F467243

General Info

Members Datasets Scaffolds Average Seq Length
593 262 1186 119

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0330275|Ga0395899_0330275_568_996
Length 142
Sequence MTKNYLTGCRLFHAPFDLLMEGHKMKYMLLVYLDEQALSEDERAHCYEESAQLAQDLNSSGQYLSAGPLHPTATATSIRMRNGKRLVTDGPFAETREQLGGYYLIDVGNLDEAISIAERVPVARVGTIEIRPVLDITGLPTA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.88
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 18.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0330275 3300037312 Bacteria 1025
2 Ga0065704_10090388 3300005289 Bacteria 2773
3 Ga0065704_10176007 3300005289 Unclassified 1263
4 Ga0065704_10333120 3300005289 Bacteria 835
5 Ga0065715_10181355 3300005293 Unclassified 1474
6 Ga0065715_10452220 3300005293 Bacteria 825
7 Ga0065715_10614916 3300005293 Bacteria 688
8 Ga0065707_10034960 3300005295 Bacteria 1258
9 Ga0070676_10060060 3300005328 Unclassified 2256
10 Ga0070676_10150627 3300005328 Bacteria 1489
11 Ga0070683_100092864 3300005329 Bacteria 2834
12 Ga0070690_100023265 3300005330 Bacteria 3799
13 Ga0070690_100074620 3300005330 Bacteria 2209
14 Ga0070690_100078842 3300005330 Bacteria 2153
15 Ga0070690_100501559 3300005330 Unclassified 908
16 Ga0070670_100357163 3300005331 Bacteria 1284
17 Ga0070677_10381168 3300005333 Bacteria 738
18 Ga0068869_100015639 3300005334 Bacteria 5096
19 Ga0068869_100238821 3300005334 Bacteria 1447
20 Ga0068869_101022801 3300005334 Bacteria 720
21 Ga0068869_101238096 3300005334 Bacteria 657
22 Ga0070680_100178648 3300005336 Unclassified 1788
23 Ga0070682_100000599 3300005337 Bacteria 21932
24 Ga0070682_100004013 3300005337 Bacteria 8180
25 Ga0070682_101257583 3300005337 Bacteria 627
26 Ga0068868_100028231 3300005338 Bacteria 4288
27 Ga0068868_100914648 3300005338 Bacteria 798
28 Ga0068868_101723578 3300005338 Bacteria 591
29 Ga0070660_100060125 3300005339 Bacteria 2948
30 Ga0070689_100000044 3300005340 Bacteria 76920
31 Ga0070689_100174096 3300005340 Bacteria 1745
32 Ga0070689_100239285 3300005340 Bacteria 1494
33 Ga0070689_102185263 3300005340 Unclassified 507
34 Ga0070691_10027840 3300005341 Bacteria 2638
35 Ga0070691_10179919 3300005341 Bacteria 1100
36 Ga0070687_100190636 3300005343 Bacteria 1235
37 Ga0070687_101467282 3300005343 Unclassified 512
38 Ga0070661_100100646 3300005344 Bacteria 2149
39 Ga0070661_100126510 3300005344 Bacteria 1917
40 Ga0070692_10227030 3300005345 Bacteria 1106
41 Ga0070692_10561817 3300005345 Bacteria 749
42 Ga0070668_100101389 3300005347 Bacteria 2281
43 Ga0070668_100975309 3300005347 Bacteria 761
44 Ga0070669_100035240 3300005353 Bacteria 3625
45 Ga0070669_100519123 3300005353 Bacteria 990
46 Ga0070675_100126152 3300005354 Bacteria 2177
47 Ga0070675_100309671 3300005354 Bacteria 1393
48 Ga0070675_100577437 3300005354 Bacteria 1018
49 Ga0070675_101512907 3300005354 Bacteria 619
50 Ga0070671_100232837 3300005355 Bacteria 1563
51 Ga0070671_100866379 3300005355 Bacteria 788
52 Ga0070671_101661076 3300005355 Bacteria 567
53 Ga0070671_102087614 3300005355 Unclassified 505
54 Ga0070674_100210423 3300005356 Bacteria 1507
55 Ga0070674_100418964 3300005356 Bacteria 1098
56 Ga0070674_100533281 3300005356 Bacteria 982
57 Ga0070674_100766750 3300005356 Unclassified 830
58 Ga0070673_101342496 3300005364 Bacteria 672
59 Ga0070688_100634672 3300005365 Unclassified 821
60 Ga0070659_100009587 3300005366 Bacteria 7117
61 Ga0070667_100003340 3300005367 Bacteria 13707
62 Ga0070703_10169844 3300005406 Bacteria 834
63 Ga0070703_10242723 3300005406 Bacteria 727
64 Ga0070709_10000133 3300005434 Bacteria 49469
65 Ga0070709_10715163 3300005434 Bacteria 780
66 Ga0070714_100596034 3300005435 Bacteria 1061
67 Ga0070713_100070346 3300005436 Bacteria 2954
68 Ga0070710_10683427 3300005437 Unclassified 723
69 Ga0070701_10055662 3300005438 Unclassified 2067
70 Ga0070701_10161272 3300005438 Bacteria 1299
71 Ga0070701_10164570 3300005438 Bacteria 1287
72 Ga0070701_10224075 3300005438 Bacteria 1123
73 Ga0070701_10311343 3300005438 Bacteria 971
74 Ga0070705_100031666 3300005440 Unclassified 2931
75 Ga0070705_100201236 3300005440 Bacteria 1365
76 Ga0070705_100558577 3300005440 Bacteria 879
77 Ga0070705_101188610 3300005440 Bacteria 628
78 Ga0070700_100019961 3300005441 Unclassified 3874
79 Ga0070700_100101110 3300005441 Unclassified 1899
80 Ga0070700_100174131 3300005441 Bacteria 1492
81 Ga0070700_100384196 3300005441 Bacteria 1051
82 Ga0070694_100016680 3300005444 Bacteria 4625
83 Ga0070694_100039993 3300005444 Bacteria 3124
84 Ga0070694_100043362 3300005444 Bacteria 3008
85 Ga0070694_100083293 3300005444 Unclassified 2229
86 Ga0070694_100176264 3300005444 Bacteria 1578
87 Ga0070694_100884687 3300005444 Bacteria 736
88 Ga0070708_100448686 3300005445 Bacteria 1217
89 Ga0070708_100483285 3300005445 Unclassified 1168
90 Ga0070708_101442094 3300005445 Unclassified 642
91 Ga0070663_100040016 3300005455 Bacteria 3279
92 Ga0070663_100142507 3300005455 Bacteria 1831
93 Ga0070678_100139548 3300005456 Bacteria 1938
94 Ga0070678_100744308 3300005456 Unclassified 886
95 Ga0070662_100014504 3300005457 Bacteria 5268
96 Ga0070662_100052687 3300005457 Unclassified 2943
97 Ga0070662_100148033 3300005457 Bacteria 1825
98 Ga0070662_100436437 3300005457 Bacteria 1085
99 Ga0070681_10245532 3300005458 Bacteria 1703
100 Ga0070681_10950169 3300005458 Bacteria 779
101 Ga0070681_11109287 3300005458 Unclassified 712
102 Ga0068867_100118634 3300005459 Bacteria 2041
103 Ga0068867_100127627 3300005459 Bacteria 1973
104 Ga0068867_100163296 3300005459 Bacteria 1758
105 Ga0068867_100355050 3300005459 Bacteria 1224
106 Ga0068867_101944986 3300005459 Bacteria 555
107 Ga0070685_10165730 3300005466 Bacteria 1412
108 Ga0070685_10247503 3300005466 Bacteria 1179
109 Ga0070706_100030518 3300005467 Bacteria 4968
110 Ga0070706_100356499 3300005467 Unclassified 1363
111 Ga0070706_101194644 3300005467 Bacteria 699
112 Ga0070707_100000506 3300005468 Bacteria 38731
113 Ga0070707_100005547 3300005468 Bacteria 11789
114 Ga0070707_100044136 3300005468 Bacteria 4267
115 Ga0070707_100094187 3300005468 Bacteria 2900
116 Ga0070707_101325557 3300005468 Bacteria 686
117 Ga0070707_101595463 3300005468 Bacteria 619
118 Ga0070698_100000010 3300005471 Bacteria 117353
119 Ga0070698_100002655 3300005471 Bacteria 19721
120 Ga0070698_100173657 3300005471 Bacteria 2095
121 Ga0070698_100701524 3300005471 Bacteria 954
122 Ga0070699_100113468 3300005518 Bacteria 2380
123 Ga0070699_100367309 3300005518 Bacteria 1298
124 Ga0070699_100580844 3300005518 Bacteria 1021
125 Ga0070699_100809792 3300005518 Bacteria 857
126 Ga0070699_101084837 3300005518 Bacteria 734
127 Ga0070699_101371841 3300005518 Unclassified 648
128 Ga0070679_100248170 3300005530 Unclassified 1736
129 Ga0070679_101291880 3300005530 Unclassified 675
130 Ga0070684_100009079 3300005535 Bacteria 7815
131 Ga0070684_100258346 3300005535 Unclassified 1593
132 Ga0070697_100016648 3300005536 Bacteria 5783
133 Ga0070697_100032051 3300005536 Bacteria 4227
134 Ga0070697_100038665 3300005536 Bacteria 3856
135 Ga0070697_100077618 3300005536 Bacteria 2733
136 Ga0070697_100124123 3300005536 Bacteria 2162
137 Ga0070697_100508045 3300005536 Bacteria 1054
138 Ga0068853_100329922 3300005539 Bacteria 1415
139 Ga0070672_100913057 3300005543 Bacteria 776
140 Ga0070686_100014523 3300005544 Bacteria 4543
141 Ga0070686_100489224 3300005544 Bacteria 953
142 Ga0070686_101274219 3300005544 Bacteria 613
143 Ga0070695_100027159 3300005545 Bacteria 3544
144 Ga0070695_100151453 3300005545 Bacteria 1619
145 Ga0070695_100193756 3300005545 Bacteria 1448
146 Ga0070695_100195558 3300005545 Bacteria 1442
147 Ga0070695_100964674 3300005545 Unclassified 692
148 Ga0070696_100002714 3300005546 Bacteria 11745
149 Ga0070696_100050310 3300005546 Bacteria 2896
150 Ga0070696_100058391 3300005546 Unclassified 2694
151 Ga0070696_100511909 3300005546 Bacteria 956
152 Ga0070696_100652354 3300005546 Bacteria 853
153 Ga0070693_100221076 3300005547 Bacteria 1241
154 Ga0070693_100894489 3300005547 Unclassified 665
155 Ga0070665_100004021 3300005548 Bacteria 15482
156 Ga0070704_100038084 3300005549 Bacteria 3291
157 Ga0070704_100045881 3300005549 Bacteria 3043
158 Ga0070704_100304887 3300005549 Bacteria 1328
159 Ga0070704_100320071 3300005549 Unclassified 1299
160 Ga0070704_100363164 3300005549 Unclassified 1225
161 Ga0070704_100477807 3300005549 Bacteria 1078
162 Ga0070704_101677485 3300005549 Unclassified 587
163 Ga0070704_102123679 3300005549 Unclassified 522
164 Ga0070704_102281174 3300005549 Unclassified 503
165 Ga0068855_100013917 3300005563 Bacteria 9702
166 Ga0068855_100705672 3300005563 Bacteria 1079
167 Ga0068855_100933588 3300005563 Unclassified 915
168 Ga0068857_100073143 3300005577 Bacteria 3053
169 Ga0068857_100150919 3300005577 Bacteria 2105
170 Ga0068857_100528725 3300005577 Bacteria 1109
171 Ga0068857_100857109 3300005577 Bacteria 870
172 Ga0068854_100212221 3300005578 Unclassified 1527
173 Ga0068854_100820779 3300005578 Bacteria 812
174 Ga0068856_100068336 3300005614 Bacteria 3512
175 Ga0070702_100151283 3300005615 Bacteria 1490
176 Ga0070702_100417622 3300005615 Bacteria 964
177 Ga0070702_101329057 3300005615 Bacteria 585
178 Ga0068852_100022697 3300005616 Bacteria 5038
179 Ga0068852_102071962 3300005616 Unclassified 591
180 Ga0068859_100027837 3300005617 Bacteria 5669
181 Ga0068859_100047495 3300005617 Unclassified 4313
182 Ga0068859_100291717 3300005617 Bacteria 1724
183 Ga0068859_100405858 3300005617 Bacteria 1459
184 Ga0068859_101010547 3300005617 Bacteria 913
185 Ga0068859_101081448 3300005617 Bacteria 882
186 Ga0068859_101349685 3300005617 Bacteria 786
187 Ga0068864_100016354 3300005618 Bacteria 6175
188 Ga0068864_100422894 3300005618 Bacteria 1270
189 Ga0068864_100756176 3300005618 Bacteria 953
190 Ga0068864_101779469 3300005618 Bacteria 621
191 Ga0068864_102485975 3300005618 Unclassified 524
192 Ga0068866_10006751 3300005718 Bacteria 4785
193 Ga0068861_100233882 3300005719 Unclassified 1560
194 Ga0068861_100311293 3300005719 Bacteria 1368
195 Ga0068861_101584963 3300005719 Bacteria 645
196 Ga0068851_10001511 3300005834 Bacteria 10207
197 Ga0068863_100347201 3300005841 Bacteria 1444
198 Ga0068858_100039634 3300005842 Bacteria 4368
199 Ga0068858_100312604 3300005842 Bacteria 1500
200 Ga0068858_100317868 3300005842 Bacteria 1487
201 Ga0068858_101224985 3300005842 Bacteria 738
202 Ga0068860_100113024 3300005843 Bacteria 2596
203 Ga0068860_100616781 3300005843 Unclassified 1091
204 Ga0068860_100667749 3300005843 Bacteria 1048
205 Ga0068862_100030916 3300005844 Bacteria 4515
206 Ga0068862_100107367 3300005844 Bacteria 2448
207 Ga0068862_100269159 3300005844 Bacteria 1558
208 Ga0068862_100305539 3300005844 Bacteria 1464
209 Ga0068862_101340628 3300005844 Bacteria 718
210 Ga0070715_10438002 3300006163 Bacteria 735
211 Ga0070716_101123524 3300006173 Unclassified 628
212 Ga0075428_100310231 3300006844 Bacteria 1696
213 Ga0075428_100435867 3300006844 Bacteria 1404
214 Ga0075428_101904826 3300006844 Unclassified 618
215 Ga0075430_100008748 3300006846 Bacteria 8545
216 Ga0075431_100093005 3300006847 Bacteria 3112
217 Ga0075431_100329381 3300006847 Bacteria 1538
218 Ga0075431_100885401 3300006847 Unclassified 863
219 Ga0075433_10095753 3300006852 Bacteria 2627
220 Ga0075433_10538088 3300006852 Unclassified 1027
221 Ga0075433_11619892 3300006852 Bacteria 558
222 Ga0075434_100079753 3300006871 Bacteria 3270
223 Ga0075434_100211910 3300006871 Unclassified 1957
224 Ga0075434_101409251 3300006871 Bacteria 707
225 Ga0075429_100090166 3300006880 Bacteria 2673
226 Ga0075429_100457512 3300006880 Unclassified 1118
227 Ga0068865_100018297 3300006881 Bacteria 4520
228 Ga0068865_100525935 3300006881 Bacteria 990
229 Ga0075436_100313507 3300006914 Bacteria 1126
230 Ga0075436_100316833 3300006914 Bacteria 1120
231 Ga0097620_100027836 3300006931 Bacteria 5669
232 Ga0097620_100047497 3300006931 Unclassified 4313
233 Ga0097620_100291701 3300006931 Bacteria 1724
234 Ga0097620_100405843 3300006931 Bacteria 1459
235 Ga0097620_101010716 3300006931 Bacteria 913
236 Ga0097620_101081206 3300006931 Bacteria 882
237 Ga0097620_101350143 3300006931 Bacteria 786
238 Ga0075435_100149793 3300007076 Bacteria 1961
239 Ga0075435_100225889 3300007076 Unclassified 1590
240 Ga0099794_10055599 3300007265 Bacteria 1913
241 Ga0099794_10114404 3300007265 Bacteria 1354
242 Ga0099794_10340195 3300007265 Bacteria 780
243 Ga0105240_10025059 3300009093 Bacteria 7851
244 Ga0105240_10078772 3300009093 Bacteria 4057
245 Ga0105240_12075146 3300009093 Unclassified 590
246 Ga0111539_12740918 3300009094 Bacteria 571
247 Ga0105245_10342073 3300009098 Unclassified 1480
248 Ga0105245_12125459 3300009098 Unclassified 615
249 Ga0105247_10270766 3300009101 Bacteria 1168
250 Ga0105247_11610049 3300009101 Bacteria 534
251 Ga0105247_11819342 3300009101 Bacteria 507
252 Ga0114129_10002325 3300009147 Bacteria 26400
253 Ga0114129_10012205 3300009147 Bacteria 12225
254 Ga0114129_10015871 3300009147 Bacteria 10710
255 Ga0114129_10081996 3300009147 Bacteria 4483
256 Ga0114129_10183993 3300009147 Unclassified 2841
257 Ga0114129_10190923 3300009147 Unclassified 2782
258 Ga0114129_10319193 3300009147 Bacteria 2065
259 Ga0114129_10410959 3300009147 Bacteria 1782
260 Ga0114129_10551823 3300009147 Bacteria 1498
261 Ga0114129_10692721 3300009147 Bacteria 1310
262 Ga0114129_10848615 3300009147 Bacteria 1161
263 Ga0114129_12925356 3300009147 Bacteria 564
264 Ga0105243_10088365 3300009148 Bacteria 2546
265 Ga0105243_10120237 3300009148 Bacteria 2213
266 Ga0105243_10322348 3300009148 Bacteria 1409
267 Ga0105243_10332700 3300009148 Bacteria 1388
268 Ga0105243_13011375 3300009148 Bacteria 511
269 Ga0105241_10123285 3300009174 Bacteria 2090
270 Ga0105241_10178848 3300009174 Bacteria 1758
271 Ga0105242_10003793 3300009176 Bacteria 11748
272 Ga0105242_10023511 3300009176 Bacteria 4856
273 Ga0105242_10054282 3300009176 Bacteria 3275
274 Ga0105242_10582760 3300009176 Bacteria 1078
275 Ga0105242_12620160 3300009176 Unclassified 553
276 Ga0105248_10039456 3300009177 Bacteria 5289
277 Ga0105248_10159118 3300009177 Bacteria 2548
278 Ga0105248_10358648 3300009177 Bacteria 1641
279 Ga0105248_11039388 3300009177 Bacteria 925
280 Ga0105237_10097758 3300009545 Bacteria 2927
281 Ga0105237_11491539 3300009545 Unclassified 683
282 Ga0105237_11819148 3300009545 Bacteria 617
283 Ga0105238_10031758 3300009551 Bacteria 5373
284 Ga0105238_10103224 3300009551 Bacteria 2832
285 Ga0105249_10008398 3300009553 Bacteria 8996
286 Ga0105249_10328429 3300009553 Unclassified 1543
287 Ga0105249_12515386 3300009553 Unclassified 587
288 Ga0105239_10005652 3300010375 Bacteria 14612
289 Ga0105239_10064365 3300010375 Bacteria 4026
290 Ga0105239_10110459 3300010375 Bacteria 3048
291 Ga0105239_10504404 3300010375 Bacteria 1376
292 Ga0105239_11830808 3300010375 Bacteria 703
293 Ga0105246_10176479 3300011119 Bacteria 1641
294 Ga0105246_10307393 3300011119 Bacteria 1283
295 Ga0157373_10147229 3300013100 Unclassified 1657
296 Ga0157373_10229364 3300013100 Bacteria 1311
297 Ga0157373_10405977 3300013100 Bacteria 977
298 Ga0157371_10008099 3300013102 Bacteria 8402
299 Ga0157370_10019183 3300013104 Bacteria 6873
300 Ga0157370_11941751 3300013104 Unclassified 528
301 Ga0157369_10014642 3300013105 Bacteria 8848
302 Ga0157374_10007554 3300013296 Bacteria 9275
303 Ga0157378_10052643 3300013297 Bacteria 3622
304 Ga0157378_10054351 3300013297 Bacteria 3565
305 Ga0157378_10071482 3300013297 Bacteria 3116
306 Ga0157378_10151775 3300013297 Bacteria 2159
307 Ga0157378_10153407 3300013297 Bacteria 2148
308 Ga0157378_10278307 3300013297 Bacteria 1612
309 Ga0157378_11362295 3300013297 Unclassified 752
310 Ga0157378_12023573 3300013297 Unclassified 626
311 Ga0163162_10030893 3300013306 Bacteria 5309
312 Ga0163162_10117634 3300013306 Bacteria 2760
313 Ga0163162_11106566 3300013306 Bacteria 898
314 Ga0157372_10005485 3300013307 Bacteria 13479
315 Ga0157372_10226930 3300013307 Bacteria 2165
316 Ga0157375_10044451 3300013308 Bacteria 4316
317 Ga0157375_10051775 3300013308 Unclassified 4034
318 Ga0157375_10211537 3300013308 Bacteria 2097
319 Ga0157375_10263629 3300013308 Bacteria 1884
320 Ga0157375_10502725 3300013308 Bacteria 1376
321 Ga0163163_10125431 3300014325 Bacteria 2605
322 Ga0163163_10387743 3300014325 Bacteria 1455
323 Ga0163163_11582848 3300014325 Bacteria 716
324 Ga0157380_10009337 3300014326 Bacteria 7024
325 Ga0157380_10026490 3300014326 Unclassified 4402
326 Ga0157380_10064983 3300014326 Bacteria 2931
327 Ga0157377_10500344 3300014745 Unclassified 849
328 Ga0157379_10119862 3300014968 Bacteria 2366
329 Ga0157379_10416225 3300014968 Bacteria 1237
330 Ga0157376_10177589 3300014969 Bacteria 1944
331 Ga0163161_10876183 3300017792 Unclassified 759
332 Ga0197907_11119277 3300020069 Unclassified 1501
333 Ga0206349_1375796 3300020075 Unclassified 847
334 Ga0206350_10877881 3300020080 Unclassified 1134
335 Ga0207656_10302281 3300025321 Unclassified 792
336 Ga0207653_10026773 3300025885 Bacteria 1850
337 Ga0207653_10317791 3300025885 Unclassified 605
338 Ga0207682_10266925 3300025893 Bacteria 799
339 Ga0207642_10081381 3300025899 Bacteria 1573
340 Ga0207642_10196076 3300025899 Bacteria 1112
341 Ga0207710_10029199 3300025900 Bacteria 2398
342 Ga0207647_10404984 3300025904 Bacteria 768
343 Ga0207699_10000137 3300025906 Bacteria 49548
344 Ga0207645_10006746 3300025907 Bacteria 8199
345 Ga0207643_10010235 3300025908 Bacteria 5045
346 Ga0207684_10047808 3300025910 Bacteria 3629
347 Ga0207684_10073175 3300025910 Bacteria 2910
348 Ga0207684_10075363 3300025910 Bacteria 2867
349 Ga0207684_10272435 3300025910 Bacteria 1460
350 Ga0207684_11559554 3300025910 Bacteria 536
351 Ga0207654_10002654 3300025911 Bacteria 9078
352 Ga0207695_10017287 3300025913 Bacteria 8398
353 Ga0207695_10021258 3300025913 Bacteria 7410
354 Ga0207695_11643272 3300025913 Unclassified 523
355 Ga0207671_10154906 3300025914 Bacteria 1772
356 Ga0207663_11227970 3300025916 Bacteria 604
357 Ga0207660_10105915 3300025917 Unclassified 2108
358 Ga0207660_10590814 3300025917 Unclassified 904
359 Ga0207662_10061235 3300025918 Unclassified 2259
360 Ga0207662_10174083 3300025918 Bacteria 1382
361 Ga0207662_10175776 3300025918 Bacteria 1375
362 Ga0207662_10593914 3300025918 Unclassified 770
363 Ga0207662_10883692 3300025918 Bacteria 632
364 Ga0207662_11082854 3300025918 Unclassified 570
365 Ga0207657_10013728 3300025919 Bacteria 7929
366 Ga0207652_10154302 3300025921 Bacteria 2057
367 Ga0207652_10823670 3300025921 Bacteria 823
368 Ga0207652_11145594 3300025921 Unclassified 679
369 Ga0207646_10001642 3300025922 Bacteria 27334
370 Ga0207646_10067222 3300025922 Bacteria 3200
371 Ga0207646_10069906 3300025922 Bacteria 3136
372 Ga0207646_10154589 3300025922 Bacteria 2069
373 Ga0207646_10470482 3300025922 Unclassified 1133
374 Ga0207646_10535058 3300025922 Bacteria 1054
375 Ga0207646_10891786 3300025922 Unclassified 789
376 Ga0207681_10346020 3300025923 Bacteria 1189
377 Ga0207694_10366631 3300025924 Unclassified 1194
378 Ga0207659_10299311 3300025926 Bacteria 1321
379 Ga0207659_10635387 3300025926 Bacteria 912
380 Ga0207659_10749309 3300025926 Bacteria 838
381 Ga0207659_11320723 3300025926 Bacteria 619
382 Ga0207687_10002949 3300025927 Bacteria 11543
383 Ga0207687_11370413 3300025927 Bacteria 608
384 Ga0207664_10393712 3300025929 Bacteria 1231
385 Ga0207644_10765031 3300025931 Bacteria 807
386 Ga0207644_10840612 3300025931 Bacteria 768
387 Ga0207690_10654105 3300025932 Unclassified 861
388 Ga0207706_10000520 3300025933 Bacteria 40984
389 Ga0207706_10047223 3300025933 Bacteria 3811
390 Ga0207706_10051142 3300025933 Unclassified 3650
391 Ga0207706_10155212 3300025933 Bacteria 2013
392 Ga0207686_10002102 3300025934 Bacteria 10981
393 Ga0207686_10007098 3300025934 Bacteria 6028
394 Ga0207686_10079755 3300025934 Bacteria 2132
395 Ga0207709_10069919 3300025935 Bacteria 2224
396 Ga0207709_10566878 3300025935 Bacteria 895
397 Ga0207709_10647461 3300025935 Bacteria 841
398 Ga0207670_10095898 3300025936 Bacteria 2108
399 Ga0207670_10122487 3300025936 Bacteria 1893
400 Ga0207670_10132104 3300025936 Bacteria 1830
401 Ga0207670_10256763 3300025936 Bacteria 1353
402 Ga0207670_10665877 3300025936 Unclassified 859
403 Ga0207670_11904159 3300025936 Bacteria 506
404 Ga0207669_10203956 3300025937 Bacteria 1438
405 Ga0207669_10376828 3300025937 Bacteria 1104
406 Ga0207665_10057954 3300025939 Bacteria 2617
407 Ga0207665_10566159 3300025939 Unclassified 884
408 Ga0207711_10003413 3300025941 Bacteria 13747
409 Ga0207711_10371988 3300025941 Bacteria 1325
410 Ga0207711_10819869 3300025941 Bacteria 866
411 Ga0207711_10861007 3300025941 Bacteria 843
412 Ga0207689_10020764 3300025942 Bacteria 5523
413 Ga0207689_10107885 3300025942 Bacteria 2288
414 Ga0207689_10532398 3300025942 Bacteria 986
415 Ga0207689_10638845 3300025942 Bacteria 896
416 Ga0207661_10174903 3300025944 Bacteria 1871
417 Ga0207679_10278587 3300025945 Bacteria 1433
418 Ga0207667_10012506 3300025949 Bacteria 9771
419 Ga0207667_10090465 3300025949 Bacteria 3163
420 Ga0207667_10474543 3300025949 Bacteria 1270
421 Ga0207651_10175003 3300025960 Bacteria 1697
422 Ga0207651_10670078 3300025960 Bacteria 912
423 Ga0207712_10018756 3300025961 Bacteria 4510
424 Ga0207640_10002162 3300025981 Bacteria 10567
425 Ga0207640_10466911 3300025981 Bacteria 1044
426 Ga0207658_10265567 3300025986 Unclassified 1464
427 Ga0207677_10167210 3300026023 Bacteria 1715
428 Ga0207703_10387604 3300026035 Bacteria 1294
429 Ga0207703_11027143 3300026035 Bacteria 791
430 Ga0207639_10221228 3300026041 Unclassified 1635
431 Ga0207678_10001213 3300026067 Bacteria 23710
432 Ga0207708_10142506 3300026075 Unclassified 1881
433 Ga0207708_10186484 3300026075 Bacteria 1649
434 Ga0207708_10439858 3300026075 Unclassified 1084
435 Ga0207708_10474528 3300026075 Bacteria 1045
436 Ga0207708_11908856 3300026075 Bacteria 520
437 Ga0207702_10007182 3300026078 Bacteria 9532
438 Ga0207641_10029385 3300026088 Bacteria 4545
439 Ga0207641_10376664 3300026088 Bacteria 1358
440 Ga0207648_10079226 3300026089 Bacteria 2865
441 Ga0207648_10107530 3300026089 Bacteria 2448
442 Ga0207648_10564589 3300026089 Bacteria 1046
443 Ga0207648_10950980 3300026089 Bacteria 804
444 Ga0207648_11065162 3300026089 Bacteria 758
445 Ga0207676_10090863 3300026095 Bacteria 2507
446 Ga0207676_10150353 3300026095 Bacteria 2004
447 Ga0207676_10531914 3300026095 Bacteria 1121
448 Ga0207676_10907080 3300026095 Bacteria 865
449 Ga0207676_11051064 3300026095 Bacteria 804
450 Ga0207674_10053136 3300026116 Bacteria 4130
451 Ga0207674_10155354 3300026116 Bacteria 2243
452 Ga0207674_11412717 3300026116 Bacteria 665
453 Ga0207675_100192380 3300026118 Bacteria 1957
454 Ga0207675_100410129 3300026118 Bacteria 1336
455 Ga0207675_100560060 3300026118 Bacteria 1143
456 Ga0207675_100672731 3300026118 Bacteria 1042
457 Ga0207675_100716642 3300026118 Bacteria 1010
458 Ga0207683_10080881 3300026121 Bacteria 2883
459 Ga0207698_10033272 3300026142 Bacteria 3745
460 Ga0207698_11264843 3300026142 Bacteria 752
461 Ga0268266_10022900 3300028379 Bacteria 5316
462 Ga0268266_11545326 3300028379 Bacteria 639
463 Ga0268265_10046538 3300028380 Bacteria 3244
464 Ga0268265_10172331 3300028380 Bacteria 1851
465 Ga0268265_10201999 3300028380 Bacteria 1725
466 Ga0268264_10149459 3300028381 Bacteria 2093
467 Ga0268264_10573803 3300028381 Unclassified 1109
468 Ga0268264_10612402 3300028381 Bacteria 1074
469 Ga0268264_10644980 3300028381 Bacteria 1047
470 Ga0307409_100162150 3300031995 Bacteria 1957
471 Ga0307411_11010625 3300032005 Unclassified 745
472 Ga0373930_0008347 3300034816 Bacteria 1812
473 Ga0373938_0091296 3300034957 Unclassified 754
474 Ga0373940_0025458 3300035088 Bacteria 1541
475 Ga0373951_0001564 3300035091 Bacteria 5986
476 Ga0373941_0056456 3300035115 Bacteria 1265
477 Ga0373931_0078306 3300035691 Bacteria 1818
478 Ga0395900_1904831 3300037418 Unclassified 505
479 Ga0395898_0442984 3300037466 Bacteria 1237
480 Ga0395898_1122400 3300037466 Bacteria 719
481 Ga0395901_0065169 3300038443 Bacteria 3793
482 Ga0439453_0117936 3300041408 Bacteria 606
483 Ga0439432_194468 3300042006 Unclassified 589
484 Ga0439455_0009598 3300042012 Bacteria 2106
485 Ga0450914_032962 3300042118 Bacteria 631
486 Ga0439458_0007435 3300042157 Bacteria 2439
487 Ga0439464_0038385 3300042439 Unclassified 1360
488 Ga0450893_0108392 3300042532 Bacteria 571
489 Ga0451577_1529877 3300042876 Bacteria 590
490 Ga0453683_0192636 3300044673 Bacteria 1294
491 Ga0453683_1022853 3300044673 Bacteria 549
492 Ga0451576_0325817 3300045051 Bacteria 1608
493 Ga0495580_0032694 3300046472 Bacteria 3752
494 Ga0495639_0139193 3300046475 Bacteria 1166
495 Ga0495662_0298927 3300046476 Bacteria 792
496 Ga0495663_0000784 3300046525 Bacteria 10857
497 Ga0495665_0360211 3300046531 Bacteria 740
498 Ga0495640_0498999 3300046533 Unclassified 741
499 Ga0495586_0366545 3300046535 Bacteria 828
500 Ga0495598_0000047 3300046537 Bacteria 18754
501 Ga0495621_0006637 3300046539 Bacteria 3388
502 Ga0495621_0288584 3300046539 Unclassified 678
503 Ga0495668_0221869 3300046616 Unclassified 1035
504 Ga0495634_0098635 3300046642 Bacteria 1890
505 Ga0495647_0590970 3300046681 Bacteria 521
506 Ga0495658_0379230 3300046683 Bacteria 900
507 Ga0495600_0622204 3300046809 Unclassified 655
508 Ga0495614_0295579 3300048089 Unclassified 748
509 Ga0496101_0056243 3300048904 Bacteria 2844
510 Ga0496102_0025002 3300048905 Bacteria 5313
511 Ga0496102_0045895 3300048905 Bacteria 3967
512 Ga0496103_0010356 3300048906 Bacteria 5518
513 Ga0496104_0089504 3300048907 Bacteria 2940
514 Ga0496105_0099811 3300048908 Bacteria 2398
515 Ga0496106_0107123 3300048909 Bacteria 2173
516 Ga0496106_0816042 3300048909 Unclassified 739
517 Ga0496107_0099800 3300048910 Bacteria 2128
518 Ga0496108_0078893 3300048911 Bacteria 2787
519 Ga0496109_0020508 3300048912 Bacteria 5838
520 Ga0496109_0091661 3300048912 Bacteria 2811
521 Ga0496110_0033945 3300048913 Bacteria 4416
522 Ga0496110_0050482 3300048913 Bacteria 3652
523 Ga0496111_0096483 3300048914 Unclassified 2170
524 Ga0496111_0462289 3300048914 Unclassified 936
525 Ga0496112_0143762 3300048915 Bacteria 2354
526 Ga0496112_0341599 3300048915 Unclassified 1440
527 Ga0496113_0188108 3300048916 Bacteria 1638
528 Ga0496113_0481031 3300048916 Unclassified 997
529 Ga0496115_0217740 3300048918 Bacteria 1576
530 Ga0496115_0456102 3300048918 Bacteria 1032
531 Ga0496115_0760693 3300048918 Unclassified 757
532 Ga0501031_0261613 3300049568 Bacteria 1124
533 Ga0501034_1535951 3300049571 Bacteria 539
534 Ga0501036_0030043 3300049572 Bacteria 4591
535 Ga0501038_0022090 3300049574 Bacteria 5704
536 Ga0501039_0044377 3300049575 Bacteria 3433
537 Ga0501040_0001593 3300049576 Bacteria 14460
538 Ga0501041_0003041 3300049577 Bacteria 9621
539 Ga0501041_0408241 3300049577 Bacteria 861
540 Ga0501042_0012537 3300049578 Bacteria 5744
541 Ga0501043_0037467 3300049579 Bacteria 3814
542 Ga0501046_0005343 3300049580 Bacteria 11489
543 Ga0501046_0051976 3300049580 Bacteria 3232
544 Ga0501048_0028583 3300049582 Bacteria 4047
545 Ga0501071_0007897 3300049587 Bacteria 7015
546 Ga0501072_0003022 3300049588 Bacteria 12690
547 Ga0501072_0003614 3300049588 Bacteria 11639
548 Ga0501073_0437068 3300049589 Bacteria 904
549 Ga0501074_0040599 3300049590 Bacteria 3370
550 Ga0501075_0013585 3300049591 Bacteria 5814
551 Ga0501075_0016028 3300049591 Bacteria 5392
552 Ga0501076_0014603 3300049592 Bacteria 5920
553 Ga0501077_0000195 3300049593 Bacteria 34941
554 Ga0501079_0000550 3300049741 Bacteria 24508
555 Ga0501080_0039009 3300049742 Bacteria 4432
556 Ga0501081_0000417 3300049743 Bacteria 23491
557 Ga0501081_0019917 3300049743 Bacteria 4469
558 Ga0501083_0033959 3300049744 Bacteria 3490
559 Ga0501035_0100870 3300049822 Bacteria 2534
560 Ga0501045_0004294 3300049824 Bacteria 9831
561 nmdc:mga05p37_110_c1 3300050507 Bacteria 74328
562 nmdc:mga05p37_12809_c1 3300050507 Bacteria 10026
563 nmdc:mga05p37_35219_c1 3300050507 Bacteria 6136
564 nmdc:mga05p37_5497_c1 3300050507 Bacteria 14885
565 nmdc:mga05p37_568875_c1 3300050507 Bacteria 1286
566 nmdc:mga05p37_580843_c1 3300050507 Bacteria 1269
567 nmdc:mga05p37_581537_c1 3300050507 Bacteria 1268
568 nmdc:mga05p37_59555_c2 3300050507 Bacteria 2343
569 nmdc:mga05p37_66047_c1 3300050507 Bacteria 4451
570 nmdc:mga05p37_67729_c1 3300050507 Bacteria 4392
571 nmdc:mga05p37_751411_c1 3300050507 Bacteria 1075
572 nmdc:mga09592_814754_c1 3300050508 Unclassified 789
573 nmdc:mga09592_817433_c1 3300050508 Bacteria 787
574 nmdc:mga0qj67_104781_c1 3300050509 Bacteria 2282
575 nmdc:mga06r32_1192834_c1 3300050510 Bacteria 708
576 nmdc:mga06r32_237083_c1 3300050510 Bacteria 1812
577 nmdc:mga0n895_130940_c1 3300050512 Bacteria 2533
578 nmdc:mga0n895_1380014_c1 3300050512 Bacteria 674
579 nmdc:mga0n895_517998_c1 3300050512 Bacteria 1200
580 nmdc:mga0n895_7683_c1 3300050512 Bacteria 9275
581 nmdc:mga0rr50_182042_c1 3300050513 Unclassified 1718
582 nmdc:mga0rr50_515635_c1 3300050513 Bacteria 1017
583 nmdc:mga08x19_288374_c1 3300050514 Bacteria 1138
584 nmdc:mga0a205_158305_c1 3300050515 Unclassified 2162
585 nmdc:mga0a205_253218_c1 3300050515 Bacteria 1640
586 nmdc:mga0a205_384329_c1 3300050515 Unclassified 1269
587 nmdc:mga0a205_51829_c1 3300050515 Bacteria 3962
588 Ga0501084_0001686 3300054114 Bacteria 17565
589 Ga0501084_0018114 3300054114 Bacteria 5865
590 Ga0587079_044646 3300059647 Unclassified 908
591 Ga0501082_0006761 3300060353 Bacteria 9912
592 Ga0501082_0195728 3300060353 Bacteria 1758
593 Ga0530510_0008140 3300061734 Bacteria 7314
594 Ga0395899_0330275
595 Ga0065704_10090388
596 Ga0065704_10176007
597 Ga0065704_10333120
598 Ga0065715_10181355
599 Ga0065715_10452220
600 Ga0065715_10614916
601 Ga0065707_10034960
602 Ga0070676_10060060
603 Ga0070676_10150627
604 Ga0070683_100092864
605 Ga0070690_100023265
606 Ga0070690_100074620
607 Ga0070690_100078842
608 Ga0070690_100501559
609 Ga0070670_100357163
610 Ga0070677_10381168
611 Ga0068869_100015639
612 Ga0068869_100238821
613 Ga0068869_101022801
614 Ga0068869_101238096
615 Ga0070680_100178648
616 Ga0070682_100000599
617 Ga0070682_100004013
618 Ga0070682_101257583
619 Ga0068868_100028231
620 Ga0068868_100914648
621 Ga0068868_101723578
622 Ga0070660_100060125
623 Ga0070689_100000044
624 Ga0070689_100174096
625 Ga0070689_100239285
626 Ga0070689_102185263
627 Ga0070691_10027840
628 Ga0070691_10179919
629 Ga0070687_100190636
630 Ga0070687_101467282
631 Ga0070661_100100646
632 Ga0070661_100126510
633 Ga0070692_10227030
634 Ga0070692_10561817
635 Ga0070668_100101389
636 Ga0070668_100975309
637 Ga0070669_100035240
638 Ga0070669_100519123
639 Ga0070675_100126152
640 Ga0070675_100309671
641 Ga0070675_100577437
642 Ga0070675_101512907
643 Ga0070671_100232837
644 Ga0070671_100866379
645 Ga0070671_101661076
646 Ga0070671_102087614
647 Ga0070674_100210423
648 Ga0070674_100418964
649 Ga0070674_100533281
650 Ga0070674_100766750
651 Ga0070673_101342496
652 Ga0070688_100634672
653 Ga0070659_100009587
654 Ga0070667_100003340
655 Ga0070703_10169844
656 Ga0070703_10242723
657 Ga0070709_10000133
658 Ga0070709_10715163
659 Ga0070714_100596034
660 Ga0070713_100070346
661 Ga0070710_10683427
662 Ga0070701_10055662
663 Ga0070701_10161272
664 Ga0070701_10164570
665 Ga0070701_10224075
666 Ga0070701_10311343
667 Ga0070705_100031666
668 Ga0070705_100201236
669 Ga0070705_100558577
670 Ga0070705_101188610
671 Ga0070700_100019961
672 Ga0070700_100101110
673 Ga0070700_100174131
674 Ga0070700_100384196
675 Ga0070694_100016680
676 Ga0070694_100039993
677 Ga0070694_100043362
678 Ga0070694_100083293
679 Ga0070694_100176264
680 Ga0070694_100884687
681 Ga0070708_100448686
682 Ga0070708_100483285
683 Ga0070708_101442094
684 Ga0070663_100040016
685 Ga0070663_100142507
686 Ga0070678_100139548
687 Ga0070678_100744308
688 Ga0070662_100014504
689 Ga0070662_100052687
690 Ga0070662_100148033
691 Ga0070662_100436437
692 Ga0070681_10245532
693 Ga0070681_10950169
694 Ga0070681_11109287
695 Ga0068867_100118634
696 Ga0068867_100127627
697 Ga0068867_100163296
698 Ga0068867_100355050
699 Ga0068867_101944986
700 Ga0070685_10165730
701 Ga0070685_10247503
702 Ga0070706_100030518
703 Ga0070706_100356499
704 Ga0070706_101194644
705 Ga0070707_100000506
706 Ga0070707_100005547
707 Ga0070707_100044136
708 Ga0070707_100094187
709 Ga0070707_101325557
710 Ga0070707_101595463
711 Ga0070698_100000010
712 Ga0070698_100002655
713 Ga0070698_100173657
714 Ga0070698_100701524
715 Ga0070699_100113468
716 Ga0070699_100367309
717 Ga0070699_100580844
718 Ga0070699_100809792
719 Ga0070699_101084837
720 Ga0070699_101371841
721 Ga0070679_100248170
722 Ga0070679_101291880
723 Ga0070684_100009079
724 Ga0070684_100258346
725 Ga0070697_100016648
726 Ga0070697_100032051
727 Ga0070697_100038665
728 Ga0070697_100077618
729 Ga0070697_100124123
730 Ga0070697_100508045
731 Ga0068853_100329922
732 Ga0070672_100913057
733 Ga0070686_100014523
734 Ga0070686_100489224
735 Ga0070686_101274219
736 Ga0070695_100027159
737 Ga0070695_100151453
738 Ga0070695_100193756
739 Ga0070695_100195558
740 Ga0070695_100964674
741 Ga0070696_100002714
742 Ga0070696_100050310
743 Ga0070696_100058391
744 Ga0070696_100511909
745 Ga0070696_100652354
746 Ga0070693_100221076
747 Ga0070693_100894489
748 Ga0070665_100004021
749 Ga0070704_100038084
750 Ga0070704_100045881
751 Ga0070704_100304887
752 Ga0070704_100320071
753 Ga0070704_100363164
754 Ga0070704_100477807
755 Ga0070704_101677485
756 Ga0070704_102123679
757 Ga0070704_102281174
758 Ga0068855_100013917
759 Ga0068855_100705672
760 Ga0068855_100933588
761 Ga0068857_100073143
762 Ga0068857_100150919
763 Ga0068857_100528725
764 Ga0068857_100857109
765 Ga0068854_100212221
766 Ga0068854_100820779
767 Ga0068856_100068336
768 Ga0070702_100151283
769 Ga0070702_100417622
770 Ga0070702_101329057
771 Ga0068852_100022697
772 Ga0068852_102071962
773 Ga0068859_100027837
774 Ga0068859_100047495
775 Ga0068859_100291717
776 Ga0068859_100405858
777 Ga0068859_101010547
778 Ga0068859_101081448
779 Ga0068859_101349685
780 Ga0068864_100016354
781 Ga0068864_100422894
782 Ga0068864_100756176
783 Ga0068864_101779469
784 Ga0068864_102485975
785 Ga0068866_10006751
786 Ga0068861_100233882
787 Ga0068861_100311293
788 Ga0068861_101584963
789 Ga0068851_10001511
790 Ga0068863_100347201
791 Ga0068858_100039634
792 Ga0068858_100312604
793 Ga0068858_100317868
794 Ga0068858_101224985
795 Ga0068860_100113024
796 Ga0068860_100616781
797 Ga0068860_100667749
798 Ga0068862_100030916
799 Ga0068862_100107367
800 Ga0068862_100269159
801 Ga0068862_100305539
802 Ga0068862_101340628
803 Ga0070715_10438002
804 Ga0070716_101123524
805 Ga0075428_100310231
806 Ga0075428_100435867
807 Ga0075428_101904826
808 Ga0075430_100008748
809 Ga0075431_100093005
810 Ga0075431_100329381
811 Ga0075431_100885401
812 Ga0075433_10095753
813 Ga0075433_10538088
814 Ga0075433_11619892
815 Ga0075434_100079753
816 Ga0075434_100211910
817 Ga0075434_101409251
818 Ga0075429_100090166
819 Ga0075429_100457512
820 Ga0068865_100018297
821 Ga0068865_100525935
822 Ga0075436_100313507
823 Ga0075436_100316833
824 Ga0097620_100027836
825 Ga0097620_100047497
826 Ga0097620_100291701
827 Ga0097620_100405843
828 Ga0097620_101010716
829 Ga0097620_101081206
830 Ga0097620_101350143
831 Ga0075435_100149793
832 Ga0075435_100225889
833 Ga0099794_10055599
834 Ga0099794_10114404
835 Ga0099794_10340195
836 Ga0105240_10025059
837 Ga0105240_10078772
838 Ga0105240_12075146
839 Ga0111539_12740918
840 Ga0105245_10342073
841 Ga0105245_12125459
842 Ga0105247_10270766
843 Ga0105247_11610049
844 Ga0105247_11819342
845 Ga0114129_10002325
846 Ga0114129_10012205
847 Ga0114129_10015871
848 Ga0114129_10081996
849 Ga0114129_10183993
850 Ga0114129_10190923
851 Ga0114129_10319193
852 Ga0114129_10410959
853 Ga0114129_10551823
854 Ga0114129_10692721
855 Ga0114129_10848615
856 Ga0114129_12925356
857 Ga0105243_10088365
858 Ga0105243_10120237
859 Ga0105243_10322348
860 Ga0105243_10332700
861 Ga0105243_13011375
862 Ga0105241_10123285
863 Ga0105241_10178848
864 Ga0105242_10003793
865 Ga0105242_10023511
866 Ga0105242_10054282
867 Ga0105242_10582760
868 Ga0105242_12620160
869 Ga0105248_10039456
870 Ga0105248_10159118
871 Ga0105248_10358648
872 Ga0105248_11039388
873 Ga0105237_10097758
874 Ga0105237_11491539
875 Ga0105237_11819148
876 Ga0105238_10031758
877 Ga0105238_10103224
878 Ga0105249_10008398
879 Ga0105249_10328429
880 Ga0105249_12515386
881 Ga0105239_10005652
882 Ga0105239_10064365
883 Ga0105239_10110459
884 Ga0105239_10504404
885 Ga0105239_11830808
886 Ga0105246_10176479
887 Ga0105246_10307393
888 Ga0157373_10147229
889 Ga0157373_10229364
890 Ga0157373_10405977
891 Ga0157371_10008099
892 Ga0157370_10019183
893 Ga0157370_11941751
894 Ga0157369_10014642
895 Ga0157374_10007554
896 Ga0157378_10052643
897 Ga0157378_10054351
898 Ga0157378_10071482
899 Ga0157378_10151775
900 Ga0157378_10153407
901 Ga0157378_10278307
902 Ga0157378_11362295
903 Ga0157378_12023573
904 Ga0163162_10030893
905 Ga0163162_10117634
906 Ga0163162_11106566
907 Ga0157372_10005485
908 Ga0157372_10226930
909 Ga0157375_10044451
910 Ga0157375_10051775
911 Ga0157375_10211537
912 Ga0157375_10263629
913 Ga0157375_10502725
914 Ga0163163_10125431
915 Ga0163163_10387743
916 Ga0163163_11582848
917 Ga0157380_10009337
918 Ga0157380_10026490
919 Ga0157380_10064983
920 Ga0157377_10500344
921 Ga0157379_10119862
922 Ga0157379_10416225
923 Ga0157376_10177589
924 Ga0163161_10876183
925 Ga0197907_11119277
926 Ga0206349_1375796
927 Ga0206350_10877881
928 Ga0207656_10302281
929 Ga0207653_10026773
930 Ga0207653_10317791
931 Ga0207682_10266925
932 Ga0207642_10081381
933 Ga0207642_10196076
934 Ga0207710_10029199
935 Ga0207647_10404984
936 Ga0207699_10000137
937 Ga0207645_10006746
938 Ga0207643_10010235
939 Ga0207684_10047808
940 Ga0207684_10073175
941 Ga0207684_10075363
942 Ga0207684_10272435
943 Ga0207684_11559554
944 Ga0207654_10002654
945 Ga0207695_10017287
946 Ga0207695_10021258
947 Ga0207695_11643272
948 Ga0207671_10154906
949 Ga0207663_11227970
950 Ga0207660_10105915
951 Ga0207660_10590814
952 Ga0207662_10061235
953 Ga0207662_10174083
954 Ga0207662_10175776
955 Ga0207662_10593914
956 Ga0207662_10883692
957 Ga0207662_11082854
958 Ga0207657_10013728
959 Ga0207652_10154302
960 Ga0207652_10823670
961 Ga0207652_11145594
962 Ga0207646_10001642
963 Ga0207646_10067222
964 Ga0207646_10069906
965 Ga0207646_10154589
966 Ga0207646_10470482
967 Ga0207646_10535058
968 Ga0207646_10891786
969 Ga0207681_10346020
970 Ga0207694_10366631
971 Ga0207659_10299311
972 Ga0207659_10635387
973 Ga0207659_10749309
974 Ga0207659_11320723
975 Ga0207687_10002949
976 Ga0207687_11370413
977 Ga0207664_10393712
978 Ga0207644_10765031
979 Ga0207644_10840612
980 Ga0207690_10654105
981 Ga0207706_10000520
982 Ga0207706_10047223
983 Ga0207706_10051142
984 Ga0207706_10155212
985 Ga0207686_10002102
986 Ga0207686_10007098
987 Ga0207686_10079755
988 Ga0207709_10069919
989 Ga0207709_10566878
990 Ga0207709_10647461
991 Ga0207670_10095898
992 Ga0207670_10122487
993 Ga0207670_10132104
994 Ga0207670_10256763
995 Ga0207670_10665877
996 Ga0207670_11904159
997 Ga0207669_10203956
998 Ga0207669_10376828
999 Ga0207665_10057954
1000 Ga0207665_10566159
1001 Ga0207711_10003413
1002 Ga0207711_10371988
1003 Ga0207711_10819869
1004 Ga0207711_10861007
1005 Ga0207689_10020764
1006 Ga0207689_10107885
1007 Ga0207689_10532398
1008 Ga0207689_10638845
1009 Ga0207661_10174903
1010 Ga0207679_10278587
1011 Ga0207667_10012506
1012 Ga0207667_10090465
1013 Ga0207667_10474543
1014 Ga0207651_10175003
1015 Ga0207651_10670078
1016 Ga0207712_10018756
1017 Ga0207640_10002162
1018 Ga0207640_10466911
1019 Ga0207658_10265567
1020 Ga0207677_10167210
1021 Ga0207703_10387604
1022 Ga0207703_11027143
1023 Ga0207639_10221228
1024 Ga0207678_10001213
1025 Ga0207708_10142506
1026 Ga0207708_10186484
1027 Ga0207708_10439858
1028 Ga0207708_10474528
1029 Ga0207708_11908856
1030 Ga0207702_10007182
1031 Ga0207641_10029385
1032 Ga0207641_10376664
1033 Ga0207648_10079226
1034 Ga0207648_10107530
1035 Ga0207648_10564589
1036 Ga0207648_10950980
1037 Ga0207648_11065162
1038 Ga0207676_10090863
1039 Ga0207676_10150353
1040 Ga0207676_10531914
1041 Ga0207676_10907080
1042 Ga0207676_11051064
1043 Ga0207674_10053136
1044 Ga0207674_10155354
1045 Ga0207674_11412717
1046 Ga0207675_100192380
1047 Ga0207675_100410129
1048 Ga0207675_100560060
1049 Ga0207675_100672731
1050 Ga0207675_100716642
1051 Ga0207683_10080881
1052 Ga0207698_10033272
1053 Ga0207698_11264843
1054 Ga0268266_10022900
1055 Ga0268266_11545326
1056 Ga0268265_10046538
1057 Ga0268265_10172331
1058 Ga0268265_10201999
1059 Ga0268264_10149459
1060 Ga0268264_10573803
1061 Ga0268264_10612402
1062 Ga0268264_10644980
1063 Ga0307409_100162150
1064 Ga0307411_11010625
1065 Ga0373930_0008347
1066 Ga0373938_0091296
1067 Ga0373940_0025458
1068 Ga0373951_0001564
1069 Ga0373941_0056456
1070 Ga0373931_0078306
1071 Ga0395900_1904831
1072 Ga0395898_0442984
1073 Ga0395898_1122400
1074 Ga0395901_0065169
1075 Ga0439453_0117936
1076 Ga0439432_194468
1077 Ga0439455_0009598
1078 Ga0450914_032962
1079 Ga0439458_0007435
1080 Ga0439464_0038385
1081 Ga0450893_0108392
1082 Ga0451577_1529877
1083 Ga0453683_0192636
1084 Ga0453683_1022853
1085 Ga0451576_0325817
1086 Ga0495580_0032694
1087 Ga0495639_0139193
1088 Ga0495662_0298927
1089 Ga0495663_0000784
1090 Ga0495665_0360211
1091 Ga0495640_0498999
1092 Ga0495586_0366545
1093 Ga0495598_0000047
1094 Ga0495621_0006637
1095 Ga0495621_0288584
1096 Ga0495668_0221869
1097 Ga0495634_0098635
1098 Ga0495647_0590970
1099 Ga0495658_0379230
1100 Ga0495600_0622204
1101 Ga0495614_0295579
1102 Ga0496101_0056243
1103 Ga0496102_0025002
1104 Ga0496102_0045895
1105 Ga0496103_0010356
1106 Ga0496104_0089504
1107 Ga0496105_0099811
1108 Ga0496106_0107123
1109 Ga0496106_0816042
1110 Ga0496107_0099800
1111 Ga0496108_0078893
1112 Ga0496109_0020508
1113 Ga0496109_0091661
1114 Ga0496110_0033945
1115 Ga0496110_0050482
1116 Ga0496111_0096483
1117 Ga0496111_0462289
1118 Ga0496112_0143762
1119 Ga0496112_0341599
1120 Ga0496113_0188108
1121 Ga0496113_0481031
1122 Ga0496115_0217740
1123 Ga0496115_0456102
1124 Ga0496115_0760693
1125 Ga0501031_0261613
1126 Ga0501034_1535951
1127 Ga0501036_0030043
1128 Ga0501038_0022090
1129 Ga0501039_0044377
1130 Ga0501040_0001593
1131 Ga0501041_0003041
1132 Ga0501041_0408241
1133 Ga0501042_0012537
1134 Ga0501043_0037467
1135 Ga0501046_0005343
1136 Ga0501046_0051976
1137 Ga0501048_0028583
1138 Ga0501071_0007897
1139 Ga0501072_0003022
1140 Ga0501072_0003614
1141 Ga0501073_0437068
1142 Ga0501074_0040599
1143 Ga0501075_0013585
1144 Ga0501075_0016028
1145 Ga0501076_0014603
1146 Ga0501077_0000195
1147 Ga0501079_0000550
1148 Ga0501080_0039009
1149 Ga0501081_0000417
1150 Ga0501081_0019917
1151 Ga0501083_0033959
1152 Ga0501035_0100870
1153 Ga0501045_0004294
1154 nmdc:mga05p37_110_c1
1155 nmdc:mga05p37_12809_c1
1156 nmdc:mga05p37_35219_c1
1157 nmdc:mga05p37_5497_c1
1158 nmdc:mga05p37_568875_c1
1159 nmdc:mga05p37_580843_c1
1160 nmdc:mga05p37_581537_c1
1161 nmdc:mga05p37_59555_c2
1162 nmdc:mga05p37_66047_c1
1163 nmdc:mga05p37_67729_c1
1164 nmdc:mga05p37_751411_c1
1165 nmdc:mga09592_814754_c1
1166 nmdc:mga09592_817433_c1
1167 nmdc:mga0qj67_104781_c1
1168 nmdc:mga06r32_1192834_c1
1169 nmdc:mga06r32_237083_c1
1170 nmdc:mga0n895_130940_c1
1171 nmdc:mga0n895_1380014_c1
1172 nmdc:mga0n895_517998_c1
1173 nmdc:mga0n895_7683_c1
1174 nmdc:mga0rr50_182042_c1
1175 nmdc:mga0rr50_515635_c1
1176 nmdc:mga08x19_288374_c1
1177 nmdc:mga0a205_158305_c1
1178 nmdc:mga0a205_253218_c1
1179 nmdc:mga0a205_384329_c1
1180 nmdc:mga0a205_51829_c1
1181 Ga0501084_0001686
1182 Ga0501084_0018114
1183 Ga0587079_044646
1184 Ga0501082_0006761
1185 Ga0501082_0195728
1186 Ga0530510_0008140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

25

137

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8121 1 115
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7935 1 115
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.7492 1 115
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7247 1 115
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7232 1 115
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8121 1 115 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7935 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7551 1 116 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7384 1 112 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7345 1 116 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A2V6YKS4-F1-model_v4 YCII-related domain-containing protein 0.8739 1 117
AF-A0A517W0K8-F1-model_v4 YCII-related domain protein 0.8736 1 117
AF-A0A7G9NYV7-F1-model_v4 YciI family protein 0.8711 1 117
AF-A0A2V8NFZ1-F1-model_v4 YCII-related domain-containing protein 0.8702 1 117
AF-A0A6N8G591-F1-model_v4 YCII-related domain-containing protein 0.87 1 111

Map