F467336

General Info

Members Datasets Scaffolds Average Seq Length
594 297 1188 122

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_12412335|Ga0157380_124123351
Length 149
Sequence VSELQDRIKEIIETEPVAVFMKGTPQFAACGNSARALDALRAVGAPITAVDVLPDPQIRQELSALSGWPTIPQVFVGGELIGGADITEELHASGELERKLGDKLGDGWQAPGRERVIELAPGGAPAPRAAGAPEGRQPAKLLQAREGSE

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
157 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
177 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
183 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
184 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
188 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
244 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 7.24
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 12.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_12412335 3300014326 Bacteria 591
2 Ga0070683_100014121 3300005329 Bacteria 6975
3 Ga0068869_100445125 3300005334 Bacteria 1073
4 Ga0070666_10529751 3300005335 Bacteria 856
5 Ga0068868_100015257 3300005338 Bacteria 5678
6 Ga0068868_100364244 3300005338 Bacteria 1241
7 Ga0070660_101289014 3300005339 Unclassified 620
8 Ga0070689_100011564 3300005340 Bacteria 6324
9 Ga0070689_100800386 3300005340 Bacteria 829
10 Ga0070687_100883403 3300005343 Bacteria 640
11 Ga0070692_11168051 3300005345 Unclassified 546
12 Ga0070668_100007902 3300005347 Bacteria 7898
13 Ga0070675_100008011 3300005354 Bacteria 8190
14 Ga0070675_100288388 3300005354 Bacteria 1444
15 Ga0070671_101455514 3300005355 Bacteria 606
16 Ga0070674_100086678 3300005356 Bacteria 2250
17 Ga0070674_100233179 3300005356 Bacteria 1437
18 Ga0070674_100439912 3300005356 Bacteria 1074
19 Ga0070673_100075688 3300005364 Bacteria 2716
20 Ga0070659_100047318 3300005366 Bacteria 3373
21 Ga0070709_10076295 3300005434 Bacteria 2176
22 Ga0070714_100098415 3300005435 Bacteria 2573
23 Ga0070714_100183372 3300005435 Bacteria 1906
24 Ga0070714_100222032 3300005435 Bacteria 1737
25 Ga0070714_101042422 3300005435 Bacteria 796
26 Ga0070714_101287591 3300005435 Bacteria 713
27 Ga0070714_102038543 3300005435 Bacteria 559
28 Ga0070713_100045171 3300005436 Bacteria 3608
29 Ga0070713_100070322 3300005436 Bacteria 2954
30 Ga0070713_100100236 3300005436 Bacteria 2507
31 Ga0070710_10471467 3300005437 Bacteria 854
32 Ga0070711_101390111 3300005439 Bacteria 611
33 Ga0070711_101486592 3300005439 Bacteria 591
34 Ga0070705_100382066 3300005440 Bacteria 1037
35 Ga0070700_100163371 3300005441 Bacteria 1535
36 Ga0070708_100033833 3300005445 Bacteria 4441
37 Ga0070708_100160627 3300005445 Bacteria 2094
38 Ga0070663_100024320 3300005455 Bacteria 4075
39 Ga0070663_100477393 3300005455 Bacteria 1032
40 Ga0070678_100489837 3300005456 Unclassified 1083
41 Ga0070678_101823092 3300005456 Bacteria 574
42 Ga0070662_100627746 3300005457 Bacteria 905
43 Ga0068867_100248762 3300005459 Bacteria 1445
44 Ga0068867_100355336 3300005459 Bacteria 1224
45 Ga0070706_100004764 3300005467 Bacteria 13011
46 Ga0070706_100237992 3300005467 Bacteria 1700
47 Ga0070706_100586113 3300005467 Bacteria 1036
48 Ga0070707_100002038 3300005468 Bacteria 19331
49 Ga0070707_100682721 3300005468 Bacteria 990
50 Ga0070698_100004845 3300005471 Bacteria 14771
51 Ga0070698_100133341 3300005471 Bacteria 2438
52 Ga0070698_100322068 3300005471 Bacteria 1476
53 Ga0070698_100386996 3300005471 Bacteria 1331
54 Ga0070699_100070518 3300005518 Bacteria 3038
55 Ga0070699_101147826 3300005518 Bacteria 713
56 Ga0070679_101324131 3300005530 Bacteria 666
57 Ga0070684_100001762 3300005535 Bacteria 15789
58 Ga0070684_100008993 3300005535 Bacteria 7848
59 Ga0070697_100241836 3300005536 Unclassified 1541
60 Ga0070672_100174911 3300005543 Bacteria 1787
61 Ga0070686_100113260 3300005544 Bacteria 1852
62 Ga0070695_100224967 3300005545 Bacteria 1354
63 Ga0070695_100815368 3300005545 Bacteria 749
64 Ga0070696_101251054 3300005546 Bacteria 629
65 Ga0070704_100015880 3300005549 Bacteria 4742
66 Ga0070704_100067625 3300005549 Unclassified 2581
67 Ga0070704_101905241 3300005549 Bacteria 551
68 Ga0068855_100025809 3300005563 Bacteria 7026
69 Ga0068857_100010331 3300005577 Bacteria 8110
70 Ga0068857_100019586 3300005577 Bacteria 5944
71 Ga0068854_100806004 3300005578 Bacteria 819
72 Ga0068854_101406567 3300005578 Bacteria 631
73 Ga0068856_101791351 3300005614 Bacteria 626
74 Ga0068866_10592916 3300005718 Bacteria 747
75 Ga0068861_100000713 3300005719 Bacteria 19839
76 Ga0068861_100139603 3300005719 Bacteria 1977
77 Ga0068861_100474111 3300005719 Bacteria 1126
78 Ga0068861_100861257 3300005719 Bacteria 855
79 Ga0068870_10271485 3300005840 Unclassified 1059
80 Ga0068863_102694952 3300005841 Bacteria 506
81 Ga0068858_100975785 3300005842 Bacteria 830
82 Ga0068860_101328148 3300005843 Bacteria 740
83 Ga0068862_100252026 3300005844 Bacteria 1609
84 Ga0068862_100471990 3300005844 Unclassified 1186
85 Ga0081455_10052565 3300005937 Bacteria 3486
86 Ga0081455_10121148 3300005937 Bacteria 2061
87 Ga0081455_10188361 3300005937 Unclassified 1556
88 Ga0081540_1003040 3300005983 Bacteria 13438
89 Ga0081539_10117171 3300005985 Bacteria 1329
90 Ga0070717_10050699 3300006028 Bacteria 3412
91 Ga0070717_10060400 3300006028 Bacteria 3139
92 Ga0070717_10093185 3300006028 Bacteria 2546
93 Ga0070717_10939103 3300006028 Unclassified 788
94 Ga0075365_10103578 3300006038 Bacteria 1950
95 Ga0075365_10665841 3300006038 Unclassified 735
96 Ga0075364_10648564 3300006051 Archaea 721
97 Ga0070715_10102578 3300006163 Bacteria 1337
98 Ga0070712_101606134 3300006175 Bacteria 569
99 Ga0097621_102034652 3300006237 Unclassified 549
100 Ga0068871_100285973 3300006358 Bacteria 1443
101 Ga0068871_101631168 3300006358 Bacteria 611
102 Ga0075428_100162383 3300006844 Bacteria 2424
103 Ga0075428_100586492 3300006844 Bacteria 1191
104 Ga0075428_100599993 3300006844 Bacteria 1176
105 Ga0075428_101002917 3300006844 Bacteria 884
106 Ga0075428_101028418 3300006844 Bacteria 871
107 Ga0075428_101299761 3300006844 Bacteria 765
108 Ga0075431_100207632 3300006847 Bacteria 2002
109 Ga0075431_100364676 3300006847 Bacteria 1451
110 Ga0075433_10110150 3300006852 Bacteria 2443
111 Ga0075433_11348036 3300006852 Bacteria 618
112 Ga0075434_100079856 3300006871 Bacteria 3268
113 Ga0075434_100205577 3300006871 Bacteria 1989
114 Ga0075434_101185685 3300006871 Bacteria 776
115 Ga0075429_100519917 3300006880 Bacteria 1043
116 Ga0068865_100047832 3300006881 Bacteria 2941
117 Ga0068865_100395841 3300006881 Bacteria 1130
118 Ga0068865_100784764 3300006881 Unclassified 821
119 Ga0068865_101853643 3300006881 Bacteria 546
120 Ga0075436_100024049 3300006914 Bacteria 4187
121 Ga0075436_100087509 3300006914 Bacteria 2164
122 Ga0075436_100443203 3300006914 Bacteria 945
123 Ga0075435_100136468 3300007076 Unclassified 2055
124 Ga0111539_10015626 3300009094 Bacteria 9437
125 Ga0111539_10023141 3300009094 Bacteria 7630
126 Ga0111539_10538129 3300009094 Bacteria 1361
127 Ga0111539_10607938 3300009094 Unclassified 1273
128 Ga0111539_10974172 3300009094 Bacteria 986
129 Ga0111539_12467712 3300009094 Bacteria 603
130 Ga0105245_10007387 3300009098 Bacteria 9622
131 Ga0105245_10013687 3300009098 Bacteria 7067
132 Ga0105245_10031433 3300009098 Bacteria 4698
133 Ga0105245_10133461 3300009098 Unclassified 2331
134 Ga0105245_10588524 3300009098 Bacteria 1138
135 Ga0114129_10010379 3300009147 Bacteria 13281
136 Ga0114129_10082990 3300009147 Bacteria 4453
137 Ga0114129_10100469 3300009147 Bacteria 4003
138 Ga0114129_10180117 3300009147 Bacteria 2876
139 Ga0114129_11899571 3300009147 Bacteria 722
140 Ga0105243_10220262 3300009148 Unclassified 1677
141 Ga0105243_10486571 3300009148 Bacteria 1166
142 Ga0105243_10505730 3300009148 Bacteria 1146
143 Ga0105243_10687496 3300009148 Bacteria 996
144 Ga0105243_10727188 3300009148 Bacteria 971
145 Ga0105241_10082368 3300009174 Bacteria 2522
146 Ga0105242_10256315 3300009176 Bacteria 1578
147 Ga0105242_10370822 3300009176 Bacteria 1328
148 Ga0105248_10148863 3300009177 Bacteria 2641
149 Ga0105238_11701936 3300009551 Unclassified 662
150 Ga0105249_10004532 3300009553 Bacteria 12011
151 Ga0105239_10118949 3300010375 Bacteria 2932
152 Ga0105239_10663113 3300010375 Bacteria 1192
153 Ga0105239_11043217 3300010375 Bacteria 940
154 Ga0105239_11748213 3300010375 Bacteria 720
155 Ga0105246_10032927 3300011119 Bacteria 3440
156 Ga0105246_10220806 3300011119 Unclassified 1485
157 Ga0157342_1023042 3300012507 Bacteria 737
158 Ga0157373_10925106 3300013100 Bacteria 648
159 Ga0157374_10003624 3300013296 Bacteria 12994
160 Ga0157374_10337487 3300013296 Unclassified 1495
161 Ga0157374_12698248 3300013296 Bacteria 524
162 Ga0163162_10037855 3300013306 Bacteria 4814
163 Ga0163162_11090620 3300013306 Bacteria 904
164 Ga0157372_11752571 3300013307 Bacteria 714
165 Ga0157375_10004528 3300013308 Bacteria 12077
166 Ga0157375_10202258 3300013308 Unclassified 2142
167 Ga0157375_11270409 3300013308 Bacteria 865
168 Ga0157380_10629824 3300014326 Bacteria 1066
169 Ga0157380_13462920 3300014326 Bacteria 505
170 Ga0182008_10066480 3300014497 Bacteria 1774
171 Ga0182008_10171867 3300014497 Unclassified 1094
172 Ga0182008_10862106 3300014497 Bacteria 530
173 Ga0157377_10003876 3300014745 Bacteria 6814
174 Ga0157379_10462964 3300014968 Bacteria 1172
175 Ga0157376_11785640 3300014969 Bacteria 651
176 Ga0182006_1176706 3300015261 Bacteria 713
177 Ga0182007_10184134 3300015262 Bacteria 723
178 Ga0163161_10018172 3300017792 Bacteria 4929
179 Ga0163161_10277807 3300017792 Bacteria 1313
180 Ga0163161_10478932 3300017792 Bacteria 1010
181 Ga0224712_10325945 3300022467 Bacteria 722
182 Ga0207653_10031353 3300025885 Bacteria 1717
183 Ga0207682_10267574 3300025893 Bacteria 798
184 Ga0207692_10116434 3300025898 Bacteria 1490
185 Ga0207642_10203726 3300025899 Bacteria 1095
186 Ga0207642_10445538 3300025899 Bacteria 783
187 Ga0207685_10082309 3300025905 Bacteria 1335
188 Ga0207699_10218101 3300025906 Unclassified 1301
189 Ga0207699_11103917 3300025906 Bacteria 587
190 Ga0207643_10407344 3300025908 Unclassified 860
191 Ga0207684_10098320 3300025910 Bacteria 2499
192 Ga0207684_10390383 3300025910 Bacteria 1197
193 Ga0207707_10277628 3300025912 Archaea 1451
194 Ga0207693_10000406 3300025915 Bacteria 39259
195 Ga0207693_11314361 3300025915 Bacteria 540
196 Ga0207663_10182835 3300025916 Bacteria 1499
197 Ga0207663_10807100 3300025916 Bacteria 747
198 Ga0207660_11007837 3300025917 Bacteria 679
199 Ga0207662_10112777 3300025918 Bacteria 1697
200 Ga0207657_11392071 3300025919 Bacteria 527
201 Ga0207652_10159740 3300025921 Archaea 2020
202 Ga0207646_10016601 3300025922 Bacteria 6906
203 Ga0207681_10668967 3300025923 Bacteria 862
204 Ga0207687_10054274 3300025927 Bacteria 2803
205 Ga0207687_10111346 3300025927 Bacteria 2032
206 Ga0207687_10682426 3300025927 Bacteria 871
207 Ga0207687_11042660 3300025927 Bacteria 702
208 Ga0207687_11492800 3300025927 Bacteria 581
209 Ga0207700_10774707 3300025928 Bacteria 858
210 Ga0207700_11464055 3300025928 Bacteria 606
211 Ga0207664_10006068 3300025929 Bacteria 8275
212 Ga0207664_10100558 3300025929 Bacteria 2388
213 Ga0207664_10342776 3300025929 Unclassified 1321
214 Ga0207664_10686427 3300025929 Bacteria 921
215 Ga0207664_10819988 3300025929 Bacteria 837
216 Ga0207644_10842137 3300025931 Bacteria 768
217 Ga0207706_10009893 3300025933 Bacteria 8745
218 Ga0207706_10106286 3300025933 Bacteria 2470
219 Ga0207706_10218119 3300025933 Unclassified 1671
220 Ga0207686_10184478 3300025934 Bacteria 1482
221 Ga0207709_10073375 3300025935 Bacteria 2180
222 Ga0207709_10111904 3300025935 Bacteria 1827
223 Ga0207670_10237202 3300025936 Bacteria 1403
224 Ga0207670_11602512 3300025936 Bacteria 554
225 Ga0207669_10021079 3300025937 Bacteria 3432
226 Ga0207669_10169808 3300025937 Bacteria 1551
227 Ga0207669_10214784 3300025937 Bacteria 1407
228 Ga0207669_10326986 3300025937 Bacteria 1176
229 Ga0207665_10066334 3300025939 Bacteria 2456
230 Ga0207691_10029192 3300025940 Bacteria 5159
231 Ga0207711_11182773 3300025941 Bacteria 706
232 Ga0207689_10119157 3300025942 Bacteria 2171
233 Ga0207661_10007997 3300025944 Bacteria 7541
234 Ga0207661_10066450 3300025944 Bacteria 2929
235 Ga0207661_11287590 3300025944 Bacteria 672
236 Ga0207679_10136111 3300025945 Bacteria 1978
237 Ga0207667_10175533 3300025949 Bacteria 2201
238 Ga0207667_10890445 3300025949 Unclassified 882
239 Ga0207651_10019919 3300025960 Bacteria 4035
240 Ga0207712_10082738 3300025961 Unclassified 2341
241 Ga0207668_10006859 3300025972 Bacteria 6755
242 Ga0207640_10959317 3300025981 Bacteria 750
243 Ga0207677_10086544 3300026023 Bacteria 2265
244 Ga0207677_10266248 3300026023 Unclassified 1399
245 Ga0207677_10339395 3300026023 Bacteria 1255
246 Ga0207639_10621595 3300026041 Bacteria 997
247 Ga0207678_10017335 3300026067 Bacteria 6322
248 Ga0207708_10004802 3300026075 Bacteria 9953
249 Ga0207708_10201194 3300026075 Bacteria 1589
250 Ga0207702_11397559 3300026078 Bacteria 694
251 Ga0207648_10001155 3300026089 Bacteria 29566
252 Ga0207648_10156714 3300026089 Bacteria 2010
253 Ga0207648_10223623 3300026089 Bacteria 1673
254 Ga0207648_10750603 3300026089 Bacteria 906
255 Ga0207674_10020150 3300026116 Bacteria 7212
256 Ga0207674_10034052 3300026116 Bacteria 5327
257 Ga0207675_100001418 3300026118 Bacteria 24014
258 Ga0207675_100272680 3300026118 Bacteria 1642
259 Ga0207675_101049231 3300026118 Bacteria 834
260 Ga0207683_11472226 3300026121 Bacteria 629
261 Ga0207698_10339997 3300026142 Bacteria 1413
262 Ga0207428_10037296 3300027907 Bacteria 3955
263 Ga0207428_10137844 3300027907 Bacteria 1865
264 Ga0207428_10169191 3300027907 Bacteria 1656
265 Ga0268266_11505721 3300028379 Bacteria 648
266 Ga0268265_11074109 3300028380 Unclassified 798
267 Ga0268265_11276734 3300028380 Bacteria 734
268 Ga0268264_10201588 3300028381 Unclassified 1821
269 Ga0265336_10066774 3300028666 Bacteria 1076
270 Ga0265338_10013423 3300028800 Bacteria 9255
271 Ga0307405_10516735 3300031731 Unclassified 960
272 Ga0307413_10754469 3300031824 Unclassified 814
273 Ga0307406_10029639 3300031901 Bacteria 3315
274 Ga0307406_10198787 3300031901 Bacteria 1474
275 Ga0307407_10565657 3300031903 Bacteria 842
276 Ga0307407_11513073 3300031903 Bacteria 531
277 Ga0307412_10418755 3300031911 Bacteria 1095
278 Ga0307409_100029935 3300031995 Bacteria 3904
279 Ga0307409_100488606 3300031995 Bacteria 1196
280 Ga0307409_100656592 3300031995 Unclassified 1043
281 Ga0307409_100902216 3300031995 Bacteria 897
282 Ga0307416_100120397 3300032002 Bacteria 2337
283 Ga0307416_101522610 3300032002 Bacteria 774
284 Ga0307411_10449499 3300032005 Unclassified 1078
285 Ga0307411_11828672 3300032005 Bacteria 564
286 Ga0307415_100114231 3300032126 Unclassified 2010
287 Ga0307415_100444143 3300032126 Bacteria 1119
288 Ga0316583_10014545 3300032133 Bacteria 2836
289 Ga0373958_0014614 3300034819 Bacteria 1375
290 Ga0373926_0193945 3300035083 Bacteria 781
291 Ga0373949_0018972 3300035090 Bacteria 1563
292 Ga0373923_0313069 3300035111 Bacteria 745
293 Ga0373932_0236770 3300035112 Bacteria 662
294 Ga0373941_0200195 3300035115 Unclassified 759
295 Ga0373945_0235199 3300035116 Bacteria 770
296 Ga0373956_0199189 3300035119 Bacteria 949
297 Ga0373935_0070171 3300035692 Bacteria 2258
298 Ga0373947_0032540 3300035725 Bacteria 3074
299 Ga0373947_0298670 3300035725 Bacteria 1073
300 Ga0373947_0497700 3300035725 Bacteria 828
301 Ga0373925_0277331 3300037068 Bacteria 1350
302 Ga0395899_0003595 3300037312 Bacteria 12264
303 Ga0395899_0014761 3300037312 Bacteria 5963
304 Ga0395899_0029051 3300037312 Bacteria 4159
305 Ga0395899_0033443 3300037312 Bacteria 3861
306 Ga0395899_0064058 3300037312 Bacteria 2703
307 Ga0395899_0071181 3300037312 Bacteria 2545
308 Ga0395899_0175353 3300037312 Bacteria 1508
309 Ga0395899_0290223 3300037312 Unclassified 1110
310 Ga0395899_0310594 3300037312 Bacteria 1065
311 Ga0395899_0439668 3300037312 Unclassified 856
312 Ga0395899_0535389 3300037312 Unclassified 755
313 Ga0395900_0024641 3300037418 Bacteria 6156
314 Ga0395900_0037222 3300037418 Bacteria 5018
315 Ga0395900_0040559 3300037418 Bacteria 4797
316 Ga0395900_0051810 3300037418 Bacteria 4226
317 Ga0395900_0099378 3300037418 Bacteria 2989
318 Ga0395900_0126297 3300037418 Bacteria 2623
319 Ga0395900_0140092 3300037418 Bacteria 2477
320 Ga0395900_0186479 3300037418 Bacteria 2105
321 Ga0395900_0194598 3300037418 Bacteria 2055
322 Ga0395900_0215458 3300037418 Bacteria 1938
323 Ga0395900_0568235 3300037418 Unclassified 1077
324 Ga0395900_0571317 3300037418 Bacteria 1073
325 Ga0395900_0620591 3300037418 Bacteria 1020
326 Ga0395900_0651748 3300037418 Unclassified 989
327 Ga0395898_0011902 3300037466 Bacteria 9010
328 Ga0395898_0082338 3300037466 Bacteria 3102
329 Ga0395898_0094852 3300037466 Bacteria 2867
330 Ga0395898_0161150 3300037466 Bacteria 2145
331 Ga0395898_0163521 3300037466 Bacteria 2129
332 Ga0395898_0194924 3300037466 Bacteria 1935
333 Ga0395898_0225319 3300037466 Bacteria 1788
334 Ga0395898_0362947 3300037466 Unclassified 1381
335 Ga0395898_0380379 3300037466 Bacteria 1346
336 Ga0395898_0394191 3300037466 Unclassified 1320
337 Ga0395898_0429845 3300037466 Bacteria 1258
338 Ga0395898_0810223 3300037466 Unclassified 876
339 Ga0395898_1215620 3300037466 Bacteria 684
340 Ga0395898_1665251 3300037466 Bacteria 561
341 Ga0395898_1772833 3300037466 Unclassified 539
342 Ga0395905_0008511 3300037471 Bacteria 10115
343 Ga0395905_0017272 3300037471 Bacteria 6854
344 Ga0395905_0024793 3300037471 Bacteria 5660
345 Ga0395905_0031084 3300037471 Bacteria 5028
346 Ga0395905_0084798 3300037471 Bacteria 2969
347 Ga0395905_0109344 3300037471 Bacteria 2595
348 Ga0395905_0166321 3300037471 Bacteria 2073
349 Ga0395905_0200189 3300037471 Bacteria 1872
350 Ga0395905_0241520 3300037471 Bacteria 1688
351 Ga0395905_0345425 3300037471 Bacteria 1379
352 Ga0395905_0518042 3300037471 Bacteria 1093
353 Ga0395905_0560564 3300037471 Unclassified 1044
354 Ga0395905_1017393 3300037471 Bacteria 732
355 Ga0395905_1056480 3300037471 Unclassified 715
356 Ga0395905_1228990 3300037471 Bacteria 653
357 Ga0395905_1282086 3300037471 Bacteria 636
358 Ga0395901_0006469 3300038443 Bacteria 11866
359 Ga0395901_0008558 3300038443 Bacteria 10339
360 Ga0395901_0019556 3300038443 Bacteria 6921
361 Ga0395901_0027774 3300038443 Bacteria 5819
362 Ga0395901_0036741 3300038443 Bacteria 5063
363 Ga0395901_0039623 3300038443 Bacteria 4877
364 Ga0395901_0050767 3300038443 Bacteria 4308
365 Ga0395901_0151765 3300038443 Bacteria 2434
366 Ga0395901_0245761 3300038443 Bacteria 1865
367 Ga0395901_0341281 3300038443 Bacteria 1547
368 Ga0395901_0358899 3300038443 Unclassified 1503
369 Ga0395901_0386363 3300038443 Bacteria 1440
370 Ga0395901_0409271 3300038443 Bacteria 1393
371 Ga0395901_0525422 3300038443 Bacteria 1202
372 Ga0395901_1005519 3300038443 Bacteria 809
373 Ga0395901_1549794 3300038443 Bacteria 617
374 Ga0395901_1690002 3300038443 Unclassified 584
375 Ga0395901_1942646 3300038443 Bacteria 535
376 Ga0436360_1196285 3300039438 Bacteria 782
377 Ga0436362_0962921 3300039453 Bacteria 537
378 Ga0439439_0099787 3300041406 Bacteria 799
379 Ga0439461_0089547 3300041410 Bacteria 736
380 Ga0451798_0326687 3300041458 Bacteria 893
381 Ga0451800_0695075 3300041459 Bacteria 608
382 Ga0451807_2411212 3300041486 Bacteria 945
383 Ga0451839_0039800 3300041496 Unclassified 510
384 Ga0439431_0071282 3300041997 Unclassified 926
385 Ga0450920_001147 3300042122 Bacteria 4342
386 Ga0450921_011803 3300042123 Bacteria 750
387 Ga0450910_011882 3300042147 Bacteria 1254
388 Ga0439446_0009643 3300042156 Bacteria 2588
389 Ga0439434_0020112 3300042435 Unclassified 2004
390 Ga0450918_014900 3300042531 Bacteria 1351
391 Ga0439440_0117777 3300042993 Bacteria 737
392 Ga0466969_0107267 3300044656 Bacteria 1310
393 Ga0466966_0015368 3300044684 Bacteria 5062
394 Ga0466963_0492845 3300044694 Bacteria 865
395 Ga0466964_0282178 3300044706 Bacteria 830
396 Ga0466964_0524450 3300044706 Bacteria 639
397 Ga0466964_0530149 3300044706 Bacteria 636
398 Ga0466971_0106653 3300044719 Archaea 1291
399 Ga0466968_0052744 3300044735 Bacteria 1740
400 Ga0466957_0031328 3300044842 Bacteria 3178
401 Ga0451576_0042988 3300045051 Bacteria 4769
402 Ga0451576_2537745 3300045051 Unclassified 523
403 Ga0466958_0007734 3300045836 Bacteria 5928
404 Ga0466967_0000056 3300045976 Bacteria 40207
405 Ga0466967_0033118 3300045976 Bacteria 4373
406 Ga0466967_0035994 3300045976 Bacteria 4221
407 Ga0466967_0142663 3300045976 Bacteria 2232
408 Ga0466967_0225321 3300045976 Bacteria 1783
409 Ga0466967_1185002 3300045976 Bacteria 761
410 Ga0466967_1449815 3300045976 Bacteria 684
411 Ga0495603_0076715 3300046455 Bacteria 1961
412 Ga0495603_0113938 3300046455 Bacteria 1577
413 Ga0495603_0118128 3300046455 Bacteria 1546
414 Ga0495603_0195120 3300046455 Bacteria 1170
415 Ga0495590_0277138 3300046457 Bacteria 628
416 Ga0495629_0130222 3300046459 Bacteria 1752
417 Ga0495641_0402988 3300046461 Unclassified 621
418 Ga0495651_0865528 3300046462 Unclassified 554
419 Ga0495580_0128707 3300046472 Bacteria 1757
420 Ga0495582_0055327 3300046473 Bacteria 2187
421 Ga0495605_0156860 3300046474 Unclassified 1012
422 Ga0495639_0053402 3300046475 Bacteria 1841
423 Ga0495639_0054076 3300046475 Bacteria 1830
424 Ga0495639_0176227 3300046475 Bacteria 1040
425 Ga0495584_0027162 3300046491 Bacteria 2901
426 Ga0495584_0096017 3300046491 Bacteria 1497
427 Ga0495584_0622967 3300046491 Bacteria 550
428 Ga0495585_0125181 3300046492 Bacteria 1357
429 Ga0495585_0478845 3300046492 Bacteria 593
430 Ga0495585_0487216 3300046492 Bacteria 587
431 Ga0495594_0057023 3300046499 Bacteria 2157
432 Ga0495594_0232371 3300046499 Bacteria 1051
433 Ga0495596_0126824 3300046500 Bacteria 991
434 Ga0495596_0133685 3300046500 Bacteria 963
435 Ga0495596_0140571 3300046500 Bacteria 937
436 Ga0495607_0176670 3300046501 Unclassified 1074
437 Ga0495607_0387804 3300046501 Bacteria 638
438 Ga0495616_0249415 3300046513 Bacteria 763
439 Ga0495630_0591054 3300046517 Bacteria 851
440 Ga0495631_0260565 3300046518 Bacteria 739
441 Ga0495637_0253119 3300046520 Bacteria 634
442 Ga0495637_0312321 3300046520 Bacteria 556
443 Ga0495644_0047910 3300046523 Bacteria 1605
444 Ga0495644_0100033 3300046523 Bacteria 1097
445 Ga0495644_0453752 3300046523 Bacteria 510
446 Ga0495663_0095320 3300046525 Bacteria 974
447 Ga0495663_0131090 3300046525 Bacteria 845
448 Ga0495663_0239519 3300046525 Bacteria 642
449 Ga0495666_0315052 3300046526 Bacteria 706
450 Ga0495642_0183693 3300046528 Bacteria 910
451 Ga0495642_0310342 3300046528 Unclassified 692
452 Ga0495642_0354067 3300046528 Bacteria 645
453 Ga0495665_0154227 3300046531 Bacteria 1198
454 Ga0495587_0790239 3300046536 Bacteria 518
455 Ga0495598_0066797 3300046537 Unclassified 1123
456 Ga0495598_0304588 3300046537 Unclassified 604
457 Ga0495609_0078879 3300046538 Bacteria 1441
458 Ga0495609_0090509 3300046538 Bacteria 1331
459 Ga0495609_0224261 3300046538 Unclassified 780
460 Ga0495609_0235570 3300046538 Bacteria 757
461 Ga0495621_0244434 3300046539 Bacteria 732
462 Ga0495633_0232995 3300046558 Unclassified 842
463 Ga0495656_0175085 3300046615 Bacteria 1051
464 Ga0495656_0329901 3300046615 Bacteria 787
465 Ga0495668_0238058 3300046616 Bacteria 997
466 Ga0495668_0483937 3300046616 Unclassified 682
467 Ga0495611_0040915 3300046648 Unclassified 2067
468 Ga0495611_0068246 3300046648 Bacteria 1623
469 Ga0495611_0395607 3300046648 Bacteria 632
470 Ga0495659_0109635 3300046664 Bacteria 1077
471 Ga0495661_0385885 3300046665 Bacteria 683
472 Ga0495661_0538081 3300046665 Unclassified 554
473 Ga0495588_0129807 3300046674 Bacteria 1329
474 Ga0495588_0172861 3300046674 Bacteria 1142
475 Ga0495588_0371867 3300046674 Bacteria 751
476 Ga0495658_0711119 3300046683 Bacteria 643
477 Ga0495613_0026984 3300046689 Bacteria 4275
478 Ga0495624_0333789 3300046690 Bacteria 912
479 Ga0495670_0118430 3300046691 Unclassified 1375
480 Ga0495670_0240548 3300046691 Bacteria 964
481 Ga0495670_0417030 3300046691 Bacteria 726
482 Ga0495671_0459034 3300046692 Bacteria 609
483 Ga0495671_0608964 3300046692 Bacteria 519
484 Ga0495589_0012402 3300046794 Bacteria 4414
485 Ga0495589_0084937 3300046794 Bacteria 1538
486 Ga0495660_0415431 3300046810 Bacteria 587
487 Ga0495581_0001339 3300047315 Bacteria 13606
488 Ga0495581_0026920 3300047315 Bacteria 3334
489 Ga0495636_0603259 3300047318 Bacteria 537
490 Ga0495676_0112220 3300047321 Bacteria 1998
491 Ga0495677_0068529 3300047445 Bacteria 1321
492 Ga0495677_0144600 3300047445 Bacteria 914
493 Ga0495677_0243218 3300047445 Bacteria 703
494 Ga0495677_0265093 3300047445 Bacteria 673
495 Ga0495685_214738 3300047447 Unclassified 615
496 Ga0495614_0083571 3300048089 Bacteria 1385
497 Ga0495615_0202011 3300048090 Bacteria 614
498 Ga0496100_0039134 3300048903 Bacteria 3010
499 Ga0496100_0532345 3300048903 Bacteria 907
500 Ga0496101_0106736 3300048904 Bacteria 2103
501 Ga0496101_0285076 3300048904 Bacteria 1292
502 Ga0496101_0696894 3300048904 Bacteria 802
503 Ga0496102_0465557 3300048905 Bacteria 1185
504 Ga0496102_1065986 3300048905 Bacteria 728
505 Ga0496103_0298628 3300048906 Bacteria 1036
506 Ga0496103_0855817 3300048906 Bacteria 572
507 Ga0496104_0000647 3300048907 Bacteria 29839
508 Ga0496104_0009894 3300048907 Bacteria 8513
509 Ga0496105_0043284 3300048908 Bacteria 3713
510 Ga0496105_0048769 3300048908 Bacteria 3495
511 Ga0496106_0218534 3300048909 Bacteria 1519
512 Ga0496108_0022580 3300048911 Bacteria 5174
513 Ga0496108_0069984 3300048911 Bacteria 2961
514 Ga0496108_0079904 3300048911 Bacteria 2769
515 Ga0496109_0008233 3300048912 Bacteria 8851
516 Ga0496109_0018123 3300048912 Bacteria 6182
517 Ga0496109_0268601 3300048912 Bacteria 1607
518 Ga0496109_1018874 3300048912 Bacteria 765
519 Ga0496110_0074374 3300048913 Unclassified 3017
520 Ga0496110_0345494 3300048913 Bacteria 1355
521 Ga0496110_1422057 3300048913 Bacteria 603
522 Ga0496111_0010483 3300048914 Bacteria 6222
523 Ga0496111_0032424 3300048914 Bacteria 3725
524 Ga0496111_0389045 3300048914 Bacteria 1031
525 Ga0496111_0457022 3300048914 Bacteria 942
526 Ga0496112_0028386 3300048915 Bacteria 5400
527 Ga0496112_0337435 3300048915 Bacteria 1451
528 Ga0496112_0832781 3300048915 Bacteria 847
529 Ga0496113_0020678 3300048916 Bacteria 4633
530 Ga0496113_0049095 3300048916 Bacteria 3142
531 Ga0496113_0332691 3300048916 Bacteria 1218
532 Ga0496113_1075492 3300048916 Bacteria 632
533 Ga0496114_0556489 3300048917 Bacteria 1013
534 Ga0496114_0926387 3300048917 Bacteria 753
535 Ga0496115_0005787 3300048918 Bacteria 9000
536 Ga0496115_0124534 3300048918 Bacteria 2123
537 Ga0496115_1211174 3300048918 Bacteria 567
538 Ga0501031_0081321 3300049568 Bacteria 2112
539 Ga0501038_0059558 3300049574 Bacteria 3271
540 Ga0501039_0085366 3300049575 Bacteria 2459
541 Ga0501040_0180731 3300049576 Bacteria 1495
542 Ga0501041_0047742 3300049577 Bacteria 2607
543 Ga0501042_0034114 3300049578 Bacteria 3609
544 Ga0501042_0403245 3300049578 Bacteria 991
545 Ga0501042_1316326 3300049578 Bacteria 527
546 Ga0501048_0239819 3300049582 Bacteria 1286
547 Ga0501048_0572354 3300049582 Bacteria 811
548 Ga0501048_1096722 3300049582 Bacteria 573
549 Ga0501068_0068318 3300049584 Bacteria 2166
550 Ga0501069_0268620 3300049585 Bacteria 997
551 Ga0501071_0086865 3300049587 Bacteria 2294
552 Ga0501072_0034796 3300049588 Bacteria 3947
553 Ga0501072_0440107 3300049588 Bacteria 1033
554 Ga0501075_0234428 3300049591 Bacteria 1399
555 Ga0501075_0464213 3300049591 Bacteria 966
556 Ga0501075_0696656 3300049591 Bacteria 774
557 Ga0501076_0001971 3300049592 Bacteria 14012
558 Ga0501076_0057655 3300049592 Bacteria 3085
559 Ga0501076_0572748 3300049592 Unclassified 931
560 Ga0501077_0092825 3300049593 Bacteria 1913
561 Ga0501079_0265756 3300049741 Bacteria 1341
562 Ga0501080_0193959 3300049742 Bacteria 1866
563 Ga0501080_0987214 3300049742 Bacteria 731
564 Ga0501081_0886581 3300049743 Bacteria 673
565 Ga0501081_1163063 3300049743 Bacteria 584
566 Ga0501083_1000978 3300049744 Bacteria 544
567 Ga0501045_1194440 3300049824 Bacteria 555
568 nmdc:mga03683_368139_c1 3300050489 Unclassified 682
569 nmdc:mga0yw44_174603_c1 3300050492 Bacteria 1412
570 nmdc:mga05p37_1064659_c1 3300050507 Unclassified 851
571 nmdc:mga05p37_108174_c1 3300050507 Bacteria 3420
572 nmdc:mga05p37_154584_c1 3300050507 Bacteria 2804
573 nmdc:mga05p37_2121315_c1 3300050507 Bacteria 526
574 nmdc:mga05p37_47671_c1 3300050507 Bacteria 5269
575 nmdc:mga05p37_75219_c1 3300050507 Bacteria 4157
576 nmdc:mga09592_379580_c1 3300050508 Bacteria 1222
577 nmdc:mga06r32_195516_c1 3300050510 Bacteria 2010
578 nmdc:mga06r32_495478_c1 3300050510 Bacteria 1199
579 nmdc:mga08y16_1084284_c1 3300050511 Unclassified 777
580 nmdc:mga08y16_24059_c1 3300050511 Bacteria 6431
581 nmdc:mga08y16_481309_c1 3300050511 Unclassified 1263
582 nmdc:mga0n895_193934_c1 3300050512 Bacteria 2062
583 nmdc:mga0n895_839823_c1 3300050512 Bacteria 907
584 nmdc:mga0rr50_188714_c1 3300050513 Bacteria 1688
585 nmdc:mga08x19_191446_c1 3300050514 Unclassified 1399
586 nmdc:mga0a205_773854_c1 3300050515 Bacteria 808
587 Ga0495619_0577426 3300053085 Unclassified 770
588 Ga0501084_0020100 3300054114 Bacteria 5568
589 Ga0590075_217527 3300059424 Bacteria 506
590 Ga0587076_107552 3300059645 Unclassified 631
591 Ga0587071_024583 3300060344 Bacteria 1125
592 Ga0501082_0051100 3300060353 Bacteria 3563
593 Ga0530510_0344512 3300061734 Bacteria 1119
594 Ga0530510_0516119 3300061734 Bacteria 906
595 Ga0157380_12412335
596 Ga0070683_100014121
597 Ga0068869_100445125
598 Ga0070666_10529751
599 Ga0068868_100015257
600 Ga0068868_100364244
601 Ga0070660_101289014
602 Ga0070689_100011564
603 Ga0070689_100800386
604 Ga0070687_100883403
605 Ga0070692_11168051
606 Ga0070668_100007902
607 Ga0070675_100008011
608 Ga0070675_100288388
609 Ga0070671_101455514
610 Ga0070674_100086678
611 Ga0070674_100233179
612 Ga0070674_100439912
613 Ga0070673_100075688
614 Ga0070659_100047318
615 Ga0070709_10076295
616 Ga0070714_100098415
617 Ga0070714_100183372
618 Ga0070714_100222032
619 Ga0070714_101042422
620 Ga0070714_101287591
621 Ga0070714_102038543
622 Ga0070713_100045171
623 Ga0070713_100070322
624 Ga0070713_100100236
625 Ga0070710_10471467
626 Ga0070711_101390111
627 Ga0070711_101486592
628 Ga0070705_100382066
629 Ga0070700_100163371
630 Ga0070708_100033833
631 Ga0070708_100160627
632 Ga0070663_100024320
633 Ga0070663_100477393
634 Ga0070678_100489837
635 Ga0070678_101823092
636 Ga0070662_100627746
637 Ga0068867_100248762
638 Ga0068867_100355336
639 Ga0070706_100004764
640 Ga0070706_100237992
641 Ga0070706_100586113
642 Ga0070707_100002038
643 Ga0070707_100682721
644 Ga0070698_100004845
645 Ga0070698_100133341
646 Ga0070698_100322068
647 Ga0070698_100386996
648 Ga0070699_100070518
649 Ga0070699_101147826
650 Ga0070679_101324131
651 Ga0070684_100001762
652 Ga0070684_100008993
653 Ga0070697_100241836
654 Ga0070672_100174911
655 Ga0070686_100113260
656 Ga0070695_100224967
657 Ga0070695_100815368
658 Ga0070696_101251054
659 Ga0070704_100015880
660 Ga0070704_100067625
661 Ga0070704_101905241
662 Ga0068855_100025809
663 Ga0068857_100010331
664 Ga0068857_100019586
665 Ga0068854_100806004
666 Ga0068854_101406567
667 Ga0068856_101791351
668 Ga0068866_10592916
669 Ga0068861_100000713
670 Ga0068861_100139603
671 Ga0068861_100474111
672 Ga0068861_100861257
673 Ga0068870_10271485
674 Ga0068863_102694952
675 Ga0068858_100975785
676 Ga0068860_101328148
677 Ga0068862_100252026
678 Ga0068862_100471990
679 Ga0081455_10052565
680 Ga0081455_10121148
681 Ga0081455_10188361
682 Ga0081540_1003040
683 Ga0081539_10117171
684 Ga0070717_10050699
685 Ga0070717_10060400
686 Ga0070717_10093185
687 Ga0070717_10939103
688 Ga0075365_10103578
689 Ga0075365_10665841
690 Ga0075364_10648564
691 Ga0070715_10102578
692 Ga0070712_101606134
693 Ga0097621_102034652
694 Ga0068871_100285973
695 Ga0068871_101631168
696 Ga0075428_100162383
697 Ga0075428_100586492
698 Ga0075428_100599993
699 Ga0075428_101002917
700 Ga0075428_101028418
701 Ga0075428_101299761
702 Ga0075431_100207632
703 Ga0075431_100364676
704 Ga0075433_10110150
705 Ga0075433_11348036
706 Ga0075434_100079856
707 Ga0075434_100205577
708 Ga0075434_101185685
709 Ga0075429_100519917
710 Ga0068865_100047832
711 Ga0068865_100395841
712 Ga0068865_100784764
713 Ga0068865_101853643
714 Ga0075436_100024049
715 Ga0075436_100087509
716 Ga0075436_100443203
717 Ga0075435_100136468
718 Ga0111539_10015626
719 Ga0111539_10023141
720 Ga0111539_10538129
721 Ga0111539_10607938
722 Ga0111539_10974172
723 Ga0111539_12467712
724 Ga0105245_10007387
725 Ga0105245_10013687
726 Ga0105245_10031433
727 Ga0105245_10133461
728 Ga0105245_10588524
729 Ga0114129_10010379
730 Ga0114129_10082990
731 Ga0114129_10100469
732 Ga0114129_10180117
733 Ga0114129_11899571
734 Ga0105243_10220262
735 Ga0105243_10486571
736 Ga0105243_10505730
737 Ga0105243_10687496
738 Ga0105243_10727188
739 Ga0105241_10082368
740 Ga0105242_10256315
741 Ga0105242_10370822
742 Ga0105248_10148863
743 Ga0105238_11701936
744 Ga0105249_10004532
745 Ga0105239_10118949
746 Ga0105239_10663113
747 Ga0105239_11043217
748 Ga0105239_11748213
749 Ga0105246_10032927
750 Ga0105246_10220806
751 Ga0157342_1023042
752 Ga0157373_10925106
753 Ga0157374_10003624
754 Ga0157374_10337487
755 Ga0157374_12698248
756 Ga0163162_10037855
757 Ga0163162_11090620
758 Ga0157372_11752571
759 Ga0157375_10004528
760 Ga0157375_10202258
761 Ga0157375_11270409
762 Ga0157380_10629824
763 Ga0157380_13462920
764 Ga0182008_10066480
765 Ga0182008_10171867
766 Ga0182008_10862106
767 Ga0157377_10003876
768 Ga0157379_10462964
769 Ga0157376_11785640
770 Ga0182006_1176706
771 Ga0182007_10184134
772 Ga0163161_10018172
773 Ga0163161_10277807
774 Ga0163161_10478932
775 Ga0224712_10325945
776 Ga0207653_10031353
777 Ga0207682_10267574
778 Ga0207692_10116434
779 Ga0207642_10203726
780 Ga0207642_10445538
781 Ga0207685_10082309
782 Ga0207699_10218101
783 Ga0207699_11103917
784 Ga0207643_10407344
785 Ga0207684_10098320
786 Ga0207684_10390383
787 Ga0207707_10277628
788 Ga0207693_10000406
789 Ga0207693_11314361
790 Ga0207663_10182835
791 Ga0207663_10807100
792 Ga0207660_11007837
793 Ga0207662_10112777
794 Ga0207657_11392071
795 Ga0207652_10159740
796 Ga0207646_10016601
797 Ga0207681_10668967
798 Ga0207687_10054274
799 Ga0207687_10111346
800 Ga0207687_10682426
801 Ga0207687_11042660
802 Ga0207687_11492800
803 Ga0207700_10774707
804 Ga0207700_11464055
805 Ga0207664_10006068
806 Ga0207664_10100558
807 Ga0207664_10342776
808 Ga0207664_10686427
809 Ga0207664_10819988
810 Ga0207644_10842137
811 Ga0207706_10009893
812 Ga0207706_10106286
813 Ga0207706_10218119
814 Ga0207686_10184478
815 Ga0207709_10073375
816 Ga0207709_10111904
817 Ga0207670_10237202
818 Ga0207670_11602512
819 Ga0207669_10021079
820 Ga0207669_10169808
821 Ga0207669_10214784
822 Ga0207669_10326986
823 Ga0207665_10066334
824 Ga0207691_10029192
825 Ga0207711_11182773
826 Ga0207689_10119157
827 Ga0207661_10007997
828 Ga0207661_10066450
829 Ga0207661_11287590
830 Ga0207679_10136111
831 Ga0207667_10175533
832 Ga0207667_10890445
833 Ga0207651_10019919
834 Ga0207712_10082738
835 Ga0207668_10006859
836 Ga0207640_10959317
837 Ga0207677_10086544
838 Ga0207677_10266248
839 Ga0207677_10339395
840 Ga0207639_10621595
841 Ga0207678_10017335
842 Ga0207708_10004802
843 Ga0207708_10201194
844 Ga0207702_11397559
845 Ga0207648_10001155
846 Ga0207648_10156714
847 Ga0207648_10223623
848 Ga0207648_10750603
849 Ga0207674_10020150
850 Ga0207674_10034052
851 Ga0207675_100001418
852 Ga0207675_100272680
853 Ga0207675_101049231
854 Ga0207683_11472226
855 Ga0207698_10339997
856 Ga0207428_10037296
857 Ga0207428_10137844
858 Ga0207428_10169191
859 Ga0268266_11505721
860 Ga0268265_11074109
861 Ga0268265_11276734
862 Ga0268264_10201588
863 Ga0265336_10066774
864 Ga0265338_10013423
865 Ga0307405_10516735
866 Ga0307413_10754469
867 Ga0307406_10029639
868 Ga0307406_10198787
869 Ga0307407_10565657
870 Ga0307407_11513073
871 Ga0307412_10418755
872 Ga0307409_100029935
873 Ga0307409_100488606
874 Ga0307409_100656592
875 Ga0307409_100902216
876 Ga0307416_100120397
877 Ga0307416_101522610
878 Ga0307411_10449499
879 Ga0307411_11828672
880 Ga0307415_100114231
881 Ga0307415_100444143
882 Ga0316583_10014545
883 Ga0373958_0014614
884 Ga0373926_0193945
885 Ga0373949_0018972
886 Ga0373923_0313069
887 Ga0373932_0236770
888 Ga0373941_0200195
889 Ga0373945_0235199
890 Ga0373956_0199189
891 Ga0373935_0070171
892 Ga0373947_0032540
893 Ga0373947_0298670
894 Ga0373947_0497700
895 Ga0373925_0277331
896 Ga0395899_0003595
897 Ga0395899_0014761
898 Ga0395899_0029051
899 Ga0395899_0033443
900 Ga0395899_0064058
901 Ga0395899_0071181
902 Ga0395899_0175353
903 Ga0395899_0290223
904 Ga0395899_0310594
905 Ga0395899_0439668
906 Ga0395899_0535389
907 Ga0395900_0024641
908 Ga0395900_0037222
909 Ga0395900_0040559
910 Ga0395900_0051810
911 Ga0395900_0099378
912 Ga0395900_0126297
913 Ga0395900_0140092
914 Ga0395900_0186479
915 Ga0395900_0194598
916 Ga0395900_0215458
917 Ga0395900_0568235
918 Ga0395900_0571317
919 Ga0395900_0620591
920 Ga0395900_0651748
921 Ga0395898_0011902
922 Ga0395898_0082338
923 Ga0395898_0094852
924 Ga0395898_0161150
925 Ga0395898_0163521
926 Ga0395898_0194924
927 Ga0395898_0225319
928 Ga0395898_0362947
929 Ga0395898_0380379
930 Ga0395898_0394191
931 Ga0395898_0429845
932 Ga0395898_0810223
933 Ga0395898_1215620
934 Ga0395898_1665251
935 Ga0395898_1772833
936 Ga0395905_0008511
937 Ga0395905_0017272
938 Ga0395905_0024793
939 Ga0395905_0031084
940 Ga0395905_0084798
941 Ga0395905_0109344
942 Ga0395905_0166321
943 Ga0395905_0200189
944 Ga0395905_0241520
945 Ga0395905_0345425
946 Ga0395905_0518042
947 Ga0395905_0560564
948 Ga0395905_1017393
949 Ga0395905_1056480
950 Ga0395905_1228990
951 Ga0395905_1282086
952 Ga0395901_0006469
953 Ga0395901_0008558
954 Ga0395901_0019556
955 Ga0395901_0027774
956 Ga0395901_0036741
957 Ga0395901_0039623
958 Ga0395901_0050767
959 Ga0395901_0151765
960 Ga0395901_0245761
961 Ga0395901_0341281
962 Ga0395901_0358899
963 Ga0395901_0386363
964 Ga0395901_0409271
965 Ga0395901_0525422
966 Ga0395901_1005519
967 Ga0395901_1549794
968 Ga0395901_1690002
969 Ga0395901_1942646
970 Ga0436360_1196285
971 Ga0436362_0962921
972 Ga0439439_0099787
973 Ga0439461_0089547
974 Ga0451798_0326687
975 Ga0451800_0695075
976 Ga0451807_2411212
977 Ga0451839_0039800
978 Ga0439431_0071282
979 Ga0450920_001147
980 Ga0450921_011803
981 Ga0450910_011882
982 Ga0439446_0009643
983 Ga0439434_0020112
984 Ga0450918_014900
985 Ga0439440_0117777
986 Ga0466969_0107267
987 Ga0466966_0015368
988 Ga0466963_0492845
989 Ga0466964_0282178
990 Ga0466964_0524450
991 Ga0466964_0530149
992 Ga0466971_0106653
993 Ga0466968_0052744
994 Ga0466957_0031328
995 Ga0451576_0042988
996 Ga0451576_2537745
997 Ga0466958_0007734
998 Ga0466967_0000056
999 Ga0466967_0033118
1000 Ga0466967_0035994
1001 Ga0466967_0142663
1002 Ga0466967_0225321
1003 Ga0466967_1185002
1004 Ga0466967_1449815
1005 Ga0495603_0076715
1006 Ga0495603_0113938
1007 Ga0495603_0118128
1008 Ga0495603_0195120
1009 Ga0495590_0277138
1010 Ga0495629_0130222
1011 Ga0495641_0402988
1012 Ga0495651_0865528
1013 Ga0495580_0128707
1014 Ga0495582_0055327
1015 Ga0495605_0156860
1016 Ga0495639_0053402
1017 Ga0495639_0054076
1018 Ga0495639_0176227
1019 Ga0495584_0027162
1020 Ga0495584_0096017
1021 Ga0495584_0622967
1022 Ga0495585_0125181
1023 Ga0495585_0478845
1024 Ga0495585_0487216
1025 Ga0495594_0057023
1026 Ga0495594_0232371
1027 Ga0495596_0126824
1028 Ga0495596_0133685
1029 Ga0495596_0140571
1030 Ga0495607_0176670
1031 Ga0495607_0387804
1032 Ga0495616_0249415
1033 Ga0495630_0591054
1034 Ga0495631_0260565
1035 Ga0495637_0253119
1036 Ga0495637_0312321
1037 Ga0495644_0047910
1038 Ga0495644_0100033
1039 Ga0495644_0453752
1040 Ga0495663_0095320
1041 Ga0495663_0131090
1042 Ga0495663_0239519
1043 Ga0495666_0315052
1044 Ga0495642_0183693
1045 Ga0495642_0310342
1046 Ga0495642_0354067
1047 Ga0495665_0154227
1048 Ga0495587_0790239
1049 Ga0495598_0066797
1050 Ga0495598_0304588
1051 Ga0495609_0078879
1052 Ga0495609_0090509
1053 Ga0495609_0224261
1054 Ga0495609_0235570
1055 Ga0495621_0244434
1056 Ga0495633_0232995
1057 Ga0495656_0175085
1058 Ga0495656_0329901
1059 Ga0495668_0238058
1060 Ga0495668_0483937
1061 Ga0495611_0040915
1062 Ga0495611_0068246
1063 Ga0495611_0395607
1064 Ga0495659_0109635
1065 Ga0495661_0385885
1066 Ga0495661_0538081
1067 Ga0495588_0129807
1068 Ga0495588_0172861
1069 Ga0495588_0371867
1070 Ga0495658_0711119
1071 Ga0495613_0026984
1072 Ga0495624_0333789
1073 Ga0495670_0118430
1074 Ga0495670_0240548
1075 Ga0495670_0417030
1076 Ga0495671_0459034
1077 Ga0495671_0608964
1078 Ga0495589_0012402
1079 Ga0495589_0084937
1080 Ga0495660_0415431
1081 Ga0495581_0001339
1082 Ga0495581_0026920
1083 Ga0495636_0603259
1084 Ga0495676_0112220
1085 Ga0495677_0068529
1086 Ga0495677_0144600
1087 Ga0495677_0243218
1088 Ga0495677_0265093
1089 Ga0495685_214738
1090 Ga0495614_0083571
1091 Ga0495615_0202011
1092 Ga0496100_0039134
1093 Ga0496100_0532345
1094 Ga0496101_0106736
1095 Ga0496101_0285076
1096 Ga0496101_0696894
1097 Ga0496102_0465557
1098 Ga0496102_1065986
1099 Ga0496103_0298628
1100 Ga0496103_0855817
1101 Ga0496104_0000647
1102 Ga0496104_0009894
1103 Ga0496105_0043284
1104 Ga0496105_0048769
1105 Ga0496106_0218534
1106 Ga0496108_0022580
1107 Ga0496108_0069984
1108 Ga0496108_0079904
1109 Ga0496109_0008233
1110 Ga0496109_0018123
1111 Ga0496109_0268601
1112 Ga0496109_1018874
1113 Ga0496110_0074374
1114 Ga0496110_0345494
1115 Ga0496110_1422057
1116 Ga0496111_0010483
1117 Ga0496111_0032424
1118 Ga0496111_0389045
1119 Ga0496111_0457022
1120 Ga0496112_0028386
1121 Ga0496112_0337435
1122 Ga0496112_0832781
1123 Ga0496113_0020678
1124 Ga0496113_0049095
1125 Ga0496113_0332691
1126 Ga0496113_1075492
1127 Ga0496114_0556489
1128 Ga0496114_0926387
1129 Ga0496115_0005787
1130 Ga0496115_0124534
1131 Ga0496115_1211174
1132 Ga0501031_0081321
1133 Ga0501038_0059558
1134 Ga0501039_0085366
1135 Ga0501040_0180731
1136 Ga0501041_0047742
1137 Ga0501042_0034114
1138 Ga0501042_0403245
1139 Ga0501042_1316326
1140 Ga0501048_0239819
1141 Ga0501048_0572354
1142 Ga0501048_1096722
1143 Ga0501068_0068318
1144 Ga0501069_0268620
1145 Ga0501071_0086865
1146 Ga0501072_0034796
1147 Ga0501072_0440107
1148 Ga0501075_0234428
1149 Ga0501075_0464213
1150 Ga0501075_0696656
1151 Ga0501076_0001971
1152 Ga0501076_0057655
1153 Ga0501076_0572748
1154 Ga0501077_0092825
1155 Ga0501079_0265756
1156 Ga0501080_0193959
1157 Ga0501080_0987214
1158 Ga0501081_0886581
1159 Ga0501081_1163063
1160 Ga0501083_1000978
1161 Ga0501045_1194440
1162 nmdc:mga03683_368139_c1
1163 nmdc:mga0yw44_174603_c1
1164 nmdc:mga05p37_1064659_c1
1165 nmdc:mga05p37_108174_c1
1166 nmdc:mga05p37_154584_c1
1167 nmdc:mga05p37_2121315_c1
1168 nmdc:mga05p37_47671_c1
1169 nmdc:mga05p37_75219_c1
1170 nmdc:mga09592_379580_c1
1171 nmdc:mga06r32_195516_c1
1172 nmdc:mga06r32_495478_c1
1173 nmdc:mga08y16_1084284_c1
1174 nmdc:mga08y16_24059_c1
1175 nmdc:mga08y16_481309_c1
1176 nmdc:mga0n895_193934_c1
1177 nmdc:mga0n895_839823_c1
1178 nmdc:mga0rr50_188714_c1
1179 nmdc:mga08x19_191446_c1
1180 nmdc:mga0a205_773854_c1
1181 Ga0495619_0577426
1182 Ga0501084_0020100
1183 Ga0590075_217527
1184 Ga0587076_107552
1185 Ga0587071_024583
1186 Ga0501082_0051100
1187 Ga0530510_0344512
1188 Ga0530510_0516119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

17

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wci-assembly1.cif.gz_A structure of e. coli monothiol glutaredoxin grx4 homodimer 0.9489 5 102
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9392 3 102
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9287 3 105
3zyw-assembly1.cif.gz_A crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) 0.9228 2 97
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9135 4 104
ID Description Score Start End Superfamily
af_Q555C8_40_141_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9763 7 102 3.40.30.10
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9723 8 93 3.40.30.10
2wemC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.959 6 101 3.40.30.10
af_Q8IBZ7_179_272_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9588 9 97 3.40.30.10
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9565 7 95 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1Q7WX43-F1-model_v4 Glutaredoxin 1.004 3 117 GO:0015036
GO:0046872
GO:0051537
AF-A0A538JX23-F1-model_v4 Glutaredoxin 0.9948 1 117 GO:0015036
GO:0046872
GO:0051537
AF-A0A538FHJ8-F1-model_v4 Glutaredoxin domain-containing protein 0.9936 20 119
AF-A0A838I5E6-F1-model_v4 Grx4 family monothiol glutaredoxin 0.9903 3 99 GO:0046872
GO:0051537
AF-A0A537TUY1-F1-model_v4 Grx4 family monothiol glutaredoxin 0.9901 1 119 GO:0046872
GO:0051537

Map