bacteria 2144
82 Ga0070678_100119759 3300005456 Bacteria 2074
83 Ga0070678_100128547 3300005456 Bacteria 2009
84 Ga0070678_100226060 3300005456 Unclassified 1558
85 Ga0070678_100249552 3300005456 Bacteria 1487
86 Ga0070678_100622400 3300005456 Bacteria 966
87 Ga0070678_101194021 3300005456 Unclassified 705
88 Ga0070662_100042512 3300005457 Bacteria 3246
89 Ga0070662_100308627 3300005457 Bacteria 1287
90 Ga0070662_100730903 3300005457 Bacteria 839
91 Ga0070662_101474048 3300005457 Bacteria 587
92 Ga0068867_100912664 3300005459 Bacteria 791
93 Ga0068867_101879811 3300005459 Unclassified 564
94 Ga0070685_10044720 3300005466 Bacteria 2536
95 Ga0070684_100000992 3300005535 Bacteria 20265
96 Ga0070697_101516224 3300005536 Bacteria 599
97 Ga0070672_100070570 3300005543 Bacteria 2776
98 Ga0070672_100148207 3300005543 Bacteria 1940
99 Ga0070672_100225286 3300005543 Bacteria 1573
100 Ga0070672_100737105 3300005543 Unclassified 864
101 Ga0070672_101969152 3300005543 Unclassified 526
102 Ga0070686_100474408 3300005544 Bacteria 966
103 Ga0070686_100737940 3300005544 Bacteria 789
104 Ga0070665_100522290 3300005548 Bacteria 1199
105 Ga0070665_100633255 3300005548 Bacteria 1082
106 Ga0070664_100000885 3300005564 Bacteria 23252
107 Ga0070664_100105570 3300005564 Bacteria 2453
108 Ga0068857_100050070 3300005577 Bacteria 3706
109 Ga0068857_101062735 3300005577 Bacteria 781
110 Ga0068857_101636315 3300005577 Unclassified 629
111 Ga0068856_100851184 3300005614 Bacteria 931
112 Ga0070702_100717556 3300005615 Bacteria 764
113 Ga0070702_101188756 3300005615 Bacteria 614
114 Ga0068852_100936295 3300005616 Bacteria 884
115 Ga0068859_100177414 3300005617 Bacteria 2212
116 Ga0068864_100031052 3300005618 Bacteria 4531
117 Ga0068864_100284833 3300005618 Bacteria 1543
118 Ga0068864_101730915 3300005618 Bacteria 630
119 Ga0068866_10227941 3300005718 Bacteria 1128
120 Ga0068861_102074314 3300005719 Unclassified 568
121 Ga0068861_102116088 3300005719 Bacteria 563
122 Ga0068851_10062112 3300005834 Bacteria 1916
123 Ga0068851_10570608 3300005834 Bacteria 686
124 Ga0068870_10385406 3300005840 Unclassified 908
125 Ga0068863_100284369 3300005841 Bacteria 1603
126 Ga0068863_100937856 3300005841 Bacteria 867
127 Ga0068858_101123532 3300005842 Bacteria 772
128 Ga0068862_100031760 3300005844 Bacteria 4460
129 Ga0068862_101129383 3300005844 Bacteria 780
130 Ga0068862_102483021 3300005844 Unclassified 530
131 Ga0070717_10975814 3300006028 Bacteria 771
132 Ga0075365_10066304 3300006038 Unclassified 2422
133 Ga0075368_10076267 3300006042 Bacteria 1360
134 Ga0075363_100032182 3300006048 Bacteria 2723
135 Ga0075364_10095715 3300006051 Bacteria 1974
136 Ga0075364_10161566 3300006051 Unclassified 1512
137 Ga0075364_10185037 3300006051 Bacteria 1410
138 Ga0075364_10231101 3300006051 Bacteria 1256
139 Ga0070715_10401513 3300006163 Unclassified 762
140 Ga0075362_10137022 3300006177 Bacteria 1168
141 Ga0075367_10041635 3300006178 Bacteria 2686
142 Ga0075367_10121333 3300006178 Bacteria 1611
143 Ga0075367_10142331 3300006178 Bacteria 1486
144 Ga0075367_10172707 3300006178 Bacteria 1346
145 Ga0075367_10566189 3300006178 Bacteria 722
146 Ga0075367_10678649 3300006178 Bacteria 655
147 Ga0075367_10930440 3300006178 Bacteria 555
148 Ga0075369_10207532 3300006186 Bacteria 905
149 Ga0075366_10015168 3300006195 Bacteria 4412
150 Ga0075366_10371710 3300006195 Bacteria 879
151 Ga0075366_10604529 3300006195 Bacteria 680
152 Ga0097621_100666203 3300006237 Bacteria 956
153 Ga0075370_10009347 3300006353 Bacteria 5087
154 Ga0068871_100249304 3300006358 Bacteria 1546
155 Ga0075428_100003040 3300006844 Bacteria 18312
156 Ga0075428_100017702 3300006844 Bacteria 7874
157 Ga0075428_100018567 3300006844 Bacteria 7687
158 Ga0075428_100275018 3300006844 Bacteria 1812
159 Ga0075428_101557345 3300006844 Bacteria 692
160 Ga0075430_100006775 3300006846 Bacteria 9659
161 Ga0075430_100008697 3300006846 Bacteria 8567
162 Ga0075430_100014488 3300006846 Bacteria 6716
163 Ga0075430_100398483 3300006846 Bacteria 1136
164 Ga0075430_100722410 3300006846 Unclassified 821
165 Ga0075431_100005339 3300006847 Bacteria 12676
166 Ga0075431_100032453 3300006847 Bacteria 5381
167 Ga0075431_100043880 3300006847 Bacteria 4612
168 Ga0075431_100112948 3300006847 Bacteria 2804
169 Ga0075431_100418491 3300006847 Archaea 1339
170 Ga0075431_100663235 3300006847 Bacteria 1023
171 Ga0075431_101338451 3300006847 Unclassified 677
172 Ga0075431_101359448 3300006847 Bacteria 670
173 Ga0075433_10132992 3300006852 Bacteria 2210
174 Ga0075433_10932721 3300006852 Unclassified 757
175 Ga0075429_100005028 3300006880 Bacteria 11384
176 Ga0075429_100145064 3300006880 Bacteria 2078
177 Ga0075429_100271185 3300006880 Bacteria 1486
178 Ga0068865_100371951 3300006881 Bacteria 1163
179 Ga0097620_100177414 3300006931 Bacteria 2212
180 Ga0111539_10000984 3300009094 Bacteria 37322
181 Ga0111539_10540259 3300009094 Bacteria 1358
182 Ga0111539_10697355 3300009094 Unclassified 1182
183 Ga0111539_10898597 3300009094 Bacteria 1030
184 Ga0111539_11049650 3300009094 Bacteria 947
185 Ga0111539_11254362 3300009094 Bacteria 860
186 Ga0111539_11528385 3300009094 Unclassified 774
187 Ga0105245_11267645 3300009098 Bacteria 786
188 Ga0105245_12002693 3300009098 Unclassified 633
189 Ga0105245_12323508 3300009098 Unclassified 590
190 Ga0105247_10134132 3300009101 Unclassified 1616
191 Ga0114129_10000348 3300009147 Bacteria 53953
192 Ga0114129_10001069 3300009147 Bacteria 36016
193 Ga0114129_10040984 3300009147 Bacteria 6526
194 Ga0114129_10054774 3300009147 Bacteria 5591
195 Ga0114129_10117379 3300009147 Bacteria 3667
196 Ga0114129_10158118 3300009147 Bacteria 3098
197 Ga0114129_11054300 3300009147 Bacteria 1020
198 Ga0105243_10738122 3300009148 Bacteria 964
199 Ga0105243_11851042 3300009148 Bacteria 635
200 Ga0105243_12433458 3300009148 Bacteria 562
201 Ga0105241_10210319 3300009174 Bacteria 1629
202 Ga0105241_12373678 3300009174 Unclassified 529
203 Ga0105242_11340100 3300009176 Bacteria 741
204 Ga0105248_10006242 3300009177 Bacteria 13064
205 Ga0105248_10046850 3300009177 Bacteria 4847
206 Ga0105248_10213149 3300009177 Bacteria 2176
207 Ga0105248_10299113 3300009177 Bacteria 1812
208 Ga0105248_10659398 3300009177 Bacteria 1180
209 Ga0105248_11102317 3300009177 Unclassified 897
210 Ga0105248_11446177 3300009177 Bacteria 778
211 Ga0105237_10137648 3300009545 Unclassified 2436
212 Ga0105238_10276403 3300009551 Bacteria 1660
213 Ga0105249_10051693 3300009553 Bacteria 3750
214 Ga0105249_10750393 3300009553 Unclassified 1038
215 Ga0105239_10702230 3300010375 Bacteria 1156
216 Ga0105239_11245335 3300010375 Bacteria 858
217 Ga0105246_10061277 3300011119 Bacteria 2617
218 Ga0157374_10018496 3300013296 Bacteria 6151
219 Ga0157374_10483617 3300013296 Bacteria 1241
220 Ga0157378_10805272 3300013297 Bacteria 965
221 Ga0163162_10098113 3300013306 Bacteria 3019
222 Ga0157375_10380617 3300013308 Bacteria 1578
223 Ga0157375_11813370 3300013308 Unclassified 723
224 Ga0163163_10050230 3300014325 Bacteria 4107
225 Ga0163163_10223005 3300014325 Bacteria 1934
226 Ga0163163_10276441 3300014325 Bacteria 1731
227 Ga0163163_10362344 3300014325 Unclassified 1506
228 Ga0163163_10911228 3300014325 Unclassified 942
229 Ga0163163_11789052 3300014325 Bacteria 675
230 Ga0157380_10179368 3300014326 Bacteria 1859
231 Ga0157380_10195281 3300014326 Bacteria 1791
232 Ga0157380_10275684 3300014326 Unclassified 1536
233 Ga0157380_10656219 3300014326 Bacteria 1047
234 Ga0157380_13050154 3300014326 Bacteria 534
235 Ga0157379_10152190 3300014968 Bacteria 2087
236 Ga0157376_10189559 3300014969 Bacteria 1885
237 Ga0157376_10576692 3300014969 Bacteria 1117
238 Ga0157376_10820160 3300014969 Bacteria 944
239 Ga0157376_10844935 3300014969 Unclassified 931
240 Ga0157376_11383607 3300014969 Bacteria 735
241 Ga0157376_12277364 3300014969 Bacteria 581
242 Ga0163161_10312745 3300017792 Bacteria 1240
243 Ga0163161_10839766 3300017792 Unclassified 774
244 Ga0207673_1008787 3300025290 Unclassified 1284
245 Ga0207697_10018774 3300025315 Bacteria 2834
246 Ga0207697_10029497 3300025315 Bacteria 2245
247 Ga0207697_10364813 3300025315 Unclassified 641
248 Ga0207697_10401395 3300025315 Bacteria 609
249 Ga0207642_10483427 3300025899 Unclassified 756
250 Ga0207688_10119062 3300025901 Bacteria 1539
251 Ga0207688_10207398 3300025901 Bacteria 1177
252 Ga0207688_10224016 3300025901 Unclassified 1133
253 Ga0207688_10473037 3300025901 Bacteria 783
254 Ga0207688_10594449 3300025901 Bacteria 697
255 Ga0207680_10107977 3300025903 Bacteria 1800
256 Ga0207643_10634627 3300025908 Bacteria 689
257 Ga0207654_10948165 3300025911 Unclassified 625
258 Ga0207671_10070359 3300025914 Unclassified 2608
259 Ga0207660_10712279 3300025917 Bacteria 819
260 Ga0207662_10190651 3300025918 Bacteria 1323
261 Ga0207649_10028677 3300025920 Bacteria 3279
262 Ga0207649_10617528 3300025920 Bacteria 835
263 Ga0207681_10062922 3300025923 Bacteria 2557
264 Ga0207681_10618417 3300025923 Bacteria 896
265 Ga0207681_11401088 3300025923 Bacteria 587
266 Ga0207694_10525281 3300025924 Bacteria 992
267 Ga0207650_10061493 3300025925 Bacteria 2804
268 Ga0207650_10105514 3300025925 Unclassified 2175
269 Ga0207650_10106718 3300025925 Bacteria 2163
270 Ga0207650_10161661 3300025925 Bacteria 1775
271 Ga0207650_10417734 3300025925 Unclassified 1112
272 Ga0207659_10101764 3300025926 Bacteria 2167
273 Ga0207659_10152119 3300025926 Bacteria 1808
274 Ga0207659_10555388 3300025926 Bacteria 976
275 Ga0207659_10799011 3300025926 Bacteria 810
276 Ga0207659_11664919 3300025926 Unclassified 544
277 Ga0207687_11106656 3300025927 Bacteria 680
278 Ga0207644_10081299 3300025931 Bacteria 2394
279 Ga0207644_10349565 3300025931 Bacteria 1200
280 Ga0207644_11431287 3300025931 Unclassified 580
281 Ga0207706_10027446 3300025933 Bacteria 5090
282 Ga0207706_10040774 3300025933 Bacteria 4115
283 Ga0207706_10356497 3300025933 Bacteria 1271
284 Ga0207706_10416931 3300025933 Unclassified 1163
285 Ga0207670_10197038 3300025936 Bacteria 1528
286 Ga0207669_10074890 3300025937 Bacteria 2143
287 Ga0207669_10298360 3300025937 Bacteria 1223
288 Ga0207669_10299699 3300025937 Bacteria 1221
289 Ga0207691_10059985 3300025940 Bacteria 3458
290 Ga0207691_10071027 3300025940 Bacteria 3143
291 Ga0207691_10096459 3300025940 Bacteria 2644
292 Ga0207691_10686801 3300025940 Unclassified 864
293 Ga0207691_11191124 3300025940 Unclassified 632
294 Ga0207711_10032889 3300025941 Bacteria 4386
295 Ga0207711_10147263 3300025941 Bacteria 2122
296 Ga0207711_10247967 3300025941 Bacteria 1634
297 Ga0207711_10746706 3300025941 Bacteria 912
298 Ga0207711_11141758 3300025941 Unclassified 720
299 Ga0207711_11589472 3300025941 Bacteria 597
300 Ga0207689_10861796 3300025942 Unclassified 764
301 Ga0207661_10000649 3300025944 Bacteria 22461
302 Ga0207661_10849585 3300025944 Bacteria 840
303 Ga0207679_10000643 3300025945 Bacteria 23321
304 Ga0207651_10027376 3300025960 Bacteria 3580
305 Ga0207651_10036765 3300025960 Bacteria 3201
306 Ga0207651_10435102 3300025960 Bacteria 1122
307 Ga0207651_10987019 3300025960 Bacteria 752
308 Ga0207651_11223704 3300025960 Unclassified 674
309 Ga0207712_10018095 3300025961 Bacteria 4585
310 Ga0207668_10106831 3300025972 Bacteria 2092
311 Ga0207640_11877597 3300025981 Unclassified 542
312 Ga0207658_10180808 3300025986 Unclassified 1745
313 Ga0207658_10691084 3300025986 Bacteria 922
314 Ga0207658_10794477 3300025986 Bacteria 859
315 Ga0207703_11400813 3300026035 Unclassified 672
316 Ga0207678_10032017 3300026067 Bacteria 4584
317 Ga0207678_10090445 3300026067 Bacteria 2616
318 Ga0207678_10543817 3300026067 Bacteria 1015
319 Ga0207678_10609886 3300026067 Unclassified 957
320 Ga0207678_10779185 3300026067 Bacteria 844
321 Ga0207708_10412907 3300026075 Bacteria 1118
322 Ga0207641_10121766 3300026088 Bacteria 2329
323 Ga0207641_10717945 3300026088 Bacteria 985
324 Ga0207648_10040919 3300026089 Bacteria 4070
325 Ga0207648_10820300 3300026089 Bacteria 867
326 Ga0207648_10946844 3300026089 Bacteria 805
327 Ga0207648_11731878 3300026089 Bacteria 586
328 Ga0207676_10047470 3300026095 Bacteria 3328
329 Ga0207676_10239547 3300026095 Bacteria 1627
330 Ga0207676_12059817 3300026095 Bacteria 569
331 Ga0207674_10078679 3300026116 Bacteria 3302
332 Ga0207674_11033966 3300026116 Bacteria 791
333 Ga0207675_100110828 3300026118 Bacteria 2589
334 Ga0207675_100318743 3300026118 Unclassified 1517
335 Ga0207683_10023056 3300026121 Bacteria 5350
336 Ga0207683_10082025 3300026121 Bacteria 2864
337 Ga0207683_10410229 3300026121 Bacteria 1247
338 Ga0207683_10612314 3300026121 Unclassified 1008
339 Ga0207683_11071554 3300026121 Unclassified 748
340 Ga0207698_12730313 3300026142 Unclassified 502
341 Ga0209971_1048177 3300027682 Unclassified 1029
342 Ga0209813_10008695 3300027866 Bacteria 2574
343 Ga0209813_10056802 3300027866 Bacteria 1240
344 Ga0207428_10002134 3300027907 Bacteria 19881
345 Ga0207428_10513933 3300027907 Bacteria 869
346 Ga0268266_10132507 3300028379 Bacteria 2230
347 Ga0268266_10297325 3300028379 Bacteria 1505
348 Ga0268266_10349365 3300028379 Unclassified 1389
349 Ga0268266_10435219 3300028379 Unclassified 1245
350 Ga0268265_10087414 3300028380 Bacteria 2480
351 Ga0268265_10117714 3300028380 Bacteria 2183
352 Ga0268264_11004042 3300028381 Bacteria 841
353 Ga0307408_100041858 3300031548 Unclassified 3249
354 Ga0307408_100059785 3300031548 Bacteria 2775
355 Ga0307408_100060836 3300031548 Bacteria 2754
356 Ga0307408_100098339 3300031548 Bacteria 2224
357 Ga0307408_100356068 3300031548 Bacteria 1243
358 Ga0307408_102006374 3300031548 Unclassified 556
359 Ga0307408_102481881 3300031548 Unclassified 504
360 Ga0307405_10117209 3300031731 Bacteria 1815
361 Ga0307405_10136333 3300031731 Unclassified 1704
362 Ga0307405_10145725 3300031731 Unclassified 1658
363 Ga0307405_10306672 3300031731 Unclassified 1207
364 Ga0307413_10822401 3300031824 Unclassified 782
365 Ga0307410_10210866 3300031852 Bacteria 1488
366 Ga0307410_10441399 3300031852 Bacteria 1060
367 Ga0307410_10668707 3300031852 Unclassified 873
368 Ga0307410_10770983 3300031852 Unclassified 816
369 Ga0307406_10619537 3300031901 Unclassified 894
370 Ga0307406_10740362 3300031901 Unclassified 824
371 Ga0307406_11190472 3300031901 Unclassified 661
372 Ga0307406_11325477 3300031901 Bacteria 629
373 Ga0307407_10063749 3300031903 Unclassified 2163
374 Ga0307407_10749343 3300031903 Bacteria 739
375 Ga0307412_10257460 3300031911 Bacteria 1358
376 Ga0307409_100067151 3300031995 Bacteria 2831
377 Ga0307409_100782401 3300031995 Unclassified 960
378 Ga0307416_100023274 3300032002 Bacteria 4492
379 Ga0307416_100094635 3300032002 Bacteria 2577
380 Ga0307416_100126739 3300032002 Bacteria 2288
381 Ga0307416_100133191 3300032002 Bacteria 2242
382 Ga0307416_100296490 3300032002 Bacteria 1604
383 Ga0307416_100346316 3300032002 Unclassified 1501
384 Ga0307416_100800135 3300032002 Bacteria 1038
385 Ga0307416_101836381 3300032002 Bacteria 710
386 Ga0307414_11002045 3300032004 Bacteria 769
387 Ga0307411_10074107 3300032005 Unclassified 2318
388 Ga0307411_10103781 3300032005 Bacteria 2017
389 Ga0307411_10118048 3300032005 Unclassified 1913
390 Ga0307411_10504622 3300032005 Bacteria 1023
391 Ga0307411_11353857 3300032005 Bacteria 650
392 Ga0307415_100028678 3300032126 Bacteria 3545
393 Ga0307415_100212946 3300032126 Bacteria 1543
394 Ga0373958_0092644 3300034819 Bacteria 699
395 Ga0373943_0477984 3300035170 Bacteria 726
396 Ga0373955_0651235 3300035172 Unclassified 646
397 Ga0373947_0054856 3300035725 Bacteria 2406
398 Ga0373937_0002803 3300036401 Bacteria 14565
399 Ga0451793_0459136 3300041452 Unclassified 818
400 Ga0451807_0980505 3300041486 Unclassified 598
401 Ga0451853_1850163 3300041512 Bacteria 586
402 Ga0439437_022272 3300042000 Bacteria 771
403 Ga0439449_0264640 3300042007 Unclassified 647
404 Ga0439450_023695 3300042008 Bacteria 1333
405 Ga0450920_065329 3300042122 Bacteria 737
406 Ga0450923_141761 3300042125 Bacteria 578
407 Ga0450897_002484 3300042128 Bacteria 1389
408 Ga0450897_050593 3300042128 Unclassified 501
409 Ga0450895_000737 3300042132 Bacteria 2042
410 Ga0450896_000294 3300042133 Bacteria 4690
411 Ga0450896_014268 3300042133 Bacteria 1133
412 Ga0450899_033466 3300042135 Bacteria 630
413 Ga0450906_018485 3300042145 Bacteria 1251
414 Ga0450908_004279 3300042184 Bacteria 2755
415 Ga0439435_0004054 3300042436 Bacteria 3119
416 Ga0439444_0027998 3300042437 Bacteria 1041
417 Ga0439464_0000717 3300042439 Bacteria 7183
418 Ga0439460_0016836 3300042461 Unclassified 1952
419 Ga0439460_0068508 3300042461 Bacteria 1095
420 Ga0450918_013134 3300042531 Bacteria 1441
421 Ga0450918_054364 3300042531 Bacteria 732
422 Ga0451577_1052693 3300042876 Unclassified 729
423 Ga0495603_0641397 3300046455 Unclassified 608
424 Ga0495629_0159154 3300046459 Unclassified 1569
425 Ga0495606_0538455 3300046507 Bacteria 583
426 Ga0495608_0711874 3300046511 Unclassified 597
427 Ga0495646_0693565 3300046680 Unclassified 512
428 Ga0495647_0060552 3300046681 Bacteria 1493
429 Ga0495680_0816071 3300047322 Bacteria 608
430 Ga0495684_0647564 3300047471 Unclassified 707
431 Ga0496100_0308507 3300048903 Bacteria 1186
432 Ga0496100_0614818 3300048903 Unclassified 845
433 Ga0496100_0685939 3300048903 Unclassified 799
434 Ga0496100_0868516 3300048903 Unclassified 708
435 Ga0496102_0673371 3300048905 Bacteria 958
436 Ga0496104_0006063 3300048907 Bacteria 10610
437 Ga0496104_0136706 3300048907 Bacteria 2354
438 Ga0496105_0056382 3300048908 Unclassified 3243
439 Ga0496106_0074668 3300048909 Bacteria 2596
440 Ga0496106_0078457 3300048909 Unclassified 2534
441 Ga0496106_0089113 3300048909 Bacteria 2379
442 Ga0496107_0225576 3300048910 Unclassified 1394
443 Ga0496107_1055737 3300048910 Bacteria 588
444 Ga0496108_0006663 3300048911 Bacteria 9353
445 Ga0496108_0056320 3300048911 Bacteria 3303
446 Ga0496108_0405403 3300048911 Unclassified 1191
447 Ga0496109_0054897 3300048912 Bacteria 3633
448 Ga0496110_0003572 3300048913 Bacteria 11949
449 Ga0496110_0118387 3300048913 Unclassified 2385
450 Ga0496110_0972397 3300048913 Unclassified 756
451 Ga0496110_1704644 3300048913 Unclassified 540
452 Ga0496111_0085211 3300048914 Bacteria 2310
453 Ga0496112_0002485 3300048915 Bacteria 14878
454 Ga0496112_0004953 3300048915 Bacteria 11407
455 Ga0496113_0102981 3300048916 Bacteria 2214
456 Ga0501291_015871 3300049514 Bacteria 1143
457 Ga0501291_062184 3300049514 Unclassified 705
458 Ga0501292_083064 3300049515 Unclassified 612
459 Ga0501295_154387 3300049518 Bacteria 568
460 Ga0501295_192921 3300049518 Unclassified 512
461 Ga0501298_021212 3300049521 Bacteria 1216
462 Ga0501299_009306 3300049522 Bacteria 1616
463 Ga0501303_004987 3300049526 Unclassified 1114
464 Ga0501031_0145961 3300049568 Bacteria 1546
465 Ga0501031_0863790 3300049568 Unclassified 579
466 Ga0501033_0776225 3300049570 Unclassified 649
467 Ga0501037_0282651 3300049573 Bacteria 1156
468 Ga0501037_0284591 3300049573 Bacteria 1151
469 Ga0501038_1247279 3300049574 Bacteria 538
470 Ga0501039_0115476 3300049575 Bacteria 2101
471 Ga0501039_0771926 3300049575 Unclassified 750
472 Ga0501041_0077791 3300049577 Bacteria 2041
473 Ga0501041_0109349 3300049577 Unclassified 1715
474 Ga0501041_0130687 3300049577 Bacteria 1564
475 Ga0501041_0174466 3300049577 Bacteria 1345
476 Ga0501041_0831605 3300049577 Bacteria 592
477 Ga0501042_1065634 3300049578 Bacteria 589
478 Ga0501043_0345349 3300049579 Bacteria 1131
479 Ga0501043_1186990 3300049579 Unclassified 536
480 Ga0501048_0233118 3300049582 Unclassified 1306
481 Ga0501048_0245189 3300049582 Bacteria 1271
482 Ga0501048_0333252 3300049582 Bacteria 1081
483 Ga0501068_1171474 3300049584 Bacteria 509
484 Ga0501071_0157483 3300049587 Bacteria 1696
485 Ga0501071_0201473 3300049587 Bacteria 1495
486 Ga0501071_0221825 3300049587 Bacteria 1423
487 Ga0501071_0239046 3300049587 Bacteria 1369
488 Ga0501071_0308731 3300049587 Bacteria 1200
489 Ga0501072_0072025 3300049588 Bacteria 2731
490 Ga0501072_0217046 3300049588 Bacteria 1524
491 Ga0501072_0268173 3300049588 Bacteria 1358
492 Ga0501072_0487568 3300049588 Unclassified 975
493 Ga0501072_0687128 3300049588 Unclassified 805
494 Ga0501073_0139274 3300049589 Unclassified 1681
495 Ga0501074_0280971 3300049590 Bacteria 1183
496 Ga0501074_0511736 3300049590 Bacteria 850
497 Ga0501074_0839088 3300049590 Bacteria 647
498 Ga0501075_0035668 3300049591 Unclassified 3710
499 Ga0501075_0146410 3300049591 Bacteria 1800
500 Ga0501075_0201391 3300049591 Unclassified 1518
501 Ga0501076_0020500 3300049592 Bacteria 5061
502 Ga0501076_0273653 3300049592 Bacteria 1383
503 Ga0501076_0570001 3300049592 Bacteria 934
504 Ga0501077_0132362 3300049593 Bacteria 1581
505 Ga0501077_0426975 3300049593 Bacteria 848
506 Ga0501202_018879 3300049652 Bacteria 1358
507 Ga0501206_107734 3300049653 Bacteria 512
508 Ga0501211_010897 3300049658 Bacteria 892
509 Ga0501214_081869 3300049659 Bacteria 544
510 Ga0501243_048054 3300049675 Bacteria 764
511 Ga0501246_045460 3300049676 Bacteria 536
512 Ga0501249_043986 3300049679 Unclassified 1016
513 Ga0501258_036905 3300049687 Unclassified 639
514 Ga0501259_135532 3300049688 Bacteria 598
515 Ga0501261_116661 3300049690 Bacteria 524
516 Ga0501221_054260 3300049704 Bacteria 911
517 Ga0501221_111428 3300049704 Bacteria 690
518 Ga0501225_0049999 3300049705 Bacteria 1163
519 Ga0501079_0092868 3300049741 Bacteria 2338
520 Ga0501079_0364604 3300049741 Bacteria 1132
521 Ga0501079_0842528 3300049741 Bacteria 722
522 Ga0501081_0034014 3300049743 Bacteria 3466
523 Ga0501232_007393 3300049757 Bacteria 1157
524 Ga0501270_002875 3300049767 Bacteria 1806
525 Ga0501272_006683 3300049769 Bacteria 1237
526 Ga0501272_021879 3300049769 Unclassified 772
527 Ga0501274_053960 3300049771 Bacteria 510
528 Ga0501279_028072 3300049775 Bacteria 826
529 Ga0501279_062538 3300049775 Bacteria 612
530 Ga0501283_075578 3300049779 Bacteria 626
531 Ga0501045_0155929 3300049824 Bacteria 1699
532 Ga0501045_0488605 3300049824 Bacteria 914
533 Ga0501204_079322 3300049850 Bacteria 555
534 nmdc:mga03683_404553_c1 3300050489 Bacteria 652
535 nmdc:mga00v17_131236_c1 3300050491 Bacteria 1601
536 nmdc:mga00v17_182862_c1 3300050491 Bacteria 1353
537 nmdc:mga00v17_901134_c1 3300050491 Bacteria 560
538 nmdc:mga0yw44_27833_c1 3300050492 Bacteria 3243
539 nmdc:mga0yw44_317876_c1 3300050492 Bacteria 1045
540 nmdc:mga0k408_313114_c1 3300050493 Bacteria 937
541 nmdc:mga0k408_38341_c1 3300050493 Bacteria 2750
542 nmdc:mga0k408_4986_c1 3300050493 Bacteria 7033
543 nmdc:mga0k408_619277_c1 3300050493 Bacteria 638
544 nmdc:mga0k408_75357_c1 3300050493 Bacteria 1971
545 nmdc:mga0k408_900314_c1 3300050493 Bacteria 513
546 nmdc:mga06z11_176678_c1 3300050494 Bacteria 1229
547 nmdc:mga06z11_45533_c1 3300050494 Bacteria 2218
548 nmdc:mga06z11_4686_c1 3300050494 Bacteria 5401
549 nmdc:mga06z11_60009_c1 3300050494 Bacteria 1979
550 nmdc:mga04h51_14054_c1 3300050495 Bacteria 2280
551 nmdc:mga04h51_301831_c1 3300050495 Unclassified 653
552 nmdc:mga07m45_18733_c1 3300050496 Bacteria 3744
553 nmdc:mga07m45_403179_c1 3300050496 Bacteria 794
554 nmdc:mga07m45_69109_c1 3300050496 Bacteria 2008
555 nmdc:mga05p37_1014_c1 3300050507 Bacteria 31952
556 nmdc:mga05p37_1413653_c1 3300050507 Unclassified 700
557 nmdc:mga05p37_21122_c1 3300050507 Bacteria 7881
558 nmdc:mga05p37_25654_c1 3300050507 Bacteria 7170
559 nmdc:mga05p37_784254_c1 3300050507 Bacteria 1045
560 nmdc:mga09592_1023180_c1 3300050508 Bacteria 690
561 nmdc:mga09592_400687_c1 3300050508 Bacteria 1186
562 nmdc:mga09592_440192_c1 3300050508 Bacteria 1125
563 nmdc:mga09592_51589_c1 3300050508 Bacteria 3471
564 nmdc:mga0qj67_1026060_c1 3300050509 Bacteria 646
565 nmdc:mga0qj67_103492_c1 3300050509 Bacteria 2297
566 nmdc:mga0qj67_1375471_c1 3300050509 Unclassified 545
567 nmdc:mga0qj67_161046_c1 3300050509 Bacteria 1822
568 nmdc:mga0qj67_379736_c1 3300050509 Bacteria 1141
569 nmdc:mga0qj67_9720_c1 3300050509 Bacteria 6622
570 nmdc:mga06r32_1032421_c1 3300050510 Bacteria 774
571 nmdc:mga06r32_11616_c1 3300050510 Bacteria 7928
572 nmdc:mga06r32_1330862_c1 3300050510 Bacteria 662
573 nmdc:mga06r32_254245_c1 3300050510 Unclassified 1745
574 nmdc:mga06r32_368247_c1 3300050510 Unclassified 1420
575 nmdc:mga06r32_8582_c1 3300050510 Bacteria 9211
576 nmdc:mga06r32_97406_c1 3300050510 Bacteria 2882
577 nmdc:mga08y16_2099878_c1 3300050511 Bacteria 513
578 nmdc:mga08y16_249047_c1 3300050511 Bacteria 1836
579 nmdc:mga08y16_48927_c1 3300050511 Bacteria 4424
580 nmdc:mga08y16_837_c1 3300050511 Bacteria 29513
581 nmdc:mga0n895_668779_c1 3300050512 Unclassified 589
582 nmdc:mga0rr50_1369570_c1 3300050513 Bacteria 599
583 nmdc:mga0a205_1334197_c1 3300050515 Unclassified 565
584 nmdc:mga0a205_285056_c1 3300050515 Bacteria 1527
585 Ga0495595_0443747 3300053084 Bacteria 659
586 Ga0500651_0104996 3300053093 Unclassified 1729
587 Ga0501084_0013765 3300054114 Bacteria 6694
588 Ga0501084_0388489 3300054114 Bacteria 1179
589 Ga0590071_000045 3300059421 Bacteria 31970
590 Ga0590075_000041 3300059424 Bacteria 33435
591 Ga0590075_022670 3300059424 Unclassified 1572
592 Ga0590077_002897 3300059426 Bacteria 3600
593 Ga0590077_016676 3300059426 Bacteria 1542
594 Ga0501082_0585739 3300060353 Unclassified 976
595 Ga0530510_0523450 3300061734 Bacteria 900
596 Ga0157380_10708189
597 JGI24748J21848_1016042
598 JGI24744J21845_10034457
599 JGI24742J22300_10082540
600 Ga0058859_11185663
601 Ga0058860_11686437
602 Ga0065714_10090209
603 Ga0065714_10099833
604 Ga0065712_10000519
605 Ga0065712_10069421
606 Ga0065712_10316481
607 Ga0065712_10523977
608 Ga0065715_10091032
609 Ga0065715_10095576
610 Ga0065715_10172797
611 Ga0065707_10648364
612 Ga0070683_100000305
613 Ga0070683_100114729
614 Ga0070690_100087325
615 Ga0070690_100301499
616 Ga0070670_100022375
617 Ga0070670_100044085
618 Ga0070677_10104259
619 Ga0070677_10353574
620 Ga0068869_101307728
621 Ga0070666_10108080
622 Ga0070666_10196085
623 Ga0068868_100036422
624 Ga0068868_100830992
625 Ga0070660_100783816
626 Ga0070689_100233366
627 Ga0070687_100136594
628 Ga0070661_100004814
629 Ga0070692_10319424
630 Ga0070668_100232072
631 Ga0070668_100664625
632 Ga0070668_101086038
633 Ga0070669_100319293
634 Ga0070669_101640185
635 Ga0070669_101838360
636 Ga0070675_100014408
637 Ga0070675_100023191
638 Ga0070675_100099666
639 Ga0070675_100338759
640 Ga0070675_100384396
641 Ga0070675_101877651
642 Ga0070675_102001353
643 Ga0070671_100075164
644 Ga0070671_100090678
645 Ga0070671_100251032
646 Ga0070671_100385789
647 Ga0070671_100464103
648 Ga0070674_100062272
649 Ga0070674_100143719
650 Ga0070674_100284476
651 Ga0070674_100875755
652 Ga0070673_100034343
653 Ga0070673_100036240
654 Ga0070673_100073457
655 Ga0070673_100279122
656 Ga0070673_100546011
657 Ga0070673_100552996
658 Ga0070673_100818375
659 Ga0070673_100969535
660 Ga0070688_100004342
661 Ga0070659_100603573
662 Ga0070667_100172676
663 Ga0070667_100251845
664 Ga0070667_100579553
665 Ga0070709_10473623
666 Ga0070705_100853707
667 Ga0070705_101491585
668 Ga0070700_100748098
669 Ga0070663_100139563
670 Ga0070663_100178717
671 Ga0070663_100308392
672 Ga0070663_100823280
673 Ga0070663_101008342
674 Ga0070663_101723007
675 Ga0070678_100109572
676 Ga0070678_100111195
677 Ga0070678_100119759
678 Ga0070678_100128547
679 Ga0070678_100226060
680 Ga0070678_100249552
681 Ga0070678_100622400
682 Ga0070678_101194021
683 Ga0070662_100042512
684 Ga0070662_100308627
685 Ga0070662_100730903
686 Ga0070662_101474048
687 Ga0068867_100912664
688 Ga0068867_101879811
689 Ga0070685_10044720
690 Ga0070684_100000992
691 Ga0070697_101516224
692 Ga0070672_100070570
693 Ga0070672_100148207
694 Ga0070672_100225286
695 Ga0070672_100737105
696 Ga0070672_101969152
697 Ga0070686_100474408
698 Ga0070686_100737940
699 Ga0070665_100522290
700 Ga0070665_100633255
701 Ga0070664_100000885
702 Ga0070664_100105570
703 Ga0068857_100050070
704 Ga0068857_101062735
705 Ga0068857_101636315
706 Ga0068856_100851184
707 Ga0070702_100717556
708 Ga0070702_101188756
709 Ga0068852_100936295
710 Ga0068859_100177414
711 Ga0068864_100031052
712 Ga0068864_100284833
713 Ga0068864_101730915
714 Ga0068866_10227941
715 Ga0068861_102074314
716 Ga0068861_102116088
717 Ga0068851_10062112
718 Ga0068851_10570608
719 Ga0068870_10385406
720 Ga0068863_100284369
721 Ga0068863_100937856
722 Ga0068858_101123532
723 Ga0068862_100031760
724 Ga0068862_101129383
725 Ga0068862_102483021
726 Ga0070717_10975814
727 Ga0075365_10066304
728 Ga0075368_10076267
729 Ga0075363_100032182
730 Ga0075364_10095715
731 Ga0075364_10161566
732 Ga0075364_10185037
733 Ga0075364_10231101
734 Ga0070715_10401513
735 Ga0075362_10137022
736 Ga0075367_10041635
737 Ga0075367_10121333
738 Ga0075367_10142331
739 Ga0075367_10172707
740 Ga0075367_10566189
741 Ga0075367_10678649
742 Ga0075367_10930440
743 Ga0075369_10207532
744 Ga0075366_10015168
745 Ga0075366_10371710
746 Ga0075366_10604529
747 Ga0097621_100666203
748 Ga0075370_10009347
749 Ga0068871_100249304
750 Ga0075428_100003040
751 Ga0075428_100017702
752 Ga0075428_100018567
753 Ga0075428_100275018
754 Ga0075428_101557345
755 Ga0075430_100006775
756 Ga0075430_100008697
757 Ga0075430_100014488
758 Ga0075430_100398483
759 Ga0075430_100722410
760 Ga0075431_100005339
761 Ga0075431_100032453
762 Ga0075431_100043880
763 Ga0075431_100112948
764 Ga0075431_100418491
765 Ga0075431_100663235
766 Ga0075431_101338451
767 Ga0075431_101359448
768 Ga0075433_10132992
769 Ga0075433_10932721
770 Ga0075429_100005028
771 Ga0075429_100145064
772 Ga0075429_100271185
773 Ga0068865_100371951
774 Ga0097620_100177414
775 Ga0111539_10000984
776 Ga0111539_10540259
777 Ga0111539_10697355
778 Ga0111539_10898597
779 Ga0111539_11049650
780 Ga0111539_11254362
781 Ga0111539_11528385
782 Ga0105245_11267645
783 Ga0105245_12002693
784 Ga0105245_12323508
785 Ga0105247_10134132
786 Ga0114129_10000348
787 Ga0114129_10001069
788 Ga0114129_10040984
789 Ga0114129_10054774
790 Ga0114129_10117379
791 Ga0114129_10158118
792 Ga0114129_11054300
793 Ga0105243_10738122
794 Ga0105243_11851042
795 Ga0105243_12433458
796 Ga0105241_10210319
797 Ga0105241_12373678
798 Ga0105242_11340100
799 Ga0105248_10006242
800 Ga0105248_10046850
801 Ga0105248_10213149
802 Ga0105248_10299113
803 Ga0105248_10659398
804 Ga0105248_11102317
805 Ga0105248_11446177
806 Ga0105237_10137648
807 Ga0105238_10276403
808 Ga0105249_10051693
809 Ga0105249_10750393
810 Ga0105239_10702230
811 Ga0105239_11245335
812 Ga0105246_10061277
813 Ga0157374_10018496
814 Ga0157374_10483617
815 Ga0157378_10805272
816 Ga0163162_10098113
817 Ga0157375_10380617
818 Ga0157375_11813370
819 Ga0163163_10050230
820 Ga0163163_10223005
821 Ga0163163_10276441
822 Ga0163163_10362344
823 Ga0163163_10911228
824 Ga0163163_11789052
825 Ga0157380_10179368
826 Ga0157380_10195281
827 Ga0157380_10275684
828 Ga0157380_10656219
829 Ga0157380_13050154
830 Ga0157379_10152190
831 Ga0157376_10189559
832 Ga0157376_10576692
833 Ga0157376_10820160
834 Ga0157376_10844935
835 Ga0157376_11383607
836 Ga0157376_12277364
837 Ga0163161_10312745
838 Ga0163161_10839766
839 Ga0207673_1008787
840 Ga0207697_10018774
841 Ga0207697_10029497
842 Ga0207697_10364813
843 Ga0207697_10401395
844 Ga0207642_10483427
845 Ga0207688_10119062
846 Ga0207688_10207398
847 Ga0207688_10224016
848 Ga0207688_10473037
849 Ga0207688_10594449
850 Ga0207680_10107977
851 Ga0207643_10634627
852 Ga0207654_10948165
853 Ga0207671_10070359
854 Ga0207660_10712279
855 Ga0207662_10190651
856 Ga0207649_10028677
857 Ga0207649_10617528
858 Ga0207681_10062922
859 Ga0207681_10618417
860 Ga0207681_11401088
861 Ga0207694_10525281
862 Ga0207650_10061493
863 Ga0207650_10105514
864 Ga0207650_10106718
865 Ga0207650_10161661
866 Ga0207650_10417734
867 Ga0207659_10101764
868 Ga0207659_10152119
869 Ga0207659_10555388
870 Ga0207659_10799011
871 Ga0207659_11664919
872 Ga0207687_11106656
873 Ga0207644_10081299
874 Ga0207644_10349565
875 Ga0207644_11431287
876 Ga0207706_10027446
877 Ga0207706_10040774
878 Ga0207706_10356497
879 Ga0207706_10416931
880 Ga0207670_10197038
881 Ga0207669_10074890
882 Ga0207669_10298360
883 Ga0207669_10299699
884 Ga0207691_10059985
885 Ga0207691_10071027
886 Ga0207691_10096459
887 Ga0207691_10686801
888 Ga0207691_11191124
889 Ga0207711_10032889
890 Ga0207711_10147263
891 Ga0207711_10247967
892 Ga0207711_10746706
893 Ga0207711_11141758
894 Ga0207711_11589472
895 Ga0207689_10861796
896 Ga0207661_10000649
897 Ga0207661_10849585
898 Ga0207679_10000643
899 Ga0207651_10027376
900 Ga0207651_10036765
901 Ga0207651_10435102
902 Ga0207651_10987019
903 Ga0207651_11223704
904 Ga0207712_10018095
905 Ga0207668_10106831
906 Ga0207640_11877597
907 Ga0207658_10180808
908 Ga0207658_10691084
909 Ga0207658_10794477
910 Ga0207703_11400813
911 Ga0207678_10032017
912 Ga0207678_10090445
913 Ga0207678_10543817
914 Ga0207678_10609886
915 Ga0207678_10779185
916 Ga0207708_10412907
917 Ga0207641_10121766
918 Ga0207641_10717945
919 Ga0207648_10040919
920 Ga0207648_10820300
921 Ga0207648_10946844
922 Ga0207648_11731878
923 Ga0207676_10047470
924 Ga0207676_10239547
925 Ga0207676_12059817
926 Ga0207674_10078679
927 Ga0207674_11033966
928 Ga0207675_100110828
929 Ga0207675_100318743
930 Ga0207683_10023056
931 Ga0207683_10082025
932 Ga0207683_10410229
933 Ga0207683_10612314
934 Ga0207683_11071554
935 Ga0207698_12730313
936 Ga0209971_1048177
937 Ga0209813_10008695
938 Ga0209813_10056802
939 Ga0207428_10002134
940 Ga0207428_10513933
941 Ga0268266_10132507
942 Ga0268266_10297325
943 Ga0268266_10349365
944 Ga0268266_10435219
945 Ga0268265_10087414
946 Ga0268265_10117714
947 Ga0268264_11004042
948 Ga0307408_100041858
949 Ga0307408_100059785
950 Ga0307408_100060836
951 Ga0307408_100098339
952 Ga0307408_100356068
953 Ga0307408_102006374
954 Ga0307408_102481881
955 Ga0307405_10117209
956 Ga0307405_10136333
957 Ga0307405_10145725
958 Ga0307405_10306672
959 Ga0307413_10822401
960 Ga0307410_10210866
961 Ga0307410_10441399
962 Ga0307410_10668707
963 Ga0307410_10770983
964 Ga0307406_10619537
965 Ga0307406_10740362
966 Ga0307406_11190472
967 Ga0307406_11325477
968 Ga0307407_10063749
969 Ga0307407_10749343
970 Ga0307412_10257460
971 Ga0307409_100067151
972 Ga0307409_100782401
973 Ga0307416_100023274
974 Ga0307416_100094635
975 Ga0307416_100126739
976 Ga0307416_100133191
977 Ga0307416_100296490
978 Ga0307416_100346316
979 Ga0307416_100800135
980 Ga0307416_101836381
981 Ga0307414_11002045
982 Ga0307411_10074107
983 Ga0307411_10103781
984 Ga0307411_10118048
985 Ga0307411_10504622
986 Ga0307411_11353857
987 Ga0307415_100028678
988 Ga0307415_100212946
989 Ga0373958_0092644
990 Ga0373943_0477984
991 Ga0373955_0651235
992 Ga0373947_0054856
993 Ga0373937_0002803
994 Ga0451793_0459136
995 Ga0451807_0980505
996 Ga0451853_1850163
997 Ga0439437_022272
998 Ga0439449_0264640
999 Ga0439450_023695
1000 Ga0450920_065329
1001 Ga0450923_141761
1002 Ga0450897_002484
1003 Ga0450897_050593
1004 Ga0450895_000737
1005 Ga0450896_000294
1006 Ga0450896_014268
1007 Ga0450899_033466
1008 Ga0450906_018485
1009 Ga0450908_004279
1010 Ga0439435_0004054
1011 Ga0439444_0027998
1012 Ga0439464_0000717
1013 Ga0439460_0016836
1014 Ga0439460_0068508
1015 Ga0450918_013134
1016 Ga0450918_054364
1017 Ga0451577_1052693
1018 Ga0495603_0641397
1019 Ga0495629_0159154
1020 Ga0495606_0538455
1021 Ga0495608_0711874
1022 Ga0495646_0693565
1023 Ga0495647_0060552
1024 Ga0495680_0816071
1025 Ga0495684_0647564
1026 Ga0496100_0308507
1027 Ga0496100_0614818
1028 Ga0496100_0685939
1029 Ga0496100_0868516
1030 Ga0496102_0673371
1031 Ga0496104_0006063
1032 Ga0496104_0136706
1033 Ga0496105_0056382
1034 Ga0496106_0074668
1035 Ga0496106_0078457
1036 Ga0496106_0089113
1037 Ga0496107_0225576
1038 Ga0496107_1055737
1039 Ga0496108_0006663
1040 Ga0496108_0056320
1041 Ga0496108_0405403
1042 Ga0496109_0054897
1043 Ga0496110_0003572
1044 Ga0496110_0118387
1045 Ga0496110_0972397
1046 Ga0496110_1704644
1047 Ga0496111_0085211
1048 Ga0496112_0002485
1049 Ga0496112_0004953
1050 Ga0496113_0102981
1051 Ga0501291_015871
1052 Ga0501291_062184
1053 Ga0501292_083064
1054 Ga0501295_154387
1055 Ga0501295_192921
1056 Ga0501298_021212
1057 Ga0501299_009306
1058 Ga0501303_004987
1059 Ga0501031_0145961
1060 Ga0501031_0863790
1061 Ga0501033_0776225
1062 Ga0501037_0282651
1063 Ga0501037_0284591
1064 Ga0501038_1247279
1065 Ga0501039_0115476
1066 Ga0501039_0771926
1067 Ga0501041_0077791
1068 Ga0501041_0109349
1069 Ga0501041_0130687
1070 Ga0501041_0174466
1071 Ga0501041_0831605
1072 Ga0501042_1065634
1073 Ga0501043_0345349
1074 Ga0501043_1186990
1075 Ga0501048_0233118
1076 Ga0501048_0245189
1077 Ga0501048_0333252
1078 Ga0501068_1171474
1079 Ga0501071_0157483
1080 Ga0501071_0201473
1081 Ga0501071_0221825
1082 Ga0501071_0239046
1083 Ga0501071_0308731
1084 Ga0501072_0072025
1085 Ga0501072_0217046
1086 Ga0501072_0268173
1087 Ga0501072_0487568
1088 Ga0501072_0687128
1089 Ga0501073_0139274
1090 Ga0501074_0280971
1091 Ga0501074_0511736
1092 Ga0501074_0839088
1093 Ga0501075_0035668
1094 Ga0501075_0146410
1095 Ga0501075_0201391
1096 Ga0501076_0020500
1097 Ga0501076_0273653
1098 Ga0501076_0570001
1099 Ga0501077_0132362
1100 Ga0501077_0426975
1101 Ga0501202_018879
1102 Ga0501206_107734
1103 Ga0501211_010897
1104 Ga0501214_081869
1105 Ga0501243_048054
1106 Ga0501246_045460
1107 Ga0501249_043986
1108 Ga0501258_036905
1109 Ga0501259_135532
1110 Ga0501261_116661
1111 Ga0501221_054260
1112 Ga0501221_111428
1113 Ga0501225_0049999
1114 Ga0501079_0092868
1115 Ga0501079_0364604
1116 Ga0501079_0842528
1117 Ga0501081_0034014
1118 Ga0501232_007393
1119 Ga0501270_002875
1120 Ga0501272_006683
1121 Ga0501272_021879
1122 Ga0501274_053960
1123 Ga0501279_028072
1124 Ga0501279_062538
1125 Ga0501283_075578
1126 Ga0501045_0155929
1127 Ga0501045_0488605
1128 Ga0501204_079322
1129 nmdc:mga03683_404553_c1
1130 nmdc:mga00v17_131236_c1
1131 nmdc:mga00v17_182862_c1
1132 nmdc:mga00v17_901134_c1
1133 nmdc:mga0yw44_27833_c1
1134 nmdc:mga0yw44_317876_c1
1135 nmdc:mga0k408_313114_c1
1136 nmdc:mga0k408_38341_c1
1137 nmdc:mga0k408_4986_c1
1138 nmdc:mga0k408_619277_c1
1139 nmdc:mga0k408_75357_c1
1140 nmdc:mga0k408_900314_c1
1141 nmdc:mga06z11_176678_c1
1142 nmdc:mga06z11_45533_c1
1143 nmdc:mga06z11_4686_c1
1144 nmdc:mga06z11_60009_c1
1145 nmdc:mga04h51_14054_c1
1146 nmdc:mga04h51_301831_c1
1147 nmdc:mga07m45_18733_c1
1148 nmdc:mga07m45_403179_c1
1149 nmdc:mga07m45_69109_c1
1150 nmdc:mga05p37_1014_c1
1151 nmdc:mga05p37_1413653_c1
1152 nmdc:mga05p37_21122_c1
1153 nmdc:mga05p37_25654_c1
1154 nmdc:mga05p37_784254_c1
1155 nmdc:mga09592_1023180_c1
1156 nmdc:mga09592_400687_c1
1157 nmdc:mga09592_440192_c1
1158 nmdc:mga09592_51589_c1
1159 nmdc:mga0qj67_1026060_c1
1160 nmdc:mga0qj67_103492_c1
1161 nmdc:mga0qj67_1375471_c1
1162 nmdc:mga0qj67_161046_c1
1163 nmdc:mga0qj67_379736_c1
1164 nmdc:mga0qj67_9720_c1
1165 nmdc:mga06r32_1032421_c1
1166 nmdc:mga06r32_11616_c1
1167 nmdc:mga06r32_1330862_c1
1168 nmdc:mga06r32_254245_c1
1169 nmdc:mga06r32_368247_c1
1170 nmdc:mga06r32_8582_c1
1171 nmdc:mga06r32_97406_c1
1172 nmdc:mga08y16_2099878_c1
1173 nmdc:mga08y16_249047_c1
1174 nmdc:mga08y16_48927_c1
1175 nmdc:mga08y16_837_c1
1176 nmdc:mga0n895_668779_c1
1177 nmdc:mga0rr50_1369570_c1
1178 nmdc:mga0a205_1334197_c1
1179 nmdc:mga0a205_285056_c1
1180 Ga0495595_0443747
1181 Ga0500651_0104996
1182 Ga0501084_0013765
1183 Ga0501084_0388489
1184 Ga0590071_000045
1185 Ga0590075_000041
1186 Ga0590075_022670
1187 Ga0590077_002897
1188 Ga0590077_016676
1189 Ga0501082_0585739
1190 Ga0530510_0523450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz7-assembly1.cif.gz_B crystal structure of putative antibiotic biosynthesis monooxygenase (np_888398.1) from bordetella bronchiseptica at 2.15 a resolution 0.7767 2 97
3tvz-assembly2.cif.gz_B structure of bacillus subtilis hmob 0.7759 2 65
3f44-assembly1.cif.gz_A crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution 0.7728 2 95
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.7667 2 96
3bm7-assembly1.cif.gz_A-2 crystal structure of a putative antibiotic biosynthesis monooxygenase (cc_2132) from caulobacter crescentus cb15 at 1.35 a resolution 0.7619 2 98
ID Description Score Start End Superfamily
3bm7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.783 2 98 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7746 1 96 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7525 1 96 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7515 2 96 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.74 2 96 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2V9F0S2-F1-model_v4 ABM domain-containing protein 0.9768 3 59
AF-A0A3D6B870-F1-model_v4 ABM domain-containing protein 0.9699 1 59
AF-A0A3N5G6S2-F1-model_v4 ABM domain-containing protein 0.9356 1 93
AF-A0A849SLQ1-F1-model_v4 ABM domain-containing protein 0.9303 1 97
AF-A0A3N5G6S2-F1-model_v4 ABM domain-containing protein 0.9259 1 93

Map