F467272

General Info

Members Datasets Scaffolds Average Seq Length
593 213 1186 396

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0131442|Ga0496107_0131442_94_1176
Length 360
Sequence MRVVALAAGTNVERLADQIAAHLPELVSVDNEAAAHDLRAMLFARDIDLPRIVTGEAGLVEVATYPEADCVISATVGAIGFVPTLKALEMGKRVALANKETLVMAGELMTQAARQSGAELLPVDSEHNALHQCLRGERREEVRRIILTASGGPFRTKNKAEMKLASVSEAMQHPTWSMGAKITIDSATLMNKGLEVIEAHWLFGFGPDEIDILVHPESVVHSMIEMVDGSVIAQMGITYPERHSCQLPPLDLAAVSGLHFETPDLERFPCIALAYRALREGGTLPAAMNAANEEAVSAFINERICLTEIPQIIQTVMDEHSNQPAKDIQTILEADHHARLAAVDAIDAACEAGASIKPGA

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
197 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
198 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
199 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
200 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
201 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.69
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0131442 3300048910 Bacteria 1848
2 SwRhRL2b_contig_969129 2162886007 Bacteria 1571
3 CNAas_1001177 3300000532 Bacteria 2362
4 JGI24034J14986_100468 3300001432 Bacteria 2367
5 JGI24748J21848_1000003 3300002074 Bacteria 323921
6 JGI24034J26672_10000005 3300002239 Bacteria 404185
7 JGI24751J29686_10000023 3300002459 Bacteria 97529
8 JGI25406J46586_10025981 3300003203 Bacteria 2265
9 Ga0065714_10064432 3300005288 Bacteria 133542
10 Ga0065704_10014703 3300005289 Bacteria 2362
11 Ga0065704_10113841 3300005289 Bacteria 1904
12 Ga0065712_10067730 3300005290 Bacteria 133482
13 Ga0065712_10095299 3300005290 Bacteria 2223
14 Ga0065715_10017525 3300005293 Bacteria 2647
15 Ga0065715_10095227 3300005293 Bacteria 4124
16 Ga0065715_10096019 3300005293 Bacteria 3958
17 Ga0065715_10097105 3300005293 Bacteria 3762
18 Ga0065715_10149489 3300005293 Unclassified 1746
19 Ga0065715_10165191 3300005293 Bacteria 1593
20 Ga0065715_10196053 3300005293 Bacteria 1384
21 Ga0065707_10009400 3300005295 Bacteria 4003
22 Ga0065707_10019661 3300005295 Bacteria 2010
23 Ga0065707_10097778 3300005295 Bacteria 3143
24 Ga0070676_10034248 3300005328 Bacteria 2916
25 Ga0070683_100045455 3300005329 Unclassified 4052
26 Ga0070690_100004372 3300005330 Bacteria 7838
27 Ga0070690_100007819 3300005330 Bacteria 6130
28 Ga0070670_100000324 3300005331 Bacteria 40556
29 Ga0070670_100040106 3300005331 Unclassified 4027
30 Ga0068869_100003254 3300005334 Bacteria 9925
31 Ga0068869_100004466 3300005334 Bacteria 8697
32 Ga0068869_100018668 3300005334 Bacteria 4725
33 Ga0068869_100056465 3300005334 Bacteria 2863
34 Ga0068869_100222920 3300005334 Bacteria 1495
35 Ga0070666_10043666 3300005335 Bacteria 3002
36 Ga0070682_100002049 3300005337 Bacteria 11249
37 Ga0070682_100008637 3300005337 Bacteria 5752
38 Ga0070682_100014746 3300005337 Bacteria 4520
39 Ga0068868_100038638 3300005338 Bacteria 3706
40 Ga0068868_100052640 3300005338 Bacteria 3205
41 Ga0068868_100109979 3300005338 Bacteria 2238
42 Ga0070689_100000716 3300005340 Bacteria 20218
43 Ga0070689_100041126 3300005340 Unclassified 3547
44 Ga0070689_100114523 3300005340 Bacteria 2148
45 Ga0070689_100268778 3300005340 Bacteria 1411
46 Ga0070689_100314754 3300005340 Bacteria 1306
47 Ga0070692_10002300 3300005345 Bacteria 7357
48 Ga0070692_10036949 3300005345 Bacteria 2480
49 Ga0070692_10054790 3300005345 Bacteria 2083
50 Ga0070692_10093937 3300005345 Bacteria 1634
51 Ga0070692_10123485 3300005345 Bacteria 1447
52 Ga0070668_100137647 3300005347 Unclassified 1965
53 Ga0070669_100000309 3300005353 Bacteria 38458
54 Ga0070669_100003292 3300005353 Bacteria 11610
55 Ga0070669_100014481 3300005353 Bacteria 5612
56 Ga0070669_100026191 3300005353 Bacteria 4195
57 Ga0070669_100038598 3300005353 Bacteria 3467
58 Ga0070675_100069793 3300005354 Bacteria 2911
59 Ga0070675_100145754 3300005354 Bacteria 2027
60 Ga0070671_100056908 3300005355 Bacteria 3253
61 Ga0070671_100263543 3300005355 Bacteria 1465
62 Ga0070673_100063346 3300005364 Bacteria 2942
63 Ga0070673_100081435 3300005364 Bacteria 2625
64 Ga0070673_100090202 3300005364 Bacteria 2504
65 Ga0070688_100211974 3300005365 Bacteria 1360
66 Ga0070659_100008120 3300005366 Bacteria 7656
67 Ga0070659_100103553 3300005366 Bacteria 2293
68 Ga0070667_100025101 3300005367 Bacteria 4954
69 Ga0070667_100028350 3300005367 Bacteria 4661
70 Ga0070703_10000128 3300005406 Bacteria 39400
71 Ga0070701_10001610 3300005438 Bacteria 8419
72 Ga0070705_100011653 3300005440 Bacteria 4444
73 Ga0070705_100035119 3300005440 Bacteria 2808
74 Ga0070700_100000042 3300005441 Bacteria 99515
75 Ga0070700_100008567 3300005441 Bacteria 5570
76 Ga0070700_100110953 3300005441 Bacteria 1823
77 Ga0070694_100000485 3300005444 Bacteria 21818
78 Ga0070694_100030058 3300005444 Bacteria 3551
79 Ga0070694_100039226 3300005444 Bacteria 3152
80 Ga0070694_100049351 3300005444 Bacteria 2834
81 Ga0070708_100000158 3300005445 Bacteria 47837
82 Ga0070708_100198809 3300005445 Bacteria 1876
83 Ga0070678_100053251 3300005456 Bacteria 2942
84 Ga0070662_100025179 3300005457 Bacteria 4106
85 Ga0070681_10000354 3300005458 Bacteria 36996
86 Ga0070681_10004931 3300005458 Bacteria 12823
87 Ga0070681_10063580 3300005458 Bacteria 3662
88 Ga0070681_10113021 3300005458 Bacteria 2655
89 Ga0068867_100003348 3300005459 Bacteria 11289
90 Ga0068867_100031781 3300005459 Bacteria 3814
91 Ga0068867_100047845 3300005459 Bacteria 3145
92 Ga0070685_10054185 3300005466 Bacteria 2326
93 Ga0070685_10102092 3300005466 Bacteria 1753
94 Ga0070706_100000480 3300005467 Bacteria 47075
95 Ga0070706_100019636 3300005467 Bacteria 6233
96 Ga0070706_100158952 3300005467 Bacteria 2110
97 Ga0070707_100000015 3300005468 Bacteria 144611
98 Ga0070707_100000478 3300005468 Bacteria 39602
99 Ga0070707_100011380 3300005468 Bacteria 8296
100 Ga0070707_100032423 3300005468 Bacteria 4977
101 Ga0070707_100053402 3300005468 Bacteria 3874
102 Ga0070707_100126583 3300005468 Bacteria 2482
103 Ga0070707_100185050 3300005468 Bacteria 2031
104 Ga0070707_100265870 3300005468 Bacteria 1668
105 Ga0070707_100276016 3300005468 Bacteria 1634
106 Ga0070698_100004618 3300005471 Bacteria 15130
107 Ga0070698_100007533 3300005471 Bacteria 11771
108 Ga0070698_100009622 3300005471 Bacteria 10338
109 Ga0070698_100027511 3300005471 Bacteria 5912
110 Ga0070698_100071701 3300005471 Bacteria 3473
111 Ga0070698_100142917 3300005471 Bacteria 2343
112 Ga0070699_100004781 3300005518 Bacteria 11971
113 Ga0070699_100029167 3300005518 Bacteria 4758
114 Ga0070699_100105341 3300005518 Bacteria 2474
115 Ga0070699_100184837 3300005518 Bacteria 1850
116 Ga0070679_100001229 3300005530 Bacteria 22504
117 Ga0070679_100052826 3300005530 Bacteria 4045
118 Ga0070697_100000163 3300005536 Bacteria 54349
119 Ga0070697_100000363 3300005536 Bacteria 35500
120 Ga0070697_100007296 3300005536 Bacteria 8598
121 Ga0070672_100133224 3300005543 Bacteria 2044
122 Ga0070672_100150151 3300005543 Bacteria 1927
123 Ga0070672_100169018 3300005543 Bacteria 1817
124 Ga0070686_100005287 3300005544 Bacteria 7137
125 Ga0070686_100028393 3300005544 Bacteria 3393
126 Ga0070686_100039727 3300005544 Bacteria 2933
127 Ga0070686_100125577 3300005544 Bacteria 1767
128 Ga0070695_100028075 3300005545 Bacteria 3490
129 Ga0070695_100058804 3300005545 Bacteria 2487
130 Ga0070696_100015062 3300005546 Bacteria 5191
131 Ga0070696_100017534 3300005546 Bacteria 4834
132 Ga0070696_100062355 3300005546 Bacteria 2609
133 Ga0070696_100064649 3300005546 Bacteria 2563
134 Ga0070696_100075324 3300005546 Bacteria 2380
135 Ga0070696_100096776 3300005546 Bacteria 2109
136 Ga0070693_100006184 3300005547 Bacteria 5801
137 Ga0070693_100091857 3300005547 Bacteria 1832
138 Ga0070693_100113624 3300005547 Bacteria 1670
139 Ga0070704_100012906 3300005549 Bacteria 5169
140 Ga0070704_100014813 3300005549 Bacteria 4879
141 Ga0070704_100100586 3300005549 Bacteria 2177
142 Ga0070704_100160760 3300005549 Bacteria 1776
143 Ga0070704_100292102 3300005549 Bacteria 1355
144 Ga0070664_100004743 3300005564 Bacteria 10903
145 Ga0070664_100199072 3300005564 Bacteria 1787
146 Ga0070664_100309245 3300005564 Bacteria 1430
147 Ga0068857_100002908 3300005577 Bacteria 14112
148 Ga0068857_100163321 3300005577 Bacteria 2021
149 Ga0068857_100240062 3300005577 Bacteria 1659
150 Ga0068854_100115629 3300005578 Bacteria 2030
151 Ga0068854_100199557 3300005578 Bacteria 1572
152 Ga0068856_100005175 3300005614 Bacteria 12877
153 Ga0070702_100005098 3300005615 Bacteria 6078
154 Ga0070702_100046346 3300005615 Bacteria 2464
155 Ga0070702_100103376 3300005615 Bacteria 1752
156 Ga0068852_100095826 3300005616 Bacteria 2666
157 Ga0068859_100007545 3300005617 Bacteria 11046
158 Ga0068859_100020507 3300005617 Bacteria 6634
159 Ga0068859_100076211 3300005617 Bacteria 3394
160 Ga0068859_100083642 3300005617 Bacteria 3235
161 Ga0068859_100106530 3300005617 Bacteria 2862
162 Ga0068859_100119987 3300005617 Bacteria 2696
163 Ga0068859_100178852 3300005617 Bacteria 2204
164 Ga0068859_100183427 3300005617 Bacteria 2176
165 Ga0068859_100348895 3300005617 Bacteria 1575
166 Ga0068864_100021880 3300005618 Bacteria 5360
167 Ga0068864_100129005 3300005618 Bacteria 2269
168 Ga0068864_100170979 3300005618 Bacteria 1981
169 Ga0068861_100011357 3300005719 Bacteria 6187
170 Ga0068861_100122690 3300005719 Bacteria 2098
171 Ga0068861_100144570 3300005719 Bacteria 1945
172 Ga0068861_100208363 3300005719 Bacteria 1645
173 Ga0068851_10000390 3300005834 Bacteria 19872
174 Ga0068870_10020295 3300005840 Bacteria 3233
175 Ga0068870_10158416 3300005840 Bacteria 1340
176 Ga0068863_100040829 3300005841 Bacteria 4411
177 Ga0068863_100050918 3300005841 Bacteria 3925
178 Ga0068863_100054965 3300005841 Bacteria 3771
179 Ga0068863_100067859 3300005841 Bacteria 3373
180 Ga0068863_100171804 3300005841 Bacteria 2079
181 Ga0068863_100410919 3300005841 Bacteria 1325
182 Ga0068858_100003182 3300005842 Bacteria 16406
183 Ga0068858_100022345 3300005842 Bacteria 5905
184 Ga0068858_100044830 3300005842 Bacteria 4099
185 Ga0068858_100064485 3300005842 Bacteria 3391
186 Ga0068858_100074363 3300005842 Bacteria 3155
187 Ga0068858_100085002 3300005842 Bacteria 2943
188 Ga0068858_100110820 3300005842 Bacteria 2563
189 Ga0068858_100262588 3300005842 Bacteria 1642
190 Ga0068860_100011621 3300005843 Bacteria 8682
191 Ga0068860_100043092 3300005843 Bacteria 4307
192 Ga0068860_100056324 3300005843 Bacteria 3738
193 Ga0068860_100071155 3300005843 Bacteria 3306
194 Ga0068860_100166697 3300005843 Bacteria 2127
195 Ga0068860_100198156 3300005843 Bacteria 1945
196 Ga0068860_100336848 3300005843 Bacteria 1483
197 Ga0068862_100025551 3300005844 Bacteria 4958
198 Ga0068862_100099298 3300005844 Bacteria 2544
199 Ga0068862_100123207 3300005844 Bacteria 2287
200 Ga0068862_100146778 3300005844 Bacteria 2097
201 Ga0068862_100232973 3300005844 Bacteria 1671
202 Ga0068862_100249236 3300005844 Bacteria 1618
203 Ga0081455_10136091 3300005937 Bacteria 1914
204 Ga0081540_1030824 3300005983 Unclassified 2962
205 Ga0081539_10000728 3300005985 Bacteria 65949
206 Ga0081539_10000894 3300005985 Bacteria 56997
207 Ga0081539_10001523 3300005985 Bacteria 38871
208 Ga0081539_10003972 3300005985 Bacteria 17099
209 Ga0070715_10000044 3300006163 Bacteria 59088
210 Ga0070716_100000021 3300006173 Bacteria 79460
211 Ga0097621_100001579 3300006237 Bacteria 15593
212 Ga0097621_100006306 3300006237 Bacteria 8412
213 Ga0097621_100031906 3300006237 Bacteria 4183
214 Ga0097621_100176275 3300006237 Bacteria 1845
215 Ga0068871_100018400 3300006358 Bacteria 5309
216 Ga0068871_100036180 3300006358 Bacteria 3929
217 Ga0068871_100049190 3300006358 Bacteria 3406
218 Ga0075428_100048716 3300006844 Bacteria 4650
219 Ga0075430_100018532 3300006846 Bacteria 5923
220 Ga0075431_100021287 3300006847 Bacteria 6627
221 Ga0075433_10021648 3300006852 Bacteria 5393
222 Ga0075433_10022596 3300006852 Bacteria 5281
223 Ga0075433_10038526 3300006852 Bacteria 4129
224 Ga0075433_10045106 3300006852 Bacteria 3831
225 Ga0075433_10082521 3300006852 Bacteria 2835
226 Ga0075433_10090015 3300006852 Bacteria 2712
227 Ga0075433_10136575 3300006852 Bacteria 2180
228 Ga0075434_100049360 3300006871 Bacteria 4178
229 Ga0075434_100059519 3300006871 Bacteria 3797
230 Ga0075434_100113324 3300006871 Bacteria 2724
231 Ga0075434_100280374 3300006871 Unclassified 1686
232 Ga0075434_100289592 3300006871 Bacteria 1658
233 Ga0075434_100311208 3300006871 Bacteria 1595
234 Ga0075429_100026752 3300006880 Bacteria 5008
235 Ga0075429_100090266 3300006880 Bacteria 2672
236 Ga0068865_100012490 3300006881 Bacteria 5346
237 Ga0075436_100000008 3300006914 Bacteria 279288
238 Ga0075436_100026281 3300006914 Bacteria 4008
239 Ga0097620_100007545 3300006931 Bacteria 11046
240 Ga0097620_100020507 3300006931 Bacteria 6634
241 Ga0097620_100021198 3300006931 Bacteria 6521
242 Ga0097620_100076204 3300006931 Bacteria 3394
243 Ga0097620_100083643 3300006931 Bacteria 3235
244 Ga0097620_100106529 3300006931 Bacteria 2862
245 Ga0097620_100119980 3300006931 Bacteria 2696
246 Ga0097620_100178838 3300006931 Bacteria 2204
247 Ga0097620_100183429 3300006931 Bacteria 2176
248 Ga0097620_100348936 3300006931 Bacteria 1575
249 Ga0075435_100000937 3300007076 Bacteria 18413
250 Ga0075435_100027226 3300007076 Bacteria 4469
251 Ga0075435_100049424 3300007076 Bacteria 3382
252 Ga0105251_10063945 3300009011 Bacteria 1725
253 Ga0105240_10038382 3300009093 Bacteria 6143
254 Ga0111539_10000296 3300009094 Bacteria 60206
255 Ga0111539_10011429 3300009094 Bacteria 11144
256 Ga0111539_10037458 3300009094 Bacteria 5855
257 Ga0111539_10107064 3300009094 Bacteria 3280
258 Ga0105247_10000033 3300009101 Bacteria 184433
259 Ga0105247_10000635 3300009101 Bacteria 28087
260 Ga0105247_10018535 3300009101 Bacteria 4176
261 Ga0114129_10007738 3300009147 Bacteria 15290
262 Ga0114129_10012089 3300009147 Bacteria 12288
263 Ga0114129_10031762 3300009147 Bacteria 7464
264 Ga0114129_10033107 3300009147 Bacteria 7304
265 Ga0114129_10045998 3300009147 Bacteria 6134
266 Ga0114129_10086774 3300009147 Bacteria 4340
267 Ga0114129_10140922 3300009147 Bacteria 3305
268 Ga0114129_10282185 3300009147 Bacteria 2219
269 Ga0114129_10582435 3300009147 Bacteria 1452
270 Ga0105243_10000386 3300009148 Bacteria 47128
271 Ga0105243_10001017 3300009148 Bacteria 25946
272 Ga0105243_10014791 3300009148 Bacteria 5904
273 Ga0105243_10017131 3300009148 Bacteria 5480
274 Ga0105243_10073760 3300009148 Bacteria 2766
275 Ga0105243_10104734 3300009148 Bacteria 2355
276 Ga0105241_10030405 3300009174 Bacteria 4036
277 Ga0105241_10089586 3300009174 Bacteria 2424
278 Ga0105241_10101448 3300009174 Bacteria 2288
279 Ga0105242_10001804 3300009176 Bacteria 16878
280 Ga0105242_10002598 3300009176 Bacteria 14150
281 Ga0105242_10011687 3300009176 Bacteria 6755
282 Ga0105242_10039424 3300009176 Bacteria 3802
283 Ga0105242_10101821 3300009176 Bacteria 2435
284 Ga0105248_10011331 3300009177 Bacteria 9830
285 Ga0105248_10034328 3300009177 Bacteria 5671
286 Ga0105248_10037194 3300009177 Bacteria 5445
287 Ga0105248_10123201 3300009177 Bacteria 2925
288 Ga0105237_10004419 3300009545 Bacteria 16295
289 Ga0105237_10010254 3300009545 Bacteria 9980
290 Ga0105238_10004387 3300009551 Bacteria 13993
291 Ga0105238_10052551 3300009551 Bacteria 4096
292 Ga0105238_10164842 3300009551 Bacteria 2191
293 Ga0105249_10000322 3300009553 Bacteria 48543
294 Ga0105249_10009278 3300009553 Bacteria 8603
295 Ga0105249_10011002 3300009553 Bacteria 7949
296 Ga0105249_10019898 3300009553 Bacteria 5995
297 Ga0105249_10046684 3300009553 Bacteria 3942
298 Ga0105249_10295549 3300009553 Bacteria 1623
299 Ga0105239_10038057 3300010375 Bacteria 5271
300 Ga0105239_10079539 3300010375 Bacteria 3607
301 Ga0105239_10097949 3300010375 Bacteria 3241
302 Ga0105239_10189227 3300010375 Bacteria 2304
303 Ga0105239_10203929 3300010375 Bacteria 2216
304 Ga0105246_10035729 3300011119 Bacteria 3323
305 Ga0157373_10010631 3300013100 Bacteria 6772
306 Ga0157373_10027772 3300013100 Bacteria 4082
307 Ga0157374_10079964 3300013296 Bacteria 3099
308 Ga0157374_10216941 3300013296 Bacteria 1877
309 Ga0157378_10000011 3300013297 Bacteria 158889
310 Ga0157378_10003521 3300013297 Bacteria 13887
311 Ga0157378_10010653 3300013297 Bacteria 8035
312 Ga0157378_10027256 3300013297 Bacteria 5042
313 Ga0157378_10031423 3300013297 Bacteria 4690
314 Ga0157378_10181128 3300013297 Bacteria 1982
315 Ga0163162_10000019 3300013306 Bacteria 220603
316 Ga0163162_10021338 3300013306 Bacteria 6377
317 Ga0163162_10022436 3300013306 Bacteria 6218
318 Ga0163162_10023669 3300013306 Bacteria 6064
319 Ga0163162_10024201 3300013306 Bacteria 5992
320 Ga0163162_10037812 3300013306 Bacteria 4817
321 Ga0163162_10048019 3300013306 Bacteria 4277
322 Ga0163162_10050359 3300013306 Bacteria 4177
323 Ga0163162_10068656 3300013306 Bacteria 3596
324 Ga0163162_10141360 3300013306 Bacteria 2521
325 Ga0163162_10359155 3300013306 Bacteria 1590
326 Ga0157372_10027081 3300013307 Bacteria 6240
327 Ga0157375_10002990 3300013308 Bacteria 14682
328 Ga0157375_10031304 3300013308 Bacteria 5027
329 Ga0157375_10157092 3300013308 Bacteria 2414
330 Ga0157375_10190856 3300013308 Bacteria 2203
331 Ga0157375_10191336 3300013308 Bacteria 2201
332 Ga0163163_10002165 3300014325 Bacteria 16602
333 Ga0163163_10006156 3300014325 Bacteria 10458
334 Ga0163163_10023812 3300014325 Bacteria 5818
335 Ga0163163_10030924 3300014325 Bacteria 5163
336 Ga0163163_10079090 3300014325 Bacteria 3286
337 Ga0163163_10090296 3300014325 Bacteria 3077
338 Ga0163163_10133444 3300014325 Unclassified 2523
339 Ga0163163_10348735 3300014325 Bacteria 1536
340 Ga0157380_10001664 3300014326 Bacteria 14660
341 Ga0157380_10004993 3300014326 Bacteria 9244
342 Ga0157380_10008278 3300014326 Bacteria 7411
343 Ga0157380_10008572 3300014326 Bacteria 7309
344 Ga0157380_10058101 3300014326 Bacteria 3083
345 Ga0157380_10062246 3300014326 Bacteria 2988
346 Ga0157380_10113178 3300014326 Bacteria 2284
347 Ga0157380_10462090 3300014326 Bacteria 1222
348 Ga0157377_10006110 3300014745 Bacteria 5715
349 Ga0157379_10268148 3300014968 Bacteria 1552
350 Ga0157376_10085924 3300014969 Bacteria 2712
351 Ga0157376_10116056 3300014969 Bacteria 2365
352 Ga0163161_10014722 3300017792 Bacteria 5447
353 Ga0163161_10021569 3300017792 Bacteria 4526
354 Ga0213876_10000209 3300021384 Bacteria 58910
355 Ga0213876_10000216 3300021384 Bacteria 58015
356 Ga0207672_1000008 3300025223 Bacteria 26222
357 Ga0207656_10011650 3300025321 Bacteria 3327
358 Ga0207653_10000019 3300025885 Bacteria 138019
359 Ga0207653_10006888 3300025885 Bacteria 3546
360 Ga0207710_10000001 3300025900 Bacteria 1797433
361 Ga0207710_10001583 3300025900 Bacteria 11152
362 Ga0207680_10010090 3300025903 Bacteria 4713
363 Ga0207680_10032833 3300025903 Bacteria 2955
364 Ga0207647_10000445 3300025904 Bacteria 33611
365 Ga0207685_10000039 3300025905 Bacteria 60484
366 Ga0207643_10006723 3300025908 Bacteria 6167
367 Ga0207643_10069025 3300025908 Bacteria 2031
368 Ga0207705_10067715 3300025909 Bacteria 2584
369 Ga0207684_10000533 3300025910 Bacteria 47088
370 Ga0207684_10003673 3300025910 Bacteria 14881
371 Ga0207684_10030426 3300025910 Bacteria 4595
372 Ga0207684_10100925 3300025910 Bacteria 2466
373 Ga0207684_10105048 3300025910 Bacteria 2415
374 Ga0207707_10000044 3300025912 Bacteria 122847
375 Ga0207707_10009034 3300025912 Bacteria 8661
376 Ga0207707_10094909 3300025912 Bacteria 2607
377 Ga0207671_10035599 3300025914 Bacteria 3693
378 Ga0207660_10010541 3300025917 Bacteria 6002
379 Ga0207662_10041430 3300025918 Bacteria 2711
380 Ga0207652_10000462 3300025921 Bacteria 41666
381 Ga0207652_10174379 3300025921 Bacteria 1930
382 Ga0207646_10000025 3300025922 Bacteria 248680
383 Ga0207646_10000849 3300025922 Bacteria 39555
384 Ga0207646_10011478 3300025922 Bacteria 8578
385 Ga0207646_10012114 3300025922 Bacteria 8301
386 Ga0207646_10028029 3300025922 Bacteria 5132
387 Ga0207646_10231884 3300025922 Bacteria 1668
388 Ga0207681_10000606 3300025923 Bacteria 24138
389 Ga0207681_10010326 3300025923 Bacteria 5712
390 Ga0207681_10020230 3300025923 Bacteria 4214
391 Ga0207681_10034183 3300025923 Bacteria 3340
392 Ga0207694_10004561 3300025924 Bacteria 10801
393 Ga0207694_10043044 3300025924 Bacteria 3485
394 Ga0207650_10000112 3300025925 Bacteria 106714
395 Ga0207650_10179185 3300025925 Bacteria 1688
396 Ga0207650_10232820 3300025925 Bacteria 1486
397 Ga0207659_10146100 3300025926 Bacteria 1841
398 Ga0207659_10208025 3300025926 Bacteria 1567
399 Ga0207644_10007523 3300025931 Bacteria 7101
400 Ga0207644_10178369 3300025931 Bacteria 1663
401 Ga0207690_10142970 3300025932 Bacteria 1765
402 Ga0207706_10010103 3300025933 Bacteria 8644
403 Ga0207686_10000046 3300025934 Bacteria 119562
404 Ga0207686_10000130 3300025934 Bacteria 60144
405 Ga0207686_10000220 3300025934 Bacteria 43582
406 Ga0207686_10156982 3300025934 Bacteria 1590
407 Ga0207709_10000738 3300025935 Bacteria 25942
408 Ga0207709_10001281 3300025935 Bacteria 17959
409 Ga0207709_10009567 3300025935 Bacteria 5334
410 Ga0207709_10090004 3300025935 Bacteria 2003
411 Ga0207670_10023827 3300025936 Bacteria 3816
412 Ga0207670_10024631 3300025936 Unclassified 3764
413 Ga0207704_10263653 3300025938 Bacteria 1300
414 Ga0207665_10000035 3300025939 Bacteria 87960
415 Ga0207691_10034011 3300025940 Bacteria 4744
416 Ga0207691_10161014 3300025940 Bacteria 1969
417 Ga0207711_10008000 3300025941 Bacteria 8845
418 Ga0207711_10025643 3300025941 Bacteria 4945
419 Ga0207711_10028246 3300025941 Bacteria 4720
420 Ga0207711_10099433 3300025941 Bacteria 2572
421 Ga0207711_10140117 3300025941 Bacteria 2175
422 Ga0207711_10146971 3300025941 Bacteria 2124
423 Ga0207711_10261210 3300025941 Bacteria 1592
424 Ga0207711_10262104 3300025941 Bacteria 1589
425 Ga0207689_10015333 3300025942 Bacteria 6487
426 Ga0207689_10016590 3300025942 Bacteria 6232
427 Ga0207689_10022191 3300025942 Bacteria 5337
428 Ga0207689_10054043 3300025942 Bacteria 3308
429 Ga0207689_10124273 3300025942 Bacteria 2123
430 Ga0207689_10160075 3300025942 Bacteria 1855
431 Ga0207689_10182354 3300025942 Bacteria 1731
432 Ga0207689_10280895 3300025942 Bacteria 1379
433 Ga0207661_10134129 3300025944 Bacteria 2125
434 Ga0207679_10291685 3300025945 Unclassified 1403
435 Ga0207651_10062843 3300025960 Bacteria 2590
436 Ga0207651_10081397 3300025960 Bacteria 2334
437 Ga0207651_10120902 3300025960 Bacteria 1986
438 Ga0207651_10136556 3300025960 Bacteria 1887
439 Ga0207712_10001566 3300025961 Bacteria 15403
440 Ga0207712_10007304 3300025961 Bacteria 6971
441 Ga0207712_10109409 3300025961 Bacteria 2070
442 Ga0207712_10189324 3300025961 Bacteria 1623
443 Ga0207640_10046333 3300025981 Bacteria 2797
444 Ga0207640_10216944 3300025981 Bacteria 1462
445 Ga0207677_10047909 3300026023 Bacteria 2873
446 Ga0207677_10079239 3300026023 Bacteria 2348
447 Ga0207677_10089212 3300026023 Bacteria 2238
448 Ga0207677_10124043 3300026023 Bacteria 1948
449 Ga0207677_10161976 3300026023 Bacteria 1739
450 Ga0207703_10000700 3300026035 Bacteria 33180
451 Ga0207703_10059187 3300026035 Bacteria 3129
452 Ga0207703_10091173 3300026035 Bacteria 2563
453 Ga0207703_10135281 3300026035 Bacteria 2133
454 Ga0207639_10246722 3300026041 Bacteria 1555
455 Ga0207708_10000074 3300026075 Bacteria 79215
456 Ga0207708_10013187 3300026075 Bacteria 6170
457 Ga0207708_10022252 3300026075 Bacteria 4785
458 Ga0207708_10146252 3300026075 Bacteria 1857
459 Ga0207708_10150194 3300026075 Bacteria 1833
460 Ga0207702_10170520 3300026078 Bacteria 1995
461 Ga0207641_10041122 3300026088 Bacteria 3874
462 Ga0207641_10072942 3300026088 Bacteria 2957
463 Ga0207648_10005481 3300026089 Bacteria 12788
464 Ga0207648_10323676 3300026089 Bacteria 1386
465 Ga0207676_10002522 3300026095 Bacteria 13053
466 Ga0207676_10002972 3300026095 Bacteria 12095
467 Ga0207676_10010433 3300026095 Bacteria 6615
468 Ga0207676_10022117 3300026095 Bacteria 4675
469 Ga0207676_10058170 3300026095 Bacteria 3048
470 Ga0207676_10138126 3300026095 Bacteria 2082
471 Ga0207674_10004656 3300026116 Bacteria 16464
472 Ga0207674_10051644 3300026116 Bacteria 4195
473 Ga0207674_10074118 3300026116 Bacteria 3417
474 Ga0207674_10146016 3300026116 Bacteria 2324
475 Ga0207674_10232942 3300026116 Bacteria 1789
476 Ga0207675_100003710 3300026118 Bacteria 14877
477 Ga0207675_100024700 3300026118 Bacteria 5588
478 Ga0207675_100036356 3300026118 Bacteria 4594
479 Ga0207675_100068934 3300026118 Bacteria 3305
480 Ga0207675_100111924 3300026118 Bacteria 2576
481 Ga0207675_100136987 3300026118 Bacteria 2324
482 Ga0207675_100165300 3300026118 Bacteria 2113
483 Ga0207675_100208129 3300026118 Bacteria 1880
484 Ga0207675_100367934 3300026118 Bacteria 1412
485 Ga0207428_10004140 3300027907 Bacteria 13910
486 Ga0207428_10072461 3300027907 Bacteria 2704
487 Ga0268265_10003451 3300028380 Bacteria 11366
488 Ga0268265_10085215 3300028380 Bacteria 2507
489 Ga0268265_10122675 3300028380 Bacteria 2144
490 Ga0268265_10132542 3300028380 Bacteria 2074
491 Ga0268265_10165862 3300028380 Bacteria 1882
492 Ga0268264_10034077 3300028381 Bacteria 4187
493 Ga0268264_10141605 3300028381 Bacteria 2145
494 Ga0268264_10151684 3300028381 Bacteria 2078
495 Ga0268264_10188935 3300028381 Bacteria 1876
496 Ga0307408_100006236 3300031548 Bacteria 7916
497 Ga0307408_100162679 3300031548 Bacteria 1774
498 Ga0307405_10016450 3300031731 Bacteria 4034
499 Ga0307405_10027785 3300031731 Bacteria 3286
500 Ga0307405_10079446 3300031731 Bacteria 2138
501 Ga0307413_10001778 3300031824 Bacteria 8435
502 Ga0307406_10003612 3300031901 Bacteria 8426
503 Ga0307406_10005534 3300031901 Bacteria 6909
504 Ga0307406_10228177 3300031901 Bacteria 1389
505 Ga0307407_10004447 3300031903 Bacteria 5951
506 Ga0307407_10004979 3300031903 Bacteria 5715
507 Ga0307412_10014002 3300031911 Bacteria 4722
508 Ga0307412_10019502 3300031911 Bacteria 4109
509 Ga0307412_10134672 3300031911 Bacteria 1800
510 Ga0307409_100001552 3300031995 Bacteria 11405
511 Ga0307409_100064031 3300031995 Bacteria 2887
512 Ga0307409_100257302 3300031995 Bacteria 1600
513 Ga0307416_100021175 3300032002 Bacteria 4661
514 Ga0307416_100024861 3300032002 Bacteria 4380
515 Ga0307416_100026843 3300032002 Bacteria 4252
516 Ga0307414_10002000 3300032004 Bacteria 10586
517 Ga0307414_10002715 3300032004 Bacteria 9314
518 Ga0307414_10023308 3300032004 Bacteria 3924
519 Ga0307411_10086537 3300032005 Bacteria 2174
520 Ga0307415_100003868 3300032126 Bacteria 7682
521 Ga0373951_0007574 3300035091 Bacteria 2464
522 Ga0373942_0010122 3300035207 Bacteria 2213
523 Ga0395905_0055145 3300037471 Bacteria 3720
524 Ga0395901_0125374 3300038443 Bacteria 2699
525 Ga0436365_0039241 3300039437 Bacteria 90885
526 Ga0436365_0067166 3300039437 Bacteria 157821
527 Ga0436365_0803376 3300039437 Bacteria 4768
528 Ga0439448_0004829 3300042005 Bacteria 3820
529 Ga0439458_0002958 3300042157 Bacteria 4077
530 Ga0439434_0008739 3300042435 Bacteria 2975
531 Ga0453683_0008014 3300044673 Bacteria 7119
532 Ga0451576_0081302 3300045051 Bacteria 3369
533 Ga0495632_0009924 3300046519 Bacteria 5689
534 Ga0495663_0000575 3300046525 Bacteria 12908
535 Ga0495598_0000025 3300046537 Bacteria 24142
536 Ga0495621_0000299 3300046539 Bacteria 11940
537 Ga0496102_0036150 3300048905 Bacteria 4449
538 Ga0496106_0005253 3300048909 Bacteria 9595
539 Ga0496106_0009270 3300048909 Bacteria 7274
540 Ga0496107_0098683 3300048910 Bacteria 2140
541 Ga0496109_0000411 3300048912 Bacteria 38095
542 Ga0496109_0129075 3300048912 Bacteria 2359
543 Ga0496109_0238287 3300048912 Bacteria 1712
544 Ga0496110_0114208 3300048913 Bacteria 2430
545 Ga0496110_0148420 3300048913 Bacteria 2122
546 Ga0501298_002637 3300049521 Bacteria 2730
547 Ga0501038_0001223 3300049574 Bacteria 23290
548 Ga0501040_0125655 3300049576 Bacteria 1802
549 Ga0501202_011077 3300049652 Bacteria 1684
550 Ga0501224_003730 3300049664 Bacteria 2139
551 Ga0501240_005475 3300049673 Bacteria 1521
552 Ga0501243_008464 3300049675 Bacteria 1586
553 Ga0501249_030697 3300049679 Bacteria 1197
554 Ga0501253_003355 3300049683 Bacteria 1913
555 Ga0501261_004098 3300049690 Bacteria 1792
556 Ga0501225_0011665 3300049705 Bacteria 2472
557 Ga0501225_0017642 3300049705 Bacteria 1981
558 Ga0501225_0019225 3300049705 Bacteria 1891
559 Ga0501268_006098 3300049765 Bacteria 1757
560 nmdc:mga05p37_27910_c1 3300050507 Bacteria 6876
561 nmdc:mga05p37_284052_c1 3300050507 Bacteria 1319
562 nmdc:mga05p37_29348_c1 3300050507 Bacteria 6712
563 nmdc:mga05p37_316957_c1 3300050507 Bacteria 1847
564 nmdc:mga05p37_87355_c1 3300050507 Bacteria 3843
565 nmdc:mga05p37_99098_c1 3300050507 Bacteria 3590
566 nmdc:mga09592_54194_c1 3300050508 Bacteria 3388
567 nmdc:mga09592_87558_c1 3300050508 Bacteria 2659
568 nmdc:mga0qj67_128628_c1 3300050509 Bacteria 2050
569 nmdc:mga0qj67_142747_c1 3300050509 Bacteria 1942
570 nmdc:mga0qj67_253552_c1 3300050509 Bacteria 1427
571 nmdc:mga0qj67_29645_c1 3300050509 Bacteria 4251
572 nmdc:mga08y16_164400_c1 3300050511 Bacteria 2305
573 nmdc:mga08y16_17931_c1 3300050511 Bacteria 7459
574 nmdc:mga08y16_21200_c1 3300050511 Bacteria 6862
575 nmdc:mga08y16_22423_c1 3300050511 Bacteria 6665
576 nmdc:mga08y16_271955_c1 3300050511 Bacteria 1749
577 nmdc:mga0n895_169550_c1 3300050512 Bacteria 2215
578 nmdc:mga0n895_198324_c1 3300050512 Bacteria 2038
579 nmdc:mga0n895_26496_c1 3300050512 Bacteria 5492
580 nmdc:mga0n895_278039_c1 3300050512 Bacteria 1698
581 nmdc:mga0n895_352649_c1 3300050512 Unclassified 1490
582 nmdc:mga0n895_36227_c1 3300050512 Bacteria 4763
583 nmdc:mga0rr50_35048_c1 3300050513 Bacteria 3601
584 nmdc:mga0rr50_4648_c1 3300050513 Bacteria 8090
585 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
586 nmdc:mga08x19_20672_c1 3300050514 Bacteria 4055
587 nmdc:mga0a205_15000_c1 3300050515 Bacteria 7232
588 nmdc:mga0a205_27267_c1 3300050515 Bacteria 5455
589 nmdc:mga0a205_87344_c1 3300050515 Bacteria 3013
590 nmdc:mga0a205_88039_c1 3300050515 Bacteria 3000
591 nmdc:mga0a205_90001_c1 3300050515 Bacteria 2966
592 Ga0500616_0001365 3300053153 Bacteria 23725
593 Ga0501084_0064440 3300054114 Bacteria 3067
594 Ga0496107_0131442
595 SwRhRL2b_contig_969129
596 CNAas_1001177
597 JGI24034J14986_100468
598 JGI24748J21848_1000003
599 JGI24034J26672_10000005
600 JGI24751J29686_10000023
601 JGI25406J46586_10025981
602 Ga0065714_10064432
603 Ga0065704_10014703
604 Ga0065704_10113841
605 Ga0065712_10067730
606 Ga0065712_10095299
607 Ga0065715_10017525
608 Ga0065715_10095227
609 Ga0065715_10096019
610 Ga0065715_10097105
611 Ga0065715_10149489
612 Ga0065715_10165191
613 Ga0065715_10196053
614 Ga0065707_10009400
615 Ga0065707_10019661
616 Ga0065707_10097778
617 Ga0070676_10034248
618 Ga0070683_100045455
619 Ga0070690_100004372
620 Ga0070690_100007819
621 Ga0070670_100000324
622 Ga0070670_100040106
623 Ga0068869_100003254
624 Ga0068869_100004466
625 Ga0068869_100018668
626 Ga0068869_100056465
627 Ga0068869_100222920
628 Ga0070666_10043666
629 Ga0070682_100002049
630 Ga0070682_100008637
631 Ga0070682_100014746
632 Ga0068868_100038638
633 Ga0068868_100052640
634 Ga0068868_100109979
635 Ga0070689_100000716
636 Ga0070689_100041126
637 Ga0070689_100114523
638 Ga0070689_100268778
639 Ga0070689_100314754
640 Ga0070692_10002300
641 Ga0070692_10036949
642 Ga0070692_10054790
643 Ga0070692_10093937
644 Ga0070692_10123485
645 Ga0070668_100137647
646 Ga0070669_100000309
647 Ga0070669_100003292
648 Ga0070669_100014481
649 Ga0070669_100026191
650 Ga0070669_100038598
651 Ga0070675_100069793
652 Ga0070675_100145754
653 Ga0070671_100056908
654 Ga0070671_100263543
655 Ga0070673_100063346
656 Ga0070673_100081435
657 Ga0070673_100090202
658 Ga0070688_100211974
659 Ga0070659_100008120
660 Ga0070659_100103553
661 Ga0070667_100025101
662 Ga0070667_100028350
663 Ga0070703_10000128
664 Ga0070701_10001610
665 Ga0070705_100011653
666 Ga0070705_100035119
667 Ga0070700_100000042
668 Ga0070700_100008567
669 Ga0070700_100110953
670 Ga0070694_100000485
671 Ga0070694_100030058
672 Ga0070694_100039226
673 Ga0070694_100049351
674 Ga0070708_100000158
675 Ga0070708_100198809
676 Ga0070678_100053251
677 Ga0070662_100025179
678 Ga0070681_10000354
679 Ga0070681_10004931
680 Ga0070681_10063580
681 Ga0070681_10113021
682 Ga0068867_100003348
683 Ga0068867_100031781
684 Ga0068867_100047845
685 Ga0070685_10054185
686 Ga0070685_10102092
687 Ga0070706_100000480
688 Ga0070706_100019636
689 Ga0070706_100158952
690 Ga0070707_100000015
691 Ga0070707_100000478
692 Ga0070707_100011380
693 Ga0070707_100032423
694 Ga0070707_100053402
695 Ga0070707_100126583
696 Ga0070707_100185050
697 Ga0070707_100265870
698 Ga0070707_100276016
699 Ga0070698_100004618
700 Ga0070698_100007533
701 Ga0070698_100009622
702 Ga0070698_100027511
703 Ga0070698_100071701
704 Ga0070698_100142917
705 Ga0070699_100004781
706 Ga0070699_100029167
707 Ga0070699_100105341
708 Ga0070699_100184837
709 Ga0070679_100001229
710 Ga0070679_100052826
711 Ga0070697_100000163
712 Ga0070697_100000363
713 Ga0070697_100007296
714 Ga0070672_100133224
715 Ga0070672_100150151
716 Ga0070672_100169018
717 Ga0070686_100005287
718 Ga0070686_100028393
719 Ga0070686_100039727
720 Ga0070686_100125577
721 Ga0070695_100028075
722 Ga0070695_100058804
723 Ga0070696_100015062
724 Ga0070696_100017534
725 Ga0070696_100062355
726 Ga0070696_100064649
727 Ga0070696_100075324
728 Ga0070696_100096776
729 Ga0070693_100006184
730 Ga0070693_100091857
731 Ga0070693_100113624
732 Ga0070704_100012906
733 Ga0070704_100014813
734 Ga0070704_100100586
735 Ga0070704_100160760
736 Ga0070704_100292102
737 Ga0070664_100004743
738 Ga0070664_100199072
739 Ga0070664_100309245
740 Ga0068857_100002908
741 Ga0068857_100163321
742 Ga0068857_100240062
743 Ga0068854_100115629
744 Ga0068854_100199557
745 Ga0068856_100005175
746 Ga0070702_100005098
747 Ga0070702_100046346
748 Ga0070702_100103376
749 Ga0068852_100095826
750 Ga0068859_100007545
751 Ga0068859_100020507
752 Ga0068859_100076211
753 Ga0068859_100083642
754 Ga0068859_100106530
755 Ga0068859_100119987
756 Ga0068859_100178852
757 Ga0068859_100183427
758 Ga0068859_100348895
759 Ga0068864_100021880
760 Ga0068864_100129005
761 Ga0068864_100170979
762 Ga0068861_100011357
763 Ga0068861_100122690
764 Ga0068861_100144570
765 Ga0068861_100208363
766 Ga0068851_10000390
767 Ga0068870_10020295
768 Ga0068870_10158416
769 Ga0068863_100040829
770 Ga0068863_100050918
771 Ga0068863_100054965
772 Ga0068863_100067859
773 Ga0068863_100171804
774 Ga0068863_100410919
775 Ga0068858_100003182
776 Ga0068858_100022345
777 Ga0068858_100044830
778 Ga0068858_100064485
779 Ga0068858_100074363
780 Ga0068858_100085002
781 Ga0068858_100110820
782 Ga0068858_100262588
783 Ga0068860_100011621
784 Ga0068860_100043092
785 Ga0068860_100056324
786 Ga0068860_100071155
787 Ga0068860_100166697
788 Ga0068860_100198156
789 Ga0068860_100336848
790 Ga0068862_100025551
791 Ga0068862_100099298
792 Ga0068862_100123207
793 Ga0068862_100146778
794 Ga0068862_100232973
795 Ga0068862_100249236
796 Ga0081455_10136091
797 Ga0081540_1030824
798 Ga0081539_10000728
799 Ga0081539_10000894
800 Ga0081539_10001523
801 Ga0081539_10003972
802 Ga0070715_10000044
803 Ga0070716_100000021
804 Ga0097621_100001579
805 Ga0097621_100006306
806 Ga0097621_100031906
807 Ga0097621_100176275
808 Ga0068871_100018400
809 Ga0068871_100036180
810 Ga0068871_100049190
811 Ga0075428_100048716
812 Ga0075430_100018532
813 Ga0075431_100021287
814 Ga0075433_10021648
815 Ga0075433_10022596
816 Ga0075433_10038526
817 Ga0075433_10045106
818 Ga0075433_10082521
819 Ga0075433_10090015
820 Ga0075433_10136575
821 Ga0075434_100049360
822 Ga0075434_100059519
823 Ga0075434_100113324
824 Ga0075434_100280374
825 Ga0075434_100289592
826 Ga0075434_100311208
827 Ga0075429_100026752
828 Ga0075429_100090266
829 Ga0068865_100012490
830 Ga0075436_100000008
831 Ga0075436_100026281
832 Ga0097620_100007545
833 Ga0097620_100020507
834 Ga0097620_100021198
835 Ga0097620_100076204
836 Ga0097620_100083643
837 Ga0097620_100106529
838 Ga0097620_100119980
839 Ga0097620_100178838
840 Ga0097620_100183429
841 Ga0097620_100348936
842 Ga0075435_100000937
843 Ga0075435_100027226
844 Ga0075435_100049424
845 Ga0105251_10063945
846 Ga0105240_10038382
847 Ga0111539_10000296
848 Ga0111539_10011429
849 Ga0111539_10037458
850 Ga0111539_10107064
851 Ga0105247_10000033
852 Ga0105247_10000635
853 Ga0105247_10018535
854 Ga0114129_10007738
855 Ga0114129_10012089
856 Ga0114129_10031762
857 Ga0114129_10033107
858 Ga0114129_10045998
859 Ga0114129_10086774
860 Ga0114129_10140922
861 Ga0114129_10282185
862 Ga0114129_10582435
863 Ga0105243_10000386
864 Ga0105243_10001017
865 Ga0105243_10014791
866 Ga0105243_10017131
867 Ga0105243_10073760
868 Ga0105243_10104734
869 Ga0105241_10030405
870 Ga0105241_10089586
871 Ga0105241_10101448
872 Ga0105242_10001804
873 Ga0105242_10002598
874 Ga0105242_10011687
875 Ga0105242_10039424
876 Ga0105242_10101821
877 Ga0105248_10011331
878 Ga0105248_10034328
879 Ga0105248_10037194
880 Ga0105248_10123201
881 Ga0105237_10004419
882 Ga0105237_10010254
883 Ga0105238_10004387
884 Ga0105238_10052551
885 Ga0105238_10164842
886 Ga0105249_10000322
887 Ga0105249_10009278
888 Ga0105249_10011002
889 Ga0105249_10019898
890 Ga0105249_10046684
891 Ga0105249_10295549
892 Ga0105239_10038057
893 Ga0105239_10079539
894 Ga0105239_10097949
895 Ga0105239_10189227
896 Ga0105239_10203929
897 Ga0105246_10035729
898 Ga0157373_10010631
899 Ga0157373_10027772
900 Ga0157374_10079964
901 Ga0157374_10216941
902 Ga0157378_10000011
903 Ga0157378_10003521
904 Ga0157378_10010653
905 Ga0157378_10027256
906 Ga0157378_10031423
907 Ga0157378_10181128
908 Ga0163162_10000019
909 Ga0163162_10021338
910 Ga0163162_10022436
911 Ga0163162_10023669
912 Ga0163162_10024201
913 Ga0163162_10037812
914 Ga0163162_10048019
915 Ga0163162_10050359
916 Ga0163162_10068656
917 Ga0163162_10141360
918 Ga0163162_10359155
919 Ga0157372_10027081
920 Ga0157375_10002990
921 Ga0157375_10031304
922 Ga0157375_10157092
923 Ga0157375_10190856
924 Ga0157375_10191336
925 Ga0163163_10002165
926 Ga0163163_10006156
927 Ga0163163_10023812
928 Ga0163163_10030924
929 Ga0163163_10079090
930 Ga0163163_10090296
931 Ga0163163_10133444
932 Ga0163163_10348735
933 Ga0157380_10001664
934 Ga0157380_10004993
935 Ga0157380_10008278
936 Ga0157380_10008572
937 Ga0157380_10058101
938 Ga0157380_10062246
939 Ga0157380_10113178
940 Ga0157380_10462090
941 Ga0157377_10006110
942 Ga0157379_10268148
943 Ga0157376_10085924
944 Ga0157376_10116056
945 Ga0163161_10014722
946 Ga0163161_10021569
947 Ga0213876_10000209
948 Ga0213876_10000216
949 Ga0207672_1000008
950 Ga0207656_10011650
951 Ga0207653_10000019
952 Ga0207653_10006888
953 Ga0207710_10000001
954 Ga0207710_10001583
955 Ga0207680_10010090
956 Ga0207680_10032833
957 Ga0207647_10000445
958 Ga0207685_10000039
959 Ga0207643_10006723
960 Ga0207643_10069025
961 Ga0207705_10067715
962 Ga0207684_10000533
963 Ga0207684_10003673
964 Ga0207684_10030426
965 Ga0207684_10100925
966 Ga0207684_10105048
967 Ga0207707_10000044
968 Ga0207707_10009034
969 Ga0207707_10094909
970 Ga0207671_10035599
971 Ga0207660_10010541
972 Ga0207662_10041430
973 Ga0207652_10000462
974 Ga0207652_10174379
975 Ga0207646_10000025
976 Ga0207646_10000849
977 Ga0207646_10011478
978 Ga0207646_10012114
979 Ga0207646_10028029
980 Ga0207646_10231884
981 Ga0207681_10000606
982 Ga0207681_10010326
983 Ga0207681_10020230
984 Ga0207681_10034183
985 Ga0207694_10004561
986 Ga0207694_10043044
987 Ga0207650_10000112
988 Ga0207650_10179185
989 Ga0207650_10232820
990 Ga0207659_10146100
991 Ga0207659_10208025
992 Ga0207644_10007523
993 Ga0207644_10178369
994 Ga0207690_10142970
995 Ga0207706_10010103
996 Ga0207686_10000046
997 Ga0207686_10000130
998 Ga0207686_10000220
999 Ga0207686_10156982
1000 Ga0207709_10000738
1001 Ga0207709_10001281
1002 Ga0207709_10009567
1003 Ga0207709_10090004
1004 Ga0207670_10023827
1005 Ga0207670_10024631
1006 Ga0207704_10263653
1007 Ga0207665_10000035
1008 Ga0207691_10034011
1009 Ga0207691_10161014
1010 Ga0207711_10008000
1011 Ga0207711_10025643
1012 Ga0207711_10028246
1013 Ga0207711_10099433
1014 Ga0207711_10140117
1015 Ga0207711_10146971
1016 Ga0207711_10261210
1017 Ga0207711_10262104
1018 Ga0207689_10015333
1019 Ga0207689_10016590
1020 Ga0207689_10022191
1021 Ga0207689_10054043
1022 Ga0207689_10124273
1023 Ga0207689_10160075
1024 Ga0207689_10182354
1025 Ga0207689_10280895
1026 Ga0207661_10134129
1027 Ga0207679_10291685
1028 Ga0207651_10062843
1029 Ga0207651_10081397
1030 Ga0207651_10120902
1031 Ga0207651_10136556
1032 Ga0207712_10001566
1033 Ga0207712_10007304
1034 Ga0207712_10109409
1035 Ga0207712_10189324
1036 Ga0207640_10046333
1037 Ga0207640_10216944
1038 Ga0207677_10047909
1039 Ga0207677_10079239
1040 Ga0207677_10089212
1041 Ga0207677_10124043
1042 Ga0207677_10161976
1043 Ga0207703_10000700
1044 Ga0207703_10059187
1045 Ga0207703_10091173
1046 Ga0207703_10135281
1047 Ga0207639_10246722
1048 Ga0207708_10000074
1049 Ga0207708_10013187
1050 Ga0207708_10022252
1051 Ga0207708_10146252
1052 Ga0207708_10150194
1053 Ga0207702_10170520
1054 Ga0207641_10041122
1055 Ga0207641_10072942
1056 Ga0207648_10005481
1057 Ga0207648_10323676
1058 Ga0207676_10002522
1059 Ga0207676_10002972
1060 Ga0207676_10010433
1061 Ga0207676_10022117
1062 Ga0207676_10058170
1063 Ga0207676_10138126
1064 Ga0207674_10004656
1065 Ga0207674_10051644
1066 Ga0207674_10074118
1067 Ga0207674_10146016
1068 Ga0207674_10232942
1069 Ga0207675_100003710
1070 Ga0207675_100024700
1071 Ga0207675_100036356
1072 Ga0207675_100068934
1073 Ga0207675_100111924
1074 Ga0207675_100136987
1075 Ga0207675_100165300
1076 Ga0207675_100208129
1077 Ga0207675_100367934
1078 Ga0207428_10004140
1079 Ga0207428_10072461
1080 Ga0268265_10003451
1081 Ga0268265_10085215
1082 Ga0268265_10122675
1083 Ga0268265_10132542
1084 Ga0268265_10165862
1085 Ga0268264_10034077
1086 Ga0268264_10141605
1087 Ga0268264_10151684
1088 Ga0268264_10188935
1089 Ga0307408_100006236
1090 Ga0307408_100162679
1091 Ga0307405_10016450
1092 Ga0307405_10027785
1093 Ga0307405_10079446
1094 Ga0307413_10001778
1095 Ga0307406_10003612
1096 Ga0307406_10005534
1097 Ga0307406_10228177
1098 Ga0307407_10004447
1099 Ga0307407_10004979
1100 Ga0307412_10014002
1101 Ga0307412_10019502
1102 Ga0307412_10134672
1103 Ga0307409_100001552
1104 Ga0307409_100064031
1105 Ga0307409_100257302
1106 Ga0307416_100021175
1107 Ga0307416_100024861
1108 Ga0307416_100026843
1109 Ga0307414_10002000
1110 Ga0307414_10002715
1111 Ga0307414_10023308
1112 Ga0307411_10086537
1113 Ga0307415_100003868
1114 Ga0373951_0007574
1115 Ga0373942_0010122
1116 Ga0395905_0055145
1117 Ga0395901_0125374
1118 Ga0436365_0039241
1119 Ga0436365_0067166
1120 Ga0436365_0803376
1121 Ga0439448_0004829
1122 Ga0439458_0002958
1123 Ga0439434_0008739
1124 Ga0453683_0008014
1125 Ga0451576_0081302
1126 Ga0495632_0009924
1127 Ga0495663_0000575
1128 Ga0495598_0000025
1129 Ga0495621_0000299
1130 Ga0496102_0036150
1131 Ga0496106_0005253
1132 Ga0496106_0009270
1133 Ga0496107_0098683
1134 Ga0496109_0000411
1135 Ga0496109_0129075
1136 Ga0496109_0238287
1137 Ga0496110_0114208
1138 Ga0496110_0148420
1139 Ga0501298_002637
1140 Ga0501038_0001223
1141 Ga0501040_0125655
1142 Ga0501202_011077
1143 Ga0501224_003730
1144 Ga0501240_005475
1145 Ga0501243_008464
1146 Ga0501249_030697
1147 Ga0501253_003355
1148 Ga0501261_004098
1149 Ga0501225_0011665
1150 Ga0501225_0017642
1151 Ga0501225_0019225
1152 Ga0501268_006098
1153 nmdc:mga05p37_27910_c1
1154 nmdc:mga05p37_284052_c1
1155 nmdc:mga05p37_29348_c1
1156 nmdc:mga05p37_316957_c1
1157 nmdc:mga05p37_87355_c1
1158 nmdc:mga05p37_99098_c1
1159 nmdc:mga09592_54194_c1
1160 nmdc:mga09592_87558_c1
1161 nmdc:mga0qj67_128628_c1
1162 nmdc:mga0qj67_142747_c1
1163 nmdc:mga0qj67_253552_c1
1164 nmdc:mga0qj67_29645_c1
1165 nmdc:mga08y16_164400_c1
1166 nmdc:mga08y16_17931_c1
1167 nmdc:mga08y16_21200_c1
1168 nmdc:mga08y16_22423_c1
1169 nmdc:mga08y16_271955_c1
1170 nmdc:mga0n895_169550_c1
1171 nmdc:mga0n895_198324_c1
1172 nmdc:mga0n895_26496_c1
1173 nmdc:mga0n895_278039_c1
1174 nmdc:mga0n895_352649_c1
1175 nmdc:mga0n895_36227_c1
1176 nmdc:mga0rr50_35048_c1
1177 nmdc:mga0rr50_4648_c1
1178 nmdc:mga08x19_16_c1
1179 nmdc:mga08x19_20672_c1
1180 nmdc:mga0a205_15000_c1
1181 nmdc:mga0a205_27267_c1
1182 nmdc:mga0a205_87344_c1
1183 nmdc:mga0a205_88039_c1
1184 nmdc:mga0a205_90001_c1
1185 Ga0500616_0001365
1186 Ga0501084_0064440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08436

DXP_redisom_C

1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain

120

203

0.99

PF02670

DXP_reductoisom

1-deoxy-D-xylulose 5-phosphate reductoisomerase

1

106

0.97

PF13288

DXPR_C

DXP reductoisomerase C-terminal domain

227

341

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mh5-assembly1.cif.gz_A crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from staphylococcus schleiferi in complex with fosmidomycin (fom) 0.9606 9 383
1r0k-assembly2.cif.gz_C crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9564 8 393
1r0l-assembly2.cif.gz_D 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph 0.9551 8 393
1r0l-assembly1.cif.gz_A 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph 0.9545 8 393
1r0l-assembly2.cif.gz_C 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph 0.9541 7 391
ID Description Score Start End Superfamily
4zn6B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9974 310 394 1.10.1740.10
1k5hB03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9738 310 393 1.10.1740.10
af_A0A1D6MNI9_381_464_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9734 311 388 1.10.1740.10
3zhyB03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9731 310 391 1.10.1740.10
1t1rA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9726 310 394 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A3D5SRD2-F1-model_v4 DXP reductoisomerase C-terminal domain-containing protein 1.003 308 396 GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A6B3I8M4-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9841 152 268 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A6G3VJI6-F1-model_v4 deleted 0.9799 152 261
AF-A0A2V9P9L1-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9779 102 394 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A6N3ING8-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9774 135 269 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402

Map