F467073

General Info

Members Datasets Scaffolds Average Seq Length
591 281 591 215

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0140527|Ga0495603_0140527_150_902
Length 250
Sequence VQWTVAAGSRQIEDRAQRELARGVVSETTINSRKLMRTLSLADAVALIPDGASLMIGGFMAVGTPESVVDELVRQGKRDLTVIANDTAMPGVGIGKLVRARLVKKAIVSHIGTNPETQAQMIGGEMEVDLVPQGTLVERIRAGGFGLGGILTATGVGTVVEEGKQKVTVAGKDYLVEPALRADFALVHAFMADYLGNLAYALTGRNFNPVIAMAADTVIVTVDNIVPVGLISPDHVVTPAPLVDYLIAQS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.23
Rhizosphere 95.26
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10013140 3300005293 Bacteria 2245
2 Ga0065715_10134779 3300005293 Bacteria 1943
3 Ga0070676_10000101 3300005328 Bacteria 30545
4 Ga0070676_10069411 3300005328 Bacteria 2112
5 Ga0070676_10262405 3300005328 Bacteria 1157
6 Ga0070690_100008126 3300005330 Bacteria 6029
7 Ga0070690_100300570 3300005330 Bacteria 1151
8 Ga0070670_100044711 3300005331 Bacteria 3807
9 Ga0070670_100198719 3300005331 Bacteria 1742
10 Ga0070670_100247343 3300005331 Bacteria 1553
11 Ga0070670_100256607 3300005331 Bacteria 1523
12 Ga0070670_100354683 3300005331 Bacteria 1289
13 Ga0070670_100722074 3300005331 Bacteria 897
14 Ga0070677_10023693 3300005333 Bacteria 2275
15 Ga0070677_10169596 3300005333 Bacteria 1030
16 Ga0070677_10224284 3300005333 Bacteria 920
17 Ga0068869_100004676 3300005334 Bacteria 8544
18 Ga0068869_100296818 3300005334 Bacteria 1304
19 Ga0070666_10006335 3300005335 Bacteria 7280
20 Ga0070666_10103994 3300005335 Bacteria 1960
21 Ga0070666_10354842 3300005335 Bacteria 1050
22 Ga0070682_100071815 3300005337 Bacteria 2216
23 Ga0068868_100194263 3300005338 Bacteria 1689
24 Ga0068868_100337060 3300005338 Bacteria 1289
25 Ga0070660_100322818 3300005339 Bacteria 1268
26 Ga0070661_100020975 3300005344 Bacteria 4664
27 Ga0070661_100085741 3300005344 Bacteria 2328
28 Ga0070661_100285316 3300005344 Bacteria 1282
29 Ga0070668_100003342 3300005347 Bacteria 11827
30 Ga0070668_100056117 3300005347 Bacteria 3041
31 Ga0070668_100117206 3300005347 Bacteria 2124
32 Ga0070668_100759510 3300005347 Bacteria 859
33 Ga0070669_100000736 3300005353 Bacteria 23856
34 Ga0070669_100031072 3300005353 Bacteria 3856
35 Ga0070669_100210501 3300005353 Bacteria 1534
36 Ga0070669_100857577 3300005353 Bacteria 774
37 Ga0070675_100046723 3300005354 Bacteria 3546
38 Ga0070675_100125332 3300005354 Bacteria 2184
39 Ga0070675_100599912 3300005354 Bacteria 998
40 Ga0070671_100008194 3300005355 Bacteria 8362
41 Ga0070671_100010572 3300005355 Bacteria 7411
42 Ga0070671_100031962 3300005355 Bacteria 4351
43 Ga0070671_100110104 3300005355 Bacteria 2313
44 Ga0070671_100127658 3300005355 Bacteria 2141
45 Ga0070674_100001055 3300005356 Bacteria 14403
46 Ga0070674_100057821 3300005356 Bacteria 2693
47 Ga0070673_100059057 3300005364 Bacteria 3035
48 Ga0070659_100002514 3300005366 Bacteria 13020
49 Ga0070667_100000911 3300005367 Bacteria 27330
50 Ga0070709_10008851 3300005434 Bacteria 5541
51 Ga0070713_100054486 3300005436 Bacteria 3318
52 Ga0070713_100663126 3300005436 Unclassified 994
53 Ga0070711_100853846 3300005439 Bacteria 775
54 Ga0070700_100717075 3300005441 Bacteria 797
55 Ga0070663_100009320 3300005455 Bacteria 6076
56 Ga0070678_100023877 3300005456 Bacteria 4084
57 Ga0070678_100050825 3300005456 Bacteria 3001
58 Ga0070678_100064684 3300005456 Bacteria 2712
59 Ga0070678_100124271 3300005456 Bacteria 2040
60 Ga0070678_101041507 3300005456 Bacteria 754
61 Ga0070662_100000248 3300005457 Bacteria 31890
62 Ga0070662_100009651 3300005457 Bacteria 6313
63 Ga0070662_100032471 3300005457 Bacteria 3669
64 Ga0070662_100186094 3300005457 Bacteria 1640
65 Ga0070662_100279826 3300005457 Bacteria 1350
66 Ga0070681_10008343 3300005458 Bacteria 10148
67 Ga0068867_100002478 3300005459 Bacteria 12972
68 Ga0068867_100006095 3300005459 Bacteria 8537
69 Ga0068867_100018802 3300005459 Bacteria 4915
70 Ga0068867_100161639 3300005459 Bacteria 1766
71 Ga0070685_10681668 3300005466 Bacteria 748
72 Ga0070679_100486878 3300005530 Bacteria 1178
73 Ga0068853_100130371 3300005539 Bacteria 2250
74 Ga0068853_100142181 3300005539 Bacteria 2155
75 Ga0068853_100504936 3300005539 Bacteria 1142
76 Ga0070672_100000298 3300005543 Bacteria 28086
77 Ga0070672_100006518 3300005543 Bacteria 7847
78 Ga0070672_100205852 3300005543 Bacteria 1647
79 Ga0070672_100240126 3300005543 Bacteria 1524
80 Ga0070672_100253803 3300005543 Bacteria 1482
81 Ga0070686_100068904 3300005544 Bacteria 2309
82 Ga0070686_100671238 3300005544 Bacteria 824
83 Ga0070696_100780467 3300005546 Bacteria 785
84 Ga0070693_100187682 3300005547 Bacteria 1335
85 Ga0070693_100629414 3300005547 Bacteria 778
86 Ga0068855_100001259 3300005563 Bacteria 31467
87 Ga0068855_100027568 3300005563 Bacteria 6794
88 Ga0068855_100098280 3300005563 Bacteria 3372
89 Ga0068855_100284887 3300005563 Bacteria 1833
90 Ga0070664_100008908 3300005564 Bacteria 8133
91 Ga0070664_100168234 3300005564 Bacteria 1943
92 Ga0070664_100314562 3300005564 Bacteria 1417
93 Ga0068854_100036313 3300005578 Bacteria 3454
94 Ga0068854_100192026 3300005578 Bacteria 1601
95 Ga0068854_100544948 3300005578 Bacteria 983
96 Ga0068856_100000181 3300005614 Bacteria 65631
97 Ga0068856_100004921 3300005614 Bacteria 13221
98 Ga0068852_100003271 3300005616 Bacteria 11311
99 Ga0068852_100152745 3300005616 Bacteria 2149
100 Ga0068852_100812551 3300005616 Bacteria 949
101 Ga0068859_100264425 3300005617 Bacteria 1812
102 Ga0068859_100878201 3300005617 Bacteria 982
103 Ga0068864_100041050 3300005618 Bacteria 3958
104 Ga0068864_100045250 3300005618 Bacteria 3775
105 Ga0068864_100525156 3300005618 Bacteria 1142
106 Ga0068866_10002517 3300005718 Bacteria 7548
107 Ga0068866_10218516 3300005718 Bacteria 1148
108 Ga0068861_100003452 3300005719 Bacteria 10493
109 Ga0068861_100281770 3300005719 Bacteria 1432
110 Ga0068851_10018572 3300005834 Bacteria 3350
111 Ga0068851_10082638 3300005834 Bacteria 1680
112 Ga0068870_10208625 3300005840 Bacteria 1189
113 Ga0068863_100000830 3300005841 Bacteria 31001
114 Ga0068863_100022362 3300005841 Bacteria 6038
115 Ga0068863_100226153 3300005841 Bacteria 1804
116 Ga0068863_100256032 3300005841 Bacteria 1692
117 Ga0068863_100724234 3300005841 Bacteria 990
118 Ga0068863_100872110 3300005841 Bacteria 900
119 Ga0068858_100001155 3300005842 Bacteria 27330
120 Ga0068858_100086524 3300005842 Bacteria 2915
121 Ga0068858_100302774 3300005842 Bacteria 1525
122 Ga0068860_100000796 3300005843 Bacteria 35406
123 Ga0068860_100189421 3300005843 Bacteria 1990
124 Ga0068862_100037681 3300005844 Bacteria 4099
125 Ga0081455_10061678 3300005937 Bacteria 3154
126 Ga0081455_10468054 3300005937 Bacteria 856
127 Ga0081540_1036258 3300005983 Bacteria 2632
128 Ga0070717_10482741 3300006028 Bacteria 1119
129 Ga0070712_100076186 3300006175 Bacteria 2415
130 Ga0070712_100333352 3300006175 Bacteria 1237
131 Ga0097621_100178113 3300006237 Bacteria 1836
132 Ga0097621_100263886 3300006237 Bacteria 1511
133 Ga0097621_100525600 3300006237 Bacteria 1074
134 Ga0068871_100014907 3300006358 Bacteria 5809
135 Ga0068871_100158590 3300006358 Bacteria 1934
136 Ga0075428_100006609 3300006844 Bacteria 12899
137 Ga0075428_100082937 3300006844 Bacteria 3498
138 Ga0075431_100006106 3300006847 Bacteria 11947
139 Ga0075431_100108401 3300006847 Bacteria 2866
140 Ga0075434_100289431 3300006871 Bacteria 1658
141 Ga0075429_100012805 3300006880 Bacteria 7276
142 Ga0068865_100001586 3300006881 Bacteria 13298
143 Ga0068865_100007519 3300006881 Bacteria 6703
144 Ga0068865_100126883 3300006881 Bacteria 1906
145 Ga0068865_100244733 3300006881 Bacteria 1413
146 Ga0068865_100423017 3300006881 Bacteria 1096
147 Ga0068865_100579843 3300006881 Bacteria 945
148 Ga0075436_100315165 3300006914 Bacteria 1123
149 Ga0097620_100264407 3300006931 Bacteria 1812
150 Ga0097620_100878241 3300006931 Bacteria 982
151 Ga0111539_10549676 3300009094 Bacteria 1345
152 Ga0111539_10676348 3300009094 Bacteria 1202
153 Ga0114129_10000005 3300009147 Bacteria 159906
154 Ga0114129_10016886 3300009147 Bacteria 10393
155 Ga0114129_10474476 3300009147 Bacteria 1638
156 Ga0105243_10014891 3300009148 Bacteria 5887
157 Ga0105241_10120373 3300009174 Bacteria 2113
158 Ga0105242_10018254 3300009176 Bacteria 5482
159 Ga0105242_10024340 3300009176 Bacteria 4781
160 Ga0105242_10573080 3300009176 Bacteria 1086
161 Ga0105248_10007457 3300009177 Bacteria 12001
162 Ga0105248_10035717 3300009177 Bacteria 5559
163 Ga0105248_10040894 3300009177 Bacteria 5197
164 Ga0105248_10093743 3300009177 Bacteria 3382
165 Ga0105248_10501479 3300009177 Bacteria 1368
166 Ga0105248_10775716 3300009177 Bacteria 1082
167 Ga0105238_10156942 3300009551 Bacteria 2251
168 Ga0105249_10031876 3300009553 Bacteria 4769
169 Ga0105249_10232531 3300009553 Bacteria 1818
170 Ga0105239_10211046 3300010375 Bacteria 2176
171 Ga0105246_10464190 3300011119 Bacteria 1067
172 Ga0105246_10466640 3300011119 Bacteria 1065
173 Ga0157371_10000221 3300013102 Bacteria 83267
174 Ga0157370_10048936 3300013104 Bacteria 4048
175 Ga0157370_10155262 3300013104 Bacteria 2129
176 Ga0157370_10244033 3300013104 Bacteria 1662
177 Ga0157369_10021715 3300013105 Bacteria 7179
178 Ga0157369_10169159 3300013105 Bacteria 2304
179 Ga0157369_10567331 3300013105 Bacteria 1172
180 Ga0157374_10145614 3300013296 Bacteria 2301
181 Ga0157374_10290105 3300013296 Bacteria 1617
182 Ga0163162_10004930 3300013306 Bacteria 12865
183 Ga0163162_10016912 3300013306 Bacteria 7132
184 Ga0163162_10102989 3300013306 Bacteria 2948
185 Ga0163162_10112431 3300013306 Bacteria 2822
186 Ga0163162_10198646 3300013306 Bacteria 2134
187 Ga0163162_10386687 3300013306 Bacteria 1532
188 Ga0157372_10000546 3300013307 Bacteria 41467
189 Ga0157372_10045693 3300013307 Bacteria 4859
190 Ga0157375_10001027 3300013308 Bacteria 24079
191 Ga0157375_10009764 3300013308 Bacteria 8435
192 Ga0157375_10014497 3300013308 Bacteria 7033
193 Ga0157375_10037005 3300013308 Bacteria 4672
194 Ga0157375_10119027 3300013308 Bacteria 2748
195 Ga0157375_10275507 3300013308 Bacteria 1845
196 Ga0163163_10237752 3300014325 Bacteria 1871
197 Ga0163163_10675326 3300014325 Bacteria 1096
198 Ga0157380_10000360 3300014326 Bacteria 27339
199 Ga0157380_10393696 3300014326 Bacteria 1312
200 Ga0157377_10192749 3300014745 Bacteria 1289
201 Ga0157379_10020533 3300014968 Bacteria 5842
202 Ga0157379_10160371 3300014968 Bacteria 2030
203 Ga0157379_10347311 3300014968 Bacteria 1358
204 Ga0157379_10375481 3300014968 Bacteria 1304
205 Ga0157376_10382129 3300014969 Bacteria 1357
206 Ga0157376_10522774 3300014969 Bacteria 1170
207 Ga0157376_10579637 3300014969 Bacteria 1114
208 Ga0163161_10001228 3300017792 Bacteria 19212
209 Ga0163161_10107246 3300017792 Bacteria 2085
210 Ga0163161_10173461 3300017792 Bacteria 1650
211 Ga0163161_10193158 3300017792 Bacteria 1566
212 Ga0163161_10373089 3300017792 Bacteria 1139
213 Ga0209050_1004532 3300025298 Bacteria 9342
214 Ga0207697_10005006 3300025315 Bacteria 6233
215 Ga0207697_10006847 3300025315 Bacteria 5119
216 Ga0207656_10013551 3300025321 Bacteria 3120
217 Ga0207682_10004587 3300025893 Bacteria 5755
218 Ga0207682_10011771 3300025893 Bacteria 3417
219 Ga0207682_10245730 3300025893 Bacteria 832
220 Ga0207642_10013803 3300025899 Bacteria 2960
221 Ga0207688_10075148 3300025901 Bacteria 1923
222 Ga0207680_10041824 3300025903 Bacteria 2677
223 Ga0207680_10053775 3300025903 Bacteria 2419
224 Ga0207647_10072400 3300025904 Bacteria 2078
225 Ga0207645_10004531 3300025907 Bacteria 10263
226 Ga0207645_10025878 3300025907 Bacteria 3795
227 Ga0207705_10129201 3300025909 Bacteria 1879
228 Ga0207705_10399820 3300025909 Bacteria 1062
229 Ga0207654_10017416 3300025911 Bacteria 3755
230 Ga0207654_10135919 3300025911 Bacteria 1562
231 Ga0207707_10077924 3300025912 Bacteria 2893
232 Ga0207707_10140700 3300025912 Bacteria 2110
233 Ga0207693_10010583 3300025915 Bacteria 7485
234 Ga0207693_10122785 3300025915 Bacteria 2040
235 Ga0207663_10067944 3300025916 Bacteria 2287
236 Ga0207660_10069384 3300025917 Bacteria 2559
237 Ga0207662_10009408 3300025918 Bacteria 5376
238 Ga0207657_10000596 3300025919 Bacteria 38318
239 Ga0207657_10099266 3300025919 Bacteria 2418
240 Ga0207649_10003941 3300025920 Bacteria 8098
241 Ga0207649_10115964 3300025920 Bacteria 1797
242 Ga0207649_10235457 3300025920 Bacteria 1312
243 Ga0207649_10552266 3300025920 Bacteria 881
244 Ga0207652_10243405 3300025921 Bacteria 1622
245 Ga0207681_10000592 3300025923 Bacteria 24653
246 Ga0207681_10013076 3300025923 Bacteria 5132
247 Ga0207681_10065318 3300025923 Bacteria 2515
248 Ga0207650_10010191 3300025925 Bacteria 6441
249 Ga0207650_10084049 3300025925 Bacteria 2419
250 Ga0207650_10087822 3300025925 Bacteria 2370
251 Ga0207650_10212746 3300025925 Bacteria 1553
252 Ga0207650_10256500 3300025925 Bacteria 1417
253 Ga0207650_10662078 3300025925 Bacteria 881
254 Ga0207650_10698994 3300025925 Bacteria 856
255 Ga0207659_10006611 3300025926 Bacteria 7119
256 Ga0207659_10021777 3300025926 Bacteria 4261
257 Ga0207659_10022473 3300025926 Bacteria 4200
258 Ga0207659_10195610 3300025926 Bacteria 1611
259 Ga0207659_10492924 3300025926 Bacteria 1036
260 Ga0207700_10083392 3300025928 Bacteria 2502
261 Ga0207700_10370345 3300025928 Bacteria 1251
262 Ga0207644_10005044 3300025931 Bacteria 8616
263 Ga0207644_10014930 3300025931 Bacteria 5207
264 Ga0207644_10046510 3300025931 Bacteria 3092
265 Ga0207644_10070496 3300025931 Bacteria 2555
266 Ga0207690_10000419 3300025932 Bacteria 27647
267 Ga0207690_10143180 3300025932 Bacteria 1764
268 Ga0207690_10644519 3300025932 Bacteria 868
269 Ga0207706_10000074 3300025933 Bacteria 103144
270 Ga0207706_10002518 3300025933 Bacteria 17874
271 Ga0207706_10019690 3300025933 Bacteria 6071
272 Ga0207706_10227285 3300025933 Bacteria 1633
273 Ga0207686_10020451 3300025934 Bacteria 3782
274 Ga0207686_10035011 3300025934 Bacteria 3010
275 Ga0207686_10214443 3300025934 Bacteria 1386
276 Ga0207686_10228944 3300025934 Bacteria 1346
277 Ga0207709_10003323 3300025935 Bacteria 9633
278 Ga0207669_10000756 3300025937 Bacteria 13966
279 Ga0207669_10107277 3300025937 Bacteria 1862
280 Ga0207669_10109329 3300025937 Bacteria 1848
281 Ga0207669_10177038 3300025937 Bacteria 1525
282 Ga0207704_10000750 3300025938 Bacteria 14293
283 Ga0207704_10048038 3300025938 Bacteria 2556
284 Ga0207704_10083377 3300025938 Bacteria 2074
285 Ga0207704_10134599 3300025938 Bacteria 1718
286 Ga0207704_10390468 3300025938 Bacteria 1095
287 Ga0207691_10001866 3300025940 Bacteria 20593
288 Ga0207691_10014808 3300025940 Bacteria 7431
289 Ga0207691_10103201 3300025940 Bacteria 2543
290 Ga0207691_10178725 3300025940 Bacteria 1855
291 Ga0207711_10011986 3300025941 Bacteria 7205
292 Ga0207711_10014428 3300025941 Bacteria 6563
293 Ga0207711_10031161 3300025941 Bacteria 4500
294 Ga0207711_10041445 3300025941 Bacteria 3921
295 Ga0207711_10222835 3300025941 Bacteria 1725
296 Ga0207689_10006195 3300025942 Bacteria 10596
297 Ga0207661_10118582 3300025944 Bacteria 2250
298 Ga0207679_10007022 3300025945 Bacteria 7136
299 Ga0207679_10126902 3300025945 Bacteria 2040
300 Ga0207679_10183171 3300025945 Bacteria 1734
301 Ga0207679_10240019 3300025945 Bacteria 1535
302 Ga0207667_10030975 3300025949 Bacteria 5780
303 Ga0207667_10307522 3300025949 Bacteria 1619
304 Ga0207667_10899361 3300025949 Bacteria 877
305 Ga0207651_10084601 3300025960 Bacteria 2298
306 Ga0207651_10399649 3300025960 Bacteria 1169
307 Ga0207712_10012206 3300025961 Bacteria 5488
308 Ga0207668_10014767 3300025972 Bacteria 4840
309 Ga0207668_10033851 3300025972 Bacteria 3388
310 Ga0207640_10089134 3300025981 Bacteria 2131
311 Ga0207640_10402079 3300025981 Bacteria 1116
312 Ga0207640_10631853 3300025981 Bacteria 910
313 Ga0207640_10939463 3300025981 Bacteria 757
314 Ga0207658_10000510 3300025986 Bacteria 35545
315 Ga0207658_10067112 3300025986 Bacteria 2701
316 Ga0207658_10086504 3300025986 Bacteria 2418
317 Ga0207658_10255718 3300025986 Bacteria 1490
318 Ga0207658_10376149 3300025986 Bacteria 1243
319 Ga0207677_10445572 3300026023 Bacteria 1108
320 Ga0207677_11011019 3300026023 Bacteria 754
321 Ga0207703_10001422 3300026035 Bacteria 21834
322 Ga0207703_10293490 3300026035 Bacteria 1480
323 Ga0207639_10032306 3300026041 Bacteria 3852
324 Ga0207639_10283807 3300026041 Bacteria 1457
325 Ga0207639_10540742 3300026041 Bacteria 1069
326 Ga0207639_10553527 3300026041 Bacteria 1056
327 Ga0207678_10007835 3300026067 Bacteria 9427
328 Ga0207708_10484405 3300026075 Bacteria 1035
329 Ga0207702_10001390 3300026078 Bacteria 24132
330 Ga0207702_10153702 3300026078 Bacteria 2095
331 Ga0207641_10001218 3300026088 Bacteria 25753
332 Ga0207641_10056997 3300026088 Bacteria 3322
333 Ga0207641_10162067 3300026088 Bacteria 2034
334 Ga0207641_10210230 3300026088 Bacteria 1799
335 Ga0207648_10001492 3300026089 Bacteria 25769
336 Ga0207648_10012368 3300026089 Bacteria 7990
337 Ga0207648_10018499 3300026089 Bacteria 6306
338 Ga0207648_10104243 3300026089 Bacteria 2487
339 Ga0207676_10036241 3300026095 Bacteria 3751
340 Ga0207676_10040883 3300026095 Bacteria 3556
341 Ga0207676_10151988 3300026095 Bacteria 1995
342 Ga0207676_10418284 3300026095 Bacteria 1256
343 Ga0207675_100001773 3300026118 Bacteria 21566
344 Ga0207675_100275507 3300026118 Bacteria 1634
345 Ga0207683_10005185 3300026121 Bacteria 11189
346 Ga0207683_10085823 3300026121 Bacteria 2798
347 Ga0207683_10150989 3300026121 Bacteria 2096
348 Ga0207683_10227010 3300026121 Bacteria 1702
349 Ga0207683_11180612 3300026121 Bacteria 709
350 Ga0207698_10012687 3300026142 Bacteria 5526
351 Ga0207698_10060728 3300026142 Bacteria 2941
352 Ga0207698_10196320 3300026142 Bacteria 1803
353 Ga0207698_10406415 3300026142 Bacteria 1303
354 Ga0207428_10613387 3300027907 Bacteria 783
355 Ga0268265_10005696 3300028380 Bacteria 8507
356 Ga0268264_10028083 3300028381 Bacteria 4602
357 Ga0268264_10192730 3300028381 Bacteria 1859
358 Ga0268264_10988880 3300028381 Bacteria 847
359 Ga0307416_100220057 3300032002 Bacteria 1820
360 Ga0307414_10585342 3300032004 Bacteria 999
361 Ga0307415_100133291 3300032126 Bacteria 1885
362 Ga0373926_0034130 3300035083 Bacteria 1800
363 Ga0373926_0181272 3300035083 Bacteria 808
364 Ga0373945_0177915 3300035116 Bacteria 874
365 Ga0373943_0026826 3300035170 Bacteria 2702
366 Ga0373924_0020099 3300035410 Bacteria 2592
367 Ga0373931_0069174 3300035691 Bacteria 1923
368 Ga0373935_0112178 3300035692 Bacteria 1811
369 Ga0373933_0161205 3300035724 Bacteria 1424
370 Ga0373947_0088546 3300035725 Bacteria 1927
371 Ga0373925_0026288 3300037068 Bacteria 4259
372 Ga0373925_0336654 3300037068 Bacteria 1223
373 Ga0395899_0003912 3300037312 Bacteria 11741
374 Ga0395899_0011242 3300037312 Bacteria 6857
375 Ga0395900_0001162 3300037418 Bacteria 32955
376 Ga0395900_0020459 3300037418 Bacteria 6755
377 Ga0395898_0003358 3300037466 Bacteria 17956
378 Ga0395905_0004279 3300037471 Bacteria 14891
379 Ga0395905_0238031 3300037471 Bacteria 1701
380 Ga0395901_0011447 3300038443 Bacteria 8989
381 Ga0395901_0175269 3300038443 Bacteria 2249
382 Ga0439449_0027200 3300042007 Bacteria 2134
383 Ga0451577_0000058 3300042876 Bacteria 272673
384 Ga0453684_0000279 3300044712 Bacteria 220016
385 Ga0466971_0093729 3300044719 Bacteria 1376
386 Ga0466957_0035583 3300044842 Bacteria 2988
387 Ga0451576_0001134 3300045051 Bacteria 48176
388 Ga0466967_0005963 3300045976 Bacteria 8551
389 Ga0495617_000030 3300046452 Bacteria 152392
390 Ga0495627_000228 3300046453 Bacteria 59535
391 Ga0495627_022678 3300046453 Bacteria 2063
392 Ga0495603_0140527 3300046455 Bacteria 1405
393 Ga0495629_0011521 3300046459 Bacteria 6423
394 Ga0495653_0007080 3300046463 Bacteria 9199
395 Ga0495580_0156956 3300046472 Bacteria 1575
396 Ga0495582_0113473 3300046473 Bacteria 1523
397 Ga0495605_0000046 3300046474 Bacteria 175985
398 Ga0495605_0012885 3300046474 Bacteria 4627
399 Ga0495605_0017171 3300046474 Bacteria 3903
400 Ga0495605_0035670 3300046474 Bacteria 2512
401 Ga0495584_0001630 3300046491 Bacteria 13194
402 Ga0495584_0064863 3300046491 Bacteria 1836
403 Ga0495584_0172202 3300046491 Bacteria 1100
404 Ga0495585_0000410 3300046492 Bacteria 41579
405 Ga0495585_0003320 3300046492 Bacteria 10923
406 Ga0495594_0033471 3300046499 Bacteria 2794
407 Ga0495594_0289775 3300046499 Bacteria 933
408 Ga0495596_0000846 3300046500 Bacteria 18508
409 Ga0495596_0005147 3300046500 Bacteria 6226
410 Ga0495596_0005570 3300046500 Bacteria 5916
411 Ga0495596_0019781 3300046500 Bacteria 2762
412 Ga0495607_0001168 3300046501 Bacteria 23749
413 Ga0495607_0052992 3300046501 Bacteria 2347
414 Ga0495583_0000142 3300046506 Bacteria 121513
415 Ga0495583_0007855 3300046506 Bacteria 6626
416 Ga0495583_0012652 3300046506 Bacteria 4756
417 Ga0495583_0023203 3300046506 Bacteria 3144
418 Ga0495583_0143298 3300046506 Bacteria 994
419 Ga0495606_0089051 3300046507 Bacteria 1902
420 Ga0495616_0034366 3300046513 Bacteria 2633
421 Ga0495616_0041717 3300046513 Bacteria 2339
422 Ga0495616_0064515 3300046513 Bacteria 1787
423 Ga0495630_0014901 3300046517 Bacteria 5670
424 Ga0495631_0006519 3300046518 Bacteria 6021
425 Ga0495631_0009677 3300046518 Bacteria 4806
426 Ga0495631_0014950 3300046518 Bacteria 3732
427 Ga0495631_0203581 3300046518 Bacteria 846
428 Ga0495632_0003811 3300046519 Bacteria 10511
429 Ga0495632_0049842 3300046519 Bacteria 2068
430 Ga0495643_0018799 3300046522 Bacteria 4004
431 Ga0495644_0002504 3300046523 Bacteria 7326
432 Ga0495644_0017039 3300046523 Bacteria 2780
433 Ga0495644_0029568 3300046523 Bacteria 2070
434 Ga0495648_0000815 3300046524 Bacteria 32978
435 Ga0495666_0003566 3300046526 Bacteria 7869
436 Ga0495666_0156403 3300046526 Bacteria 1058
437 Ga0495642_0000013 3300046528 Bacteria 123896
438 Ga0495642_0017369 3300046528 Bacteria 2811
439 Ga0495642_0040232 3300046528 Bacteria 1898
440 Ga0495642_0093510 3300046528 Bacteria 1274
441 Ga0495654_0004974 3300046530 Bacteria 7808
442 Ga0495665_0007660 3300046531 Bacteria 5843
443 Ga0495586_0089053 3300046535 Bacteria 1703
444 Ga0495586_0385626 3300046535 Unclassified 806
445 Ga0495587_0018542 3300046536 Bacteria 4316
446 Ga0495609_0000948 3300046538 Bacteria 20986
447 Ga0495609_0005910 3300046538 Bacteria 6324
448 Ga0495609_0021179 3300046538 Bacteria 2999
449 Ga0495609_0102637 3300046538 Bacteria 1238
450 Ga0495621_0033547 3300046539 Bacteria 1770
451 Ga0495621_0101783 3300046539 Bacteria 1094
452 Ga0495597_0006125 3300046542 Bacteria 6258
453 Ga0495597_0020490 3300046542 Bacteria 3079
454 Ga0495645_0571727 3300046543 Bacteria 698
455 Ga0495622_0094057 3300046557 Bacteria 1376
456 Ga0495633_0037882 3300046558 Bacteria 2305
457 Ga0495633_0045305 3300046558 Bacteria 2083
458 Ga0495656_0150497 3300046615 Bacteria 1123
459 Ga0495656_0166527 3300046615 Bacteria 1075
460 Ga0495668_0000373 3300046616 Bacteria 59298
461 Ga0495668_0046915 3300046616 Bacteria 2399
462 Ga0495668_0134968 3300046616 Bacteria 1350
463 Ga0495668_0162213 3300046616 Bacteria 1224
464 Ga0495611_0011487 3300046648 Bacteria 3755
465 Ga0495611_0049033 3300046648 Bacteria 1899
466 Ga0495625_0006300 3300046660 Bacteria 10610
467 Ga0495661_0009522 3300046665 Bacteria 6665
468 Ga0495661_0013871 3300046665 Bacteria 5406
469 Ga0495661_0024686 3300046665 Bacteria 3891
470 Ga0495661_0056187 3300046665 Bacteria 2356
471 Ga0495661_0065767 3300046665 Bacteria 2135
472 Ga0495661_0272031 3300046665 Bacteria 857
473 Ga0495588_0002056 3300046674 Bacteria 8606
474 Ga0495623_0060908 3300046679 Bacteria 2367
475 Ga0495658_0247497 3300046683 Bacteria 1120
476 Ga0495669_0001491 3300046684 Bacteria 9648
477 Ga0495669_0006852 3300046684 Bacteria 4768
478 Ga0495669_0048252 3300046684 Bacteria 1904
479 Ga0495613_0109696 3300046689 Bacteria 1990
480 Ga0495613_0307319 3300046689 Bacteria 1096
481 Ga0495624_0001290 3300046690 Bacteria 19765
482 Ga0495670_0012853 3300046691 Bacteria 4116
483 Ga0495670_0029128 3300046691 Bacteria 2739
484 Ga0495671_0000989 3300046692 Bacteria 19828
485 Ga0495589_0018014 3300046794 Bacteria 3624
486 Ga0495589_0027534 3300046794 Bacteria 2873
487 Ga0495600_0149738 3300046809 Bacteria 1511
488 Ga0495660_0047873 3300046810 Bacteria 2339
489 Ga0495581_0208481 3300047315 Bacteria 1143
490 Ga0495604_0060867 3300047317 Bacteria 2889
491 Ga0495604_0232047 3300047317 Bacteria 1265
492 Ga0495672_0042963 3300047320 Bacteria 2721
493 Ga0495672_0112700 3300047320 Bacteria 1457
494 Ga0495676_0009654 3300047321 Bacteria 8779
495 Ga0495676_0015149 3300047321 Bacteria 6880
496 Ga0495676_0041025 3300047321 Bacteria 3814
497 Ga0495676_0492953 3300047321 Bacteria 805
498 Ga0495680_0036776 3300047322 Bacteria 3927
499 Ga0495675_0141733 3300047444 Bacteria 1489
500 Ga0495677_0002312 3300047445 Bacteria 7514
501 Ga0495677_0005272 3300047445 Bacteria 4910
502 Ga0495679_026066 3300047446 Bacteria 1946
503 Ga0495685_076668 3300047447 Bacteria 1116
504 Ga0495673_0007840 3300047469 Bacteria 6071
505 Ga0495681_0009180 3300047470 Bacteria 6115
506 Ga0495681_0012177 3300047470 Bacteria 5069
507 Ga0495593_0006234 3300047673 Bacteria 7004
508 Ga0495602_0012852 3300048088 Bacteria 8583
509 Ga0495614_0103330 3300048089 Bacteria 1247
510 Ga0495615_0003349 3300048090 Bacteria 2675
511 Ga0495626_0001381 3300048091 Bacteria 19521
512 Ga0495626_0002812 3300048091 Bacteria 11650
513 Ga0495626_0006393 3300048091 Bacteria 6707
514 Ga0495626_0009558 3300048091 Bacteria 5237
515 Ga0495626_0027417 3300048091 Bacteria 2770
516 Ga0495626_0028758 3300048091 Bacteria 2691
517 Ga0495626_0040255 3300048091 Bacteria 2208
518 Ga0496101_0606039 3300048904 Bacteria 866
519 Ga0496102_0000231 3300048905 Bacteria 73157
520 Ga0496102_0000943 3300048905 Bacteria 27451
521 Ga0496102_0001702 3300048905 Bacteria 19248
522 Ga0496102_0301316 3300048905 Bacteria 1511
523 Ga0496103_0049971 3300048906 Bacteria 2586
524 Ga0496103_0051518 3300048906 Bacteria 2548
525 Ga0496103_0103977 3300048906 Bacteria 1799
526 Ga0496104_0000005 3300048907 Bacteria 620360
527 Ga0496104_0047410 3300048907 Bacteria 4050
528 Ga0496105_0000106 3300048908 Bacteria 56944
529 Ga0496105_0141427 3300048908 Bacteria 1981
530 Ga0496105_0611819 3300048908 Bacteria 844
531 Ga0496106_0001506 3300048909 Bacteria 17507
532 Ga0496107_0012164 3300048910 Bacteria 6002
533 Ga0496107_0142314 3300048910 Bacteria 1773
534 Ga0496108_0263696 3300048911 Bacteria 1499
535 Ga0496108_0452342 3300048911 Bacteria 1122
536 Ga0496109_0084620 3300048912 Bacteria 2926
537 Ga0496109_0104821 3300048912 Bacteria 2626
538 Ga0496110_0159180 3300048913 Bacteria 2046
539 Ga0496110_0630742 3300048913 Bacteria 971
540 Ga0496112_0038804 3300048915 Bacteria 4652
541 Ga0496113_0303283 3300048916 Bacteria 1279
542 Ga0496114_0012861 3300048917 Bacteria 6703
543 Ga0496121_0230157 3300048924 Bacteria 1299
544 Ga0496124_0002249 3300048927 Bacteria 25656
545 Ga0495678_007207 3300049459 Bacteria 5795
546 Ga0495682_0014012 3300049460 Bacteria 3044
547 Ga0495682_0051125 3300049460 Bacteria 1504
548 Ga0501033_0105330 3300049570 Bacteria 2056
549 Ga0501034_0002589 3300049571 Bacteria 21507
550 Ga0501036_0214161 3300049572 Bacteria 1618
551 Ga0501037_0218628 3300049573 Bacteria 1341
552 Ga0501038_0196655 3300049574 Bacteria 1620
553 Ga0501038_0483855 3300049574 Bacteria 948
554 Ga0501039_0052036 3300049575 Bacteria 3169
555 Ga0501039_0076109 3300049575 Bacteria 2609
556 Ga0501040_0044724 3300049576 Bacteria 3019
557 Ga0501041_0150614 3300049577 Bacteria 1452
558 Ga0501043_0177384 3300049579 Bacteria 1661
559 Ga0501046_0061483 3300049580 Bacteria 2936
560 Ga0501046_0148497 3300049580 Bacteria 1769
561 Ga0501048_0088350 3300049582 Bacteria 2186
562 Ga0501068_0096756 3300049584 Bacteria 1826
563 Ga0501071_0019978 3300049587 Bacteria 4653
564 Ga0501071_0121639 3300049587 Bacteria 1935
565 Ga0501072_0043830 3300049588 Bacteria 3517
566 Ga0501074_0424267 3300049590 Bacteria 943
567 Ga0501075_0010572 3300049591 Bacteria 6489
568 Ga0501075_0256244 3300049591 Bacteria 1333
569 Ga0501076_0012122 3300049592 Bacteria 6444
570 Ga0501076_0560963 3300049592 Bacteria 942
571 Ga0501077_0222286 3300049593 Bacteria 1200
572 Ga0501079_0040966 3300049741 Bacteria 3574
573 Ga0501079_0228273 3300049741 Bacteria 1454
574 Ga0501081_0026219 3300049743 Bacteria 3928
575 Ga0501081_0039813 3300049743 Bacteria 3217
576 Ga0501083_0142869 3300049744 Bacteria 1567
577 Ga0501035_0321483 3300049822 Bacteria 1300
578 Ga0501045_0061879 3300049824 Bacteria 2746
579 nmdc:mga05p37_16495_c1 3300050507 Bacteria 8897
580 nmdc:mga05p37_534646_c1 3300050507 Bacteria 1338
581 nmdc:mga05p37_75835_c1 3300050507 Bacteria 4140
582 nmdc:mga09592_11152_c1 3300050508 Bacteria 7313
583 nmdc:mga06r32_176363_c1 3300050510 Bacteria 2122
584 nmdc:mga06r32_458597_c1 3300050510 Bacteria 1254
585 nmdc:mga06r32_771_c1 3300050510 Bacteria 28266
586 nmdc:mga0n895_233101_c1 3300050512 Bacteria 1868
587 Ga0495612_0018286 3300053078 Bacteria 2808
588 Ga0495619_0111174 3300053085 Bacteria 1872
589 Ga0501084_0110106 3300054114 Bacteria 2314
590 Ga0501082_0063082 3300060353 Bacteria 3191
591 Ga0530510_0007515 3300061734 Bacteria 7590

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10087822 Ga0207650_100878222 187
2 3300046674 Ga0495588_0002056 Ga0495588_0002056_7976_8587 203
3 3300005436 Ga0070713_100663126 Ga0070713_1006631262 204
4 3300032002 Ga0307416_100220057 Ga0307416_1002200572 204
5 3300032126 Ga0307415_100133291 Ga0307415_1001332912 204
6 3300046535 Ga0495586_0385626 Ga0495586_0385626_31_645 204
7 3300035083 Ga0373926_0181272 Ga0373926_0181272_173_793 206
8 3300046528 Ga0495642_0017369 Ga0495642_0017369_1321_1959 212
9 3300005339 Ga0070660_100322818 Ga0070660_1003228182 214
10 3300005563 Ga0068855_100098280 Ga0068855_1000982803 214
11 3300005578 Ga0068854_100544948 Ga0068854_1005449481 214
12 3300005616 Ga0068852_100812551 Ga0068852_1008125512 214
13 3300005937 Ga0081455_10061678 Ga0081455_100616783 214
14 3300006844 Ga0075428_100006609 Ga0075428_1000066099 214
15 3300006844 Ga0075428_100082937 Ga0075428_1000829373 214
16 3300006847 Ga0075431_100006106 Ga0075431_1000061069 214
17 3300006847 Ga0075431_100108401 Ga0075431_1001084013 214
18 3300006880 Ga0075429_100012805 Ga0075429_1000128052 214
19 3300006881 Ga0068865_100579843 Ga0068865_1005798432 214
20 3300006914 Ga0075436_100315165 Ga0075436_1003151652 214
21 3300009147 Ga0114129_10000005 Ga0114129_1000000519 214
22 3300009147 Ga0114129_10016886 Ga0114129_100168867 214
23 3300010375 Ga0105239_10211046 Ga0105239_102110462 214
24 3300025909 Ga0207705_10129201 Ga0207705_101292012 214
25 3300025911 Ga0207654_10017416 Ga0207654_100174164 214
26 3300025938 Ga0207704_10390468 Ga0207704_103904682 214
27 3300025945 Ga0207679_10126902 Ga0207679_101269023 214
28 3300026142 Ga0207698_10060728 Ga0207698_100607282 214
29 3300037312 Ga0395899_0003912 Ga0395899_0003912_10756_11400 214
30 3300037312 Ga0395899_0011242 Ga0395899_0011242_4693_5337 214
31 3300037418 Ga0395900_0001162 Ga0395900_0001162_24513_25157 214
32 3300037418 Ga0395900_0020459 Ga0395900_0020459_4947_5591 214
33 3300037466 Ga0395898_0003358 Ga0395898_0003358_11252_11896 214
34 3300037471 Ga0395905_0004279 Ga0395905_0004279_7476_8120 214
35 3300037471 Ga0395905_0238031 Ga0395905_0238031_959_1603 214
36 3300038443 Ga0395901_0011447 Ga0395901_0011447_6989_7633 214
37 3300038443 Ga0395901_0175269 Ga0395901_0175269_536_1180 214
38 3300042007 Ga0439449_0027200 Ga0439449_0027200_1429_2073 214
39 3300042876 Ga0451577_0000058 Ga0451577_0000058_50172_50816 214
40 3300044712 Ga0453684_0000279 Ga0453684_0000279_146829_147473 214
41 3300044719 Ga0466971_0093729 Ga0466971_0093729_466_1110 214
42 3300044842 Ga0466957_0035583 Ga0466957_0035583_731_1375 214
43 3300045051 Ga0451576_0001134 Ga0451576_0001134_40367_41011 214
44 3300045976 Ga0466967_0005963 Ga0466967_0005963_3784_4428 214
45 3300046452 Ga0495617_000030 Ga0495617_000030_116666_117310 214
46 3300046453 Ga0495627_000228 Ga0495627_000228_23805_24449 214
47 3300046459 Ga0495629_0011521 Ga0495629_0011521_45_689 214
48 3300046463 Ga0495653_0007080 Ga0495653_0007080_5982_6626 214
49 3300046472 Ga0495580_0156956 Ga0495580_0156956_724_1368 214
50 3300046473 Ga0495582_0113473 Ga0495582_0113473_688_1332 214
51 3300046474 Ga0495605_0000046 Ga0495605_0000046_140259_140903 214
52 3300046474 Ga0495605_0012885 Ga0495605_0012885_1737_2381 214
53 3300046474 Ga0495605_0017171 Ga0495605_0017171_1509_2153 214
54 3300046474 Ga0495605_0035670 Ga0495605_0035670_742_1386 214
55 3300046491 Ga0495584_0001630 Ga0495584_0001630_12326_12970 214
56 3300046491 Ga0495584_0172202 Ga0495584_0172202_373_1017 214
57 3300046492 Ga0495585_0000410 Ga0495585_0000410_14022_14666 214
58 3300046500 Ga0495596_0000846 Ga0495596_0000846_9438_10082 214
59 3300046500 Ga0495596_0019781 Ga0495596_0019781_588_1232 214
60 3300046501 Ga0495607_0001168 Ga0495607_0001168_16603_17247 214
61 3300046506 Ga0495583_0000142 Ga0495583_0000142_3403_4047 214
62 3300046506 Ga0495583_0007855 Ga0495583_0007855_1319_1963 214
63 3300046506 Ga0495583_0012652 Ga0495583_0012652_1531_2175 214
64 3300046506 Ga0495583_0023203 Ga0495583_0023203_1835_2479 214
65 3300046507 Ga0495606_0089051 Ga0495606_0089051_90_734 214
66 3300046513 Ga0495616_0034366 Ga0495616_0034366_81_725 214
67 3300046513 Ga0495616_0041717 Ga0495616_0041717_165_809 214
68 3300046513 Ga0495616_0064515 Ga0495616_0064515_161_805 214
69 3300046517 Ga0495630_0014901 Ga0495630_0014901_3562_4206 214
70 3300046518 Ga0495631_0014950 Ga0495631_0014950_2699_3343 214
71 3300046518 Ga0495631_0203581 Ga0495631_0203581_98_742 214
72 3300046519 Ga0495632_0003811 Ga0495632_0003811_5809_6453 214
73 3300046519 Ga0495632_0049842 Ga0495632_0049842_592_1236 214
74 3300046523 Ga0495644_0002504 Ga0495644_0002504_6561_7205 214
75 3300046523 Ga0495644_0017039 Ga0495644_0017039_229_873 214
76 3300046524 Ga0495648_0000815 Ga0495648_0000815_16698_17342 214
77 3300046526 Ga0495666_0003566 Ga0495666_0003566_2554_3198 214
78 3300046526 Ga0495666_0156403 Ga0495666_0156403_385_1029 214
79 3300046528 Ga0495642_0000013 Ga0495642_0000013_31689_32333 214
80 3300046528 Ga0495642_0093510 Ga0495642_0093510_56_700 214
81 3300046530 Ga0495654_0004974 Ga0495654_0004974_6432_7076 214
82 3300046531 Ga0495665_0007660 Ga0495665_0007660_4624_5268 214
83 3300046538 Ga0495609_0000948 Ga0495609_0000948_184_828 214
84 3300046538 Ga0495609_0005910 Ga0495609_0005910_2155_2799 214
85 3300046538 Ga0495609_0021179 Ga0495609_0021179_880_1524 214
86 3300046538 Ga0495609_0102637 Ga0495609_0102637_582_1226 214
87 3300046542 Ga0495597_0006125 Ga0495597_0006125_5513_6157 214
88 3300046542 Ga0495597_0020490 Ga0495597_0020490_1062_1706 214
89 3300046558 Ga0495633_0037882 Ga0495633_0037882_813_1457 214
90 3300046558 Ga0495633_0045305 Ga0495633_0045305_1415_2059 214
91 3300046615 Ga0495656_0150497 Ga0495656_0150497_353_997 214
92 3300046616 Ga0495668_0000373 Ga0495668_0000373_23819_24463 214
93 3300046616 Ga0495668_0134968 Ga0495668_0134968_206_850 214
94 3300046616 Ga0495668_0162213 Ga0495668_0162213_64_708 214
95 3300046648 Ga0495611_0049033 Ga0495611_0049033_14_658 214
96 3300046660 Ga0495625_0006300 Ga0495625_0006300_1950_2594 214
97 3300046665 Ga0495661_0009522 Ga0495661_0009522_726_1370 214
98 3300046665 Ga0495661_0013871 Ga0495661_0013871_3384_4028 214
99 3300046665 Ga0495661_0024686 Ga0495661_0024686_3234_3878 214
100 3300046665 Ga0495661_0065767 Ga0495661_0065767_917_1561 214
101 3300046665 Ga0495661_0272031 Ga0495661_0272031_181_825 214
102 3300046679 Ga0495623_0060908 Ga0495623_0060908_1664_2308 214
103 3300046684 Ga0495669_0006852 Ga0495669_0006852_3068_3712 214
104 3300046684 Ga0495669_0048252 Ga0495669_0048252_1012_1656 214
105 3300046689 Ga0495613_0307319 Ga0495613_0307319_406_1050 214
106 3300046690 Ga0495624_0001290 Ga0495624_0001290_12195_12839 214
107 3300046691 Ga0495670_0012853 Ga0495670_0012853_1396_2040 214
108 3300046691 Ga0495670_0029128 Ga0495670_0029128_1871_2515 214
109 3300046692 Ga0495671_0000989 Ga0495671_0000989_373_1017 214
110 3300046794 Ga0495589_0018014 Ga0495589_0018014_1070_1714 214
111 3300046794 Ga0495589_0027534 Ga0495589_0027534_844_1488 214
112 3300046809 Ga0495600_0149738 Ga0495600_0149738_689_1333 214
113 3300046810 Ga0495660_0047873 Ga0495660_0047873_705_1349 214
114 3300047317 Ga0495604_0060867 Ga0495604_0060867_484_1128 214
115 3300047320 Ga0495672_0042963 Ga0495672_0042963_351_995 214
116 3300047321 Ga0495676_0009654 Ga0495676_0009654_4538_5182 214
117 3300047444 Ga0495675_0141733 Ga0495675_0141733_404_1048 214
118 3300047445 Ga0495677_0002312 Ga0495677_0002312_6131_6775 214
119 3300047445 Ga0495677_0005272 Ga0495677_0005272_2939_3583 214
120 3300047447 Ga0495685_076668 Ga0495685_076668_38_682 214
121 3300047470 Ga0495681_0009180 Ga0495681_0009180_3412_4056 214
122 3300047470 Ga0495681_0012177 Ga0495681_0012177_3042_3686 214
123 3300047673 Ga0495593_0006234 Ga0495593_0006234_6047_6691 214
124 3300048088 Ga0495602_0012852 Ga0495602_0012852_488_1132 214
125 3300048089 Ga0495614_0103330 Ga0495614_0103330_379_1023 214
126 3300048090 Ga0495615_0003349 Ga0495615_0003349_469_1113 214
127 3300048091 Ga0495626_0001381 Ga0495626_0001381_13575_14219 214
128 3300048091 Ga0495626_0002812 Ga0495626_0002812_7144_7788 214
129 3300048091 Ga0495626_0009558 Ga0495626_0009558_2840_3484 214
130 3300048091 Ga0495626_0027417 Ga0495626_0027417_482_1126 214
131 3300048091 Ga0495626_0040255 Ga0495626_0040255_114_758 214
132 3300048905 Ga0496102_0000231 Ga0496102_0000231_63183_63827 214
133 3300048905 Ga0496102_0000943 Ga0496102_0000943_17519_18163 214
134 3300048906 Ga0496103_0049971 Ga0496103_0049971_1887_2531 214
135 3300048906 Ga0496103_0051518 Ga0496103_0051518_326_970 214
136 3300048906 Ga0496103_0103977 Ga0496103_0103977_790_1434 214
137 3300048924 Ga0496121_0230157 Ga0496121_0230157_403_1047 214
138 3300049459 Ga0495678_007207 Ga0495678_007207_676_1320 214
139 3300049460 Ga0495682_0014012 Ga0495682_0014012_23_667 214
140 3300050507 nmdc:mga05p37_16495_c1 nmdc:mga05p37_16495_c1_4801_5445 214
141 3300050507 nmdc:mga05p37_75835_c1 nmdc:mga05p37_75835_c1_3217_3861 214
142 3300050508 nmdc:mga09592_11152_c1 nmdc:mga09592_11152_c1_6261_6905 214
143 3300050510 nmdc:mga06r32_176363_c1 nmdc:mga06r32_176363_c1_185_829 214
144 3300050510 nmdc:mga06r32_771_c1 nmdc:mga06r32_771_c1_17376_18020 214
145 3300005293 Ga0065715_10013140 Ga0065715_100131403 215
146 3300005293 Ga0065715_10134779 Ga0065715_101347791 215
147 3300005328 Ga0070676_10000101 Ga0070676_1000010114 215
148 3300005328 Ga0070676_10069411 Ga0070676_100694111 215
149 3300005328 Ga0070676_10262405 Ga0070676_102624052 215
150 3300005330 Ga0070690_100008126 Ga0070690_1000081266 215
151 3300005330 Ga0070690_100300570 Ga0070690_1003005702 215
152 3300005331 Ga0070670_100044711 Ga0070670_1000447113 215
153 3300005331 Ga0070670_100198719 Ga0070670_1001987191 215
154 3300005331 Ga0070670_100247343 Ga0070670_1002473432 215
155 3300005331 Ga0070670_100256607 Ga0070670_1002566073 215
156 3300005331 Ga0070670_100354683 Ga0070670_1003546832 215
157 3300005331 Ga0070670_100722074 Ga0070670_1007220741 215
158 3300005333 Ga0070677_10023693 Ga0070677_100236934 215
159 3300005333 Ga0070677_10169596 Ga0070677_101695962 215
160 3300005333 Ga0070677_10224284 Ga0070677_102242841 215
161 3300005334 Ga0068869_100004676 Ga0068869_1000046767 215
162 3300005334 Ga0068869_100296818 Ga0068869_1002968181 215
163 3300005335 Ga0070666_10006335 Ga0070666_100063357 215
164 3300005335 Ga0070666_10103994 Ga0070666_101039942 215
165 3300005335 Ga0070666_10354842 Ga0070666_103548422 215
166 3300005337 Ga0070682_100071815 Ga0070682_1000718152 215
167 3300005338 Ga0068868_100194263 Ga0068868_1001942632 215
168 3300005338 Ga0068868_100337060 Ga0068868_1003370602 215
169 3300005344 Ga0070661_100020975 Ga0070661_1000209752 215
170 3300005344 Ga0070661_100085741 Ga0070661_1000857412 215
171 3300005344 Ga0070661_100285316 Ga0070661_1002853162 215
172 3300005347 Ga0070668_100003342 Ga0070668_1000033429 215
173 3300005347 Ga0070668_100056117 Ga0070668_1000561172 215
174 3300005347 Ga0070668_100117206 Ga0070668_1001172062 215
175 3300005347 Ga0070668_100759510 Ga0070668_1007595101 215
176 3300005353 Ga0070669_100000736 Ga0070669_1000007364 215
177 3300005353 Ga0070669_100031072 Ga0070669_1000310722 215
178 3300005353 Ga0070669_100210501 Ga0070669_1002105012 215
179 3300005353 Ga0070669_100857577 Ga0070669_1008575771 215
180 3300005354 Ga0070675_100046723 Ga0070675_1000467234 215
181 3300005354 Ga0070675_100125332 Ga0070675_1001253323 215
182 3300005354 Ga0070675_100599912 Ga0070675_1005999121 215
183 3300005355 Ga0070671_100008194 Ga0070671_1000081945 215
184 3300005355 Ga0070671_100010572 Ga0070671_1000105726 215
185 3300005355 Ga0070671_100031962 Ga0070671_1000319623 215
186 3300005355 Ga0070671_100110104 Ga0070671_1001101043 215
187 3300005355 Ga0070671_100127658 Ga0070671_1001276582 215
188 3300005356 Ga0070674_100001055 Ga0070674_1000010557 215
189 3300005356 Ga0070674_100057821 Ga0070674_1000578213 215
190 3300005364 Ga0070673_100059057 Ga0070673_1000590571 215
191 3300005366 Ga0070659_100002514 Ga0070659_1000025147 215
192 3300005367 Ga0070667_100000911 Ga0070667_10000091113 215
193 3300005434 Ga0070709_10008851 Ga0070709_100088514 215
194 3300005436 Ga0070713_100054486 Ga0070713_1000544863 215
195 3300005439 Ga0070711_100853846 Ga0070711_1008538461 215
196 3300005441 Ga0070700_100717075 Ga0070700_1007170751 215
197 3300005455 Ga0070663_100009320 Ga0070663_1000093202 215
198 3300005456 Ga0070678_100023877 Ga0070678_1000238775 215
199 3300005456 Ga0070678_100050825 Ga0070678_1000508253 215
200 3300005456 Ga0070678_100064684 Ga0070678_1000646842 215
201 3300005456 Ga0070678_100124271 Ga0070678_1001242712 215
202 3300005456 Ga0070678_101041507 Ga0070678_1010415071 215
203 3300005457 Ga0070662_100000248 Ga0070662_10000024821 215
204 3300005457 Ga0070662_100009651 Ga0070662_1000096515 215
205 3300005457 Ga0070662_100032471 Ga0070662_1000324715 215
206 3300005457 Ga0070662_100186094 Ga0070662_1001860942 215
207 3300005457 Ga0070662_100279826 Ga0070662_1002798262 215
208 3300005458 Ga0070681_10008343 Ga0070681_100083433 215
209 3300005459 Ga0068867_100002478 Ga0068867_1000024786 215
210 3300005459 Ga0068867_100006095 Ga0068867_1000060953 215
211 3300005459 Ga0068867_100018802 Ga0068867_1000188023 215
212 3300005459 Ga0068867_100161639 Ga0068867_1001616391 215
213 3300005466 Ga0070685_10681668 Ga0070685_106816681 215
214 3300005530 Ga0070679_100486878 Ga0070679_1004868782 215
215 3300005539 Ga0068853_100130371 Ga0068853_1001303713 215
216 3300005539 Ga0068853_100142181 Ga0068853_1001421813 215
217 3300005539 Ga0068853_100504936 Ga0068853_1005049362 215
218 3300005543 Ga0070672_100000298 Ga0070672_10000029812 215
219 3300005543 Ga0070672_100006518 Ga0070672_1000065185 215
220 3300005543 Ga0070672_100205852 Ga0070672_1002058521 215
221 3300005543 Ga0070672_100240126 Ga0070672_1002401261 215
222 3300005543 Ga0070672_100253803 Ga0070672_1002538032 215
223 3300005544 Ga0070686_100068904 Ga0070686_1000689042 215
224 3300005544 Ga0070686_100671238 Ga0070686_1006712381 215
225 3300005546 Ga0070696_100780467 Ga0070696_1007804671 215
226 3300005547 Ga0070693_100187682 Ga0070693_1001876821 215
227 3300005547 Ga0070693_100629414 Ga0070693_1006294141 215
228 3300005563 Ga0068855_100001259 Ga0068855_1000012596 215
229 3300005563 Ga0068855_100027568 Ga0068855_1000275686 215
230 3300005563 Ga0068855_100284887 Ga0068855_1002848873 215
231 3300005564 Ga0070664_100008908 Ga0070664_1000089085 215
232 3300005564 Ga0070664_100168234 Ga0070664_1001682342 215
233 3300005564 Ga0070664_100314562 Ga0070664_1003145622 215
234 3300005578 Ga0068854_100036313 Ga0068854_1000363134 215
235 3300005578 Ga0068854_100192026 Ga0068854_1001920262 215
236 3300005614 Ga0068856_100000181 Ga0068856_10000018119 215
237 3300005614 Ga0068856_100004921 Ga0068856_1000049215 215
238 3300005616 Ga0068852_100003271 Ga0068852_1000032719 215
239 3300005616 Ga0068852_100152745 Ga0068852_1001527453 215
240 3300005617 Ga0068859_100264425 Ga0068859_1002644251 215
241 3300005617 Ga0068859_100878201 Ga0068859_1008782011 215
242 3300005618 Ga0068864_100041050 Ga0068864_1000410502 215
243 3300005618 Ga0068864_100045250 Ga0068864_1000452504 215
244 3300005618 Ga0068864_100525156 Ga0068864_1005251562 215
245 3300005718 Ga0068866_10002517 Ga0068866_100025177 215
246 3300005718 Ga0068866_10218516 Ga0068866_102185162 215
247 3300005719 Ga0068861_100003452 Ga0068861_10000345210 215
248 3300005719 Ga0068861_100281770 Ga0068861_1002817702 215
249 3300005834 Ga0068851_10018572 Ga0068851_100185724 215
250 3300005834 Ga0068851_10082638 Ga0068851_100826381 215
251 3300005840 Ga0068870_10208625 Ga0068870_102086252 215
252 3300005841 Ga0068863_100000830 Ga0068863_10000083015 215
253 3300005841 Ga0068863_100022362 Ga0068863_1000223625 215
254 3300005841 Ga0068863_100226153 Ga0068863_1002261532 215
255 3300005841 Ga0068863_100256032 Ga0068863_1002560322 215
256 3300005841 Ga0068863_100724234 Ga0068863_1007242341 215
257 3300005841 Ga0068863_100872110 Ga0068863_1008721101 215
258 3300005842 Ga0068858_100001155 Ga0068858_10000115513 215
259 3300005842 Ga0068858_100086524 Ga0068858_1000865243 215
260 3300005842 Ga0068858_100302774 Ga0068858_1003027742 215
261 3300005843 Ga0068860_100000796 Ga0068860_10000079621 215
262 3300005843 Ga0068860_100189421 Ga0068860_1001894212 215
263 3300005844 Ga0068862_100037681 Ga0068862_1000376814 215
264 3300005937 Ga0081455_10468054 Ga0081455_104680541 215
265 3300005983 Ga0081540_1036258 Ga0081540_10362582 215
266 3300006028 Ga0070717_10482741 Ga0070717_104827412 215
267 3300006175 Ga0070712_100076186 Ga0070712_1000761863 215
268 3300006175 Ga0070712_100333352 Ga0070712_1003333522 215
269 3300006237 Ga0097621_100178113 Ga0097621_1001781133 215
270 3300006237 Ga0097621_100263886 Ga0097621_1002638862 215
271 3300006237 Ga0097621_100525600 Ga0097621_1005256001 215
272 3300006358 Ga0068871_100014907 Ga0068871_1000149077 215
273 3300006358 Ga0068871_100158590 Ga0068871_1001585901 215
274 3300006871 Ga0075434_100289431 Ga0075434_1002894312 215
275 3300006881 Ga0068865_100001586 Ga0068865_1000015862 215
276 3300006881 Ga0068865_100007519 Ga0068865_1000075192 215
277 3300006881 Ga0068865_100126883 Ga0068865_1001268832 215
278 3300006881 Ga0068865_100244733 Ga0068865_1002447331 215
279 3300006881 Ga0068865_100423017 Ga0068865_1004230172 215
280 3300006931 Ga0097620_100264407 Ga0097620_1002644072 215
281 3300006931 Ga0097620_100878241 Ga0097620_1008782411 215
282 3300009094 Ga0111539_10549676 Ga0111539_105496762 215
283 3300009094 Ga0111539_10676348 Ga0111539_106763481 215
284 3300009147 Ga0114129_10474476 Ga0114129_104744762 215
285 3300009148 Ga0105243_10014891 Ga0105243_100148915 215
286 3300009174 Ga0105241_10120373 Ga0105241_101203733 215
287 3300009176 Ga0105242_10018254 Ga0105242_100182544 215
288 3300009176 Ga0105242_10024340 Ga0105242_100243405 215
289 3300009176 Ga0105242_10573080 Ga0105242_105730802 215
290 3300009177 Ga0105248_10007457 Ga0105248_100074578 215
291 3300009177 Ga0105248_10035717 Ga0105248_100357174 215
292 3300009177 Ga0105248_10040894 Ga0105248_100408944 215
293 3300009177 Ga0105248_10093743 Ga0105248_100937432 215
294 3300009177 Ga0105248_10501479 Ga0105248_105014792 215
295 3300009177 Ga0105248_10775716 Ga0105248_107757161 215
296 3300009551 Ga0105238_10156942 Ga0105238_101569423 215
297 3300009553 Ga0105249_10031876 Ga0105249_100318766 215
298 3300009553 Ga0105249_10232531 Ga0105249_102325312 215
299 3300011119 Ga0105246_10464190 Ga0105246_104641902 215
300 3300011119 Ga0105246_10466640 Ga0105246_104666402 215
301 3300013102 Ga0157371_10000221 Ga0157371_1000022113 215
302 3300013104 Ga0157370_10048936 Ga0157370_100489365 215
303 3300013104 Ga0157370_10155262 Ga0157370_101552622 215
304 3300013104 Ga0157370_10244033 Ga0157370_102440331 215
305 3300013105 Ga0157369_10021715 Ga0157369_100217157 215
306 3300013105 Ga0157369_10169159 Ga0157369_101691593 215
307 3300013105 Ga0157369_10567331 Ga0157369_105673312 215
308 3300013296 Ga0157374_10145614 Ga0157374_101456143 215
309 3300013296 Ga0157374_10290105 Ga0157374_102901052 215
310 3300013306 Ga0163162_10004930 Ga0163162_100049309 215
311 3300013306 Ga0163162_10016912 Ga0163162_100169127 215
312 3300013306 Ga0163162_10102989 Ga0163162_101029892 215
313 3300013306 Ga0163162_10112431 Ga0163162_101124312 215
314 3300013306 Ga0163162_10198646 Ga0163162_101986463 215
315 3300013306 Ga0163162_10386687 Ga0163162_103866872 215
316 3300013307 Ga0157372_10000546 Ga0157372_100005464 215
317 3300013307 Ga0157372_10045693 Ga0157372_100456932 215
318 3300013308 Ga0157375_10001027 Ga0157375_100010276 215
319 3300013308 Ga0157375_10009764 Ga0157375_100097648 215
320 3300013308 Ga0157375_10014497 Ga0157375_100144972 215
321 3300013308 Ga0157375_10037005 Ga0157375_100370054 215
322 3300013308 Ga0157375_10119027 Ga0157375_101190273 215
323 3300013308 Ga0157375_10275507 Ga0157375_102755071 215
324 3300014325 Ga0163163_10237752 Ga0163163_102377522 215
325 3300014325 Ga0163163_10675326 Ga0163163_106753263 215
326 3300014326 Ga0157380_10000360 Ga0157380_1000036012 215
327 3300014326 Ga0157380_10393696 Ga0157380_103936962 215
328 3300014745 Ga0157377_10192749 Ga0157377_101927493 215
329 3300014968 Ga0157379_10020533 Ga0157379_100205334 215
330 3300014968 Ga0157379_10160371 Ga0157379_101603712 215
331 3300014968 Ga0157379_10347311 Ga0157379_103473112 215
332 3300014968 Ga0157379_10375481 Ga0157379_103754812 215
333 3300014969 Ga0157376_10382129 Ga0157376_103821291 215
334 3300014969 Ga0157376_10522774 Ga0157376_105227742 215
335 3300014969 Ga0157376_10579637 Ga0157376_105796372 215
336 3300017792 Ga0163161_10001228 Ga0163161_1000122810 215
337 3300017792 Ga0163161_10107246 Ga0163161_101072462 215
338 3300017792 Ga0163161_10173461 Ga0163161_101734612 215
339 3300017792 Ga0163161_10193158 Ga0163161_101931582 215
340 3300017792 Ga0163161_10373089 Ga0163161_103730892 215
341 3300025298 Ga0209050_1004532 Ga0209050_10045328 215
342 3300025315 Ga0207697_10005006 Ga0207697_100050062 215
343 3300025315 Ga0207697_10006847 Ga0207697_100068475 215
344 3300025321 Ga0207656_10013551 Ga0207656_100135512 215
345 3300025893 Ga0207682_10004587 Ga0207682_100045872 215
346 3300025893 Ga0207682_10011771 Ga0207682_100117714 215
347 3300025893 Ga0207682_10245730 Ga0207682_102457302 215
348 3300025899 Ga0207642_10013803 Ga0207642_100138033 215
349 3300025901 Ga0207688_10075148 Ga0207688_100751481 215
350 3300025903 Ga0207680_10041824 Ga0207680_100418244 215
351 3300025903 Ga0207680_10053775 Ga0207680_100537752 215
352 3300025904 Ga0207647_10072400 Ga0207647_100724001 215
353 3300025907 Ga0207645_10004531 Ga0207645_100045314 215
354 3300025907 Ga0207645_10025878 Ga0207645_100258785 215
355 3300025909 Ga0207705_10399820 Ga0207705_103998201 215
356 3300025911 Ga0207654_10135919 Ga0207654_101359192 215
357 3300025912 Ga0207707_10077924 Ga0207707_100779243 215
358 3300025912 Ga0207707_10140700 Ga0207707_101407002 215
359 3300025915 Ga0207693_10010583 Ga0207693_100105832 215
360 3300025915 Ga0207693_10122785 Ga0207693_101227852 215
361 3300025916 Ga0207663_10067944 Ga0207663_100679442 215
362 3300025917 Ga0207660_10069384 Ga0207660_100693842 215
363 3300025918 Ga0207662_10009408 Ga0207662_100094086 215
364 3300025919 Ga0207657_10000596 Ga0207657_1000059627 215
365 3300025919 Ga0207657_10099266 Ga0207657_100992663 215
366 3300025920 Ga0207649_10003941 Ga0207649_100039415 215
367 3300025920 Ga0207649_10115964 Ga0207649_101159642 215
368 3300025920 Ga0207649_10235457 Ga0207649_102354572 215
369 3300025920 Ga0207649_10552266 Ga0207649_105522662 215
370 3300025921 Ga0207652_10243405 Ga0207652_102434051 215
371 3300025923 Ga0207681_10000592 Ga0207681_1000059211 215
372 3300025923 Ga0207681_10013076 Ga0207681_100130764 215
373 3300025923 Ga0207681_10065318 Ga0207681_100653184 215
374 3300025925 Ga0207650_10010191 Ga0207650_100101914 215
375 3300025925 Ga0207650_10084049 Ga0207650_100840493 215
376 3300025925 Ga0207650_10212746 Ga0207650_102127462 215
377 3300025925 Ga0207650_10256500 Ga0207650_102565002 215
378 3300025925 Ga0207650_10662078 Ga0207650_106620782 215
379 3300025925 Ga0207650_10698994 Ga0207650_106989942 215
380 3300025926 Ga0207659_10006611 Ga0207659_100066114 215
381 3300025926 Ga0207659_10021777 Ga0207659_100217774 215
382 3300025926 Ga0207659_10022473 Ga0207659_100224734 215
383 3300025926 Ga0207659_10195610 Ga0207659_101956102 215
384 3300025926 Ga0207659_10492924 Ga0207659_104929242 215
385 3300025928 Ga0207700_10083392 Ga0207700_100833923 215
386 3300025928 Ga0207700_10370345 Ga0207700_103703452 215
387 3300025931 Ga0207644_10005044 Ga0207644_100050446 215
388 3300025931 Ga0207644_10014930 Ga0207644_100149302 215
389 3300025931 Ga0207644_10046510 Ga0207644_100465103 215
390 3300025931 Ga0207644_10070496 Ga0207644_100704963 215
391 3300025932 Ga0207690_10000419 Ga0207690_1000041921 215
392 3300025932 Ga0207690_10143180 Ga0207690_101431802 215
393 3300025932 Ga0207690_10644519 Ga0207690_106445192 215
394 3300025933 Ga0207706_10000074 Ga0207706_1000007420 215
395 3300025933 Ga0207706_10002518 Ga0207706_1000251815 215
396 3300025933 Ga0207706_10019690 Ga0207706_100196904 215
397 3300025933 Ga0207706_10227285 Ga0207706_102272852 215
398 3300025934 Ga0207686_10020451 Ga0207686_100204514 215
399 3300025934 Ga0207686_10035011 Ga0207686_100350113 215
400 3300025934 Ga0207686_10214443 Ga0207686_102144432 215
401 3300025934 Ga0207686_10228944 Ga0207686_102289442 215
402 3300025935 Ga0207709_10003323 Ga0207709_100033238 215
403 3300025937 Ga0207669_10000756 Ga0207669_100007567 215
404 3300025937 Ga0207669_10107277 Ga0207669_101072773 215
405 3300025937 Ga0207669_10109329 Ga0207669_101093292 215
406 3300025937 Ga0207669_10177038 Ga0207669_101770382 215
407 3300025938 Ga0207704_10000750 Ga0207704_100007507 215
408 3300025938 Ga0207704_10048038 Ga0207704_100480382 215
409 3300025938 Ga0207704_10083377 Ga0207704_100833772 215
410 3300025938 Ga0207704_10134599 Ga0207704_101345992 215
411 3300025940 Ga0207691_10001866 Ga0207691_1000186610 215
412 3300025940 Ga0207691_10014808 Ga0207691_100148085 215
413 3300025940 Ga0207691_10103201 Ga0207691_101032013 215
414 3300025940 Ga0207691_10178725 Ga0207691_101787252 215
415 3300025941 Ga0207711_10011986 Ga0207711_100119866 215
416 3300025941 Ga0207711_10014428 Ga0207711_100144284 215
417 3300025941 Ga0207711_10031161 Ga0207711_100311613 215
418 3300025941 Ga0207711_10041445 Ga0207711_100414454 215
419 3300025941 Ga0207711_10222835 Ga0207711_102228352 215
420 3300025942 Ga0207689_10006195 Ga0207689_100061951 215
421 3300025944 Ga0207661_10118582 Ga0207661_101185822 215
422 3300025945 Ga0207679_10007022 Ga0207679_100070225 215
423 3300025945 Ga0207679_10183171 Ga0207679_101831712 215
424 3300025945 Ga0207679_10240019 Ga0207679_102400193 215
425 3300025949 Ga0207667_10030975 Ga0207667_100309755 215
426 3300025949 Ga0207667_10307522 Ga0207667_103075223 215
427 3300025949 Ga0207667_10899361 Ga0207667_108993612 215
428 3300025960 Ga0207651_10084601 Ga0207651_100846013 215
429 3300025960 Ga0207651_10399649 Ga0207651_103996492 215
430 3300025961 Ga0207712_10012206 Ga0207712_100122064 215
431 3300025972 Ga0207668_10014767 Ga0207668_100147673 215
432 3300025972 Ga0207668_10033851 Ga0207668_100338513 215
433 3300025981 Ga0207640_10089134 Ga0207640_100891342 215
434 3300025981 Ga0207640_10402079 Ga0207640_104020792 215
435 3300025981 Ga0207640_10631853 Ga0207640_106318532 215
436 3300025981 Ga0207640_10939463 Ga0207640_109394631 215
437 3300025986 Ga0207658_10000510 Ga0207658_100005107 215
438 3300025986 Ga0207658_10067112 Ga0207658_100671123 215
439 3300025986 Ga0207658_10086504 Ga0207658_100865042 215
440 3300025986 Ga0207658_10255718 Ga0207658_102557182 215
441 3300025986 Ga0207658_10376149 Ga0207658_103761492 215
442 3300026023 Ga0207677_10445572 Ga0207677_104455722 215
443 3300026023 Ga0207677_11011019 Ga0207677_110110191 215
444 3300026035 Ga0207703_10001422 Ga0207703_1000142215 215
445 3300026035 Ga0207703_10293490 Ga0207703_102934902 215
446 3300026041 Ga0207639_10032306 Ga0207639_100323063 215
447 3300026041 Ga0207639_10283807 Ga0207639_102838072 215
448 3300026041 Ga0207639_10540742 Ga0207639_105407421 215
449 3300026041 Ga0207639_10553527 Ga0207639_105535272 215
450 3300026067 Ga0207678_10007835 Ga0207678_1000783510 215
451 3300026075 Ga0207708_10484405 Ga0207708_104844052 215
452 3300026078 Ga0207702_10001390 Ga0207702_1000139019 215
453 3300026078 Ga0207702_10153702 Ga0207702_101537022 215
454 3300026088 Ga0207641_10001218 Ga0207641_1000121810 215
455 3300026088 Ga0207641_10056997 Ga0207641_100569974 215
456 3300026088 Ga0207641_10162067 Ga0207641_101620672 215
457 3300026088 Ga0207641_10210230 Ga0207641_102102303 215
458 3300026089 Ga0207648_10001492 Ga0207648_1000149216 215
459 3300026089 Ga0207648_10012368 Ga0207648_100123685 215
460 3300026089 Ga0207648_10018499 Ga0207648_100184996 215
461 3300026089 Ga0207648_10104243 Ga0207648_101042433 215
462 3300026095 Ga0207676_10036241 Ga0207676_100362414 215
463 3300026095 Ga0207676_10040883 Ga0207676_100408832 215
464 3300026095 Ga0207676_10151988 Ga0207676_101519882 215
465 3300026095 Ga0207676_10418284 Ga0207676_104182842 215
466 3300026118 Ga0207675_100001773 Ga0207675_10000177315 215
467 3300026118 Ga0207675_100275507 Ga0207675_1002755072 215
468 3300026121 Ga0207683_10005185 Ga0207683_100051856 215
469 3300026121 Ga0207683_10085823 Ga0207683_100858233 215
470 3300026121 Ga0207683_10150989 Ga0207683_101509892 215
471 3300026121 Ga0207683_10227010 Ga0207683_102270102 215
472 3300026121 Ga0207683_11180612 Ga0207683_111806121 215
473 3300026142 Ga0207698_10012687 Ga0207698_100126873 215
474 3300026142 Ga0207698_10196320 Ga0207698_101963203 215
475 3300026142 Ga0207698_10406415 Ga0207698_104064152 215
476 3300027907 Ga0207428_10613387 Ga0207428_106133872 215
477 3300028380 Ga0268265_10005696 Ga0268265_100056964 215
478 3300028381 Ga0268264_10028083 Ga0268264_100280834 215
479 3300028381 Ga0268264_10192730 Ga0268264_101927303 215
480 3300028381 Ga0268264_10988880 Ga0268264_109888801 215
481 3300032004 Ga0307414_10585342 Ga0307414_105853422 215
482 3300035083 Ga0373926_0034130 Ga0373926_0034130_654_1301 215
483 3300035116 Ga0373945_0177915 Ga0373945_0177915_129_776 215
484 3300035170 Ga0373943_0026826 Ga0373943_0026826_1605_2252 215
485 3300035410 Ga0373924_0020099 Ga0373924_0020099_1200_1847 215
486 3300035691 Ga0373931_0069174 Ga0373931_0069174_130_786 215
487 3300035692 Ga0373935_0112178 Ga0373935_0112178_497_1144 215
488 3300035724 Ga0373933_0161205 Ga0373933_0161205_38_685 215
489 3300035725 Ga0373947_0088546 Ga0373947_0088546_47_694 215
490 3300037068 Ga0373925_0026288 Ga0373925_0026288_2236_2883 215
491 3300037068 Ga0373925_0336654 Ga0373925_0336654_15_662 215
492 3300046453 Ga0495627_022678 Ga0495627_022678_335_982 215
493 3300046455 Ga0495603_0140527 Ga0495603_0140527_150_902 215
494 3300046491 Ga0495584_0064863 Ga0495584_0064863_605_1252 215
495 3300046492 Ga0495585_0003320 Ga0495585_0003320_8432_9079 215
496 3300046499 Ga0495594_0033471 Ga0495594_0033471_1769_2416 215
497 3300046499 Ga0495594_0289775 Ga0495594_0289775_153_800 215
498 3300046500 Ga0495596_0005147 Ga0495596_0005147_3098_3745 215
499 3300046500 Ga0495596_0005570 Ga0495596_0005570_5090_5737 215
500 3300046501 Ga0495607_0052992 Ga0495607_0052992_1139_1786 215
501 3300046506 Ga0495583_0143298 Ga0495583_0143298_177_824 215
502 3300046518 Ga0495631_0006519 Ga0495631_0006519_2776_3423 215
503 3300046518 Ga0495631_0009677 Ga0495631_0009677_697_1344 215
504 3300046522 Ga0495643_0018799 Ga0495643_0018799_2753_3400 215
505 3300046523 Ga0495644_0029568 Ga0495644_0029568_1181_1828 215
506 3300046528 Ga0495642_0040232 Ga0495642_0040232_795_1442 215
507 3300046535 Ga0495586_0089053 Ga0495586_0089053_208_855 215
508 3300046536 Ga0495587_0018542 Ga0495587_0018542_3148_3795 215
509 3300046539 Ga0495621_0033547 Ga0495621_0033547_455_1105 215
510 3300046539 Ga0495621_0101783 Ga0495621_0101783_394_1041 215
511 3300046543 Ga0495645_0571727 Ga0495645_0571727_16_663 215
512 3300046557 Ga0495622_0094057 Ga0495622_0094057_620_1267 215
513 3300046615 Ga0495656_0166527 Ga0495656_0166527_176_823 215
514 3300046616 Ga0495668_0046915 Ga0495668_0046915_363_1010 215
515 3300046648 Ga0495611_0011487 Ga0495611_0011487_1695_2342 215
516 3300046665 Ga0495661_0056187 Ga0495661_0056187_23_670 215
517 3300046683 Ga0495658_0247497 Ga0495658_0247497_174_821 215
518 3300046684 Ga0495669_0001491 Ga0495669_0001491_8867_9514 215
519 3300046689 Ga0495613_0109696 Ga0495613_0109696_695_1342 215
520 3300047315 Ga0495581_0208481 Ga0495581_0208481_464_1111 215
521 3300047317 Ga0495604_0232047 Ga0495604_0232047_552_1199 215
522 3300047320 Ga0495672_0112700 Ga0495672_0112700_206_853 215
523 3300047321 Ga0495676_0015149 Ga0495676_0015149_768_1415 215
524 3300047321 Ga0495676_0041025 Ga0495676_0041025_713_1360 215
525 3300047321 Ga0495676_0492953 Ga0495676_0492953_58_705 215
526 3300047322 Ga0495680_0036776 Ga0495680_0036776_1725_2372 215
527 3300047446 Ga0495679_026066 Ga0495679_026066_56_703 215
528 3300047469 Ga0495673_0007840 Ga0495673_0007840_1669_2316 215
529 3300048091 Ga0495626_0006393 Ga0495626_0006393_2087_2734 215
530 3300048091 Ga0495626_0028758 Ga0495626_0028758_1391_2038 215
531 3300048904 Ga0496101_0606039 Ga0496101_0606039_13_660 215
532 3300048905 Ga0496102_0001702 Ga0496102_0001702_6128_6775 215
533 3300048905 Ga0496102_0301316 Ga0496102_0301316_710_1357 215
534 3300048907 Ga0496104_0000005 Ga0496104_0000005_41894_42541 215
535 3300048907 Ga0496104_0047410 Ga0496104_0047410_2893_3540 215
536 3300048908 Ga0496105_0000106 Ga0496105_0000106_6010_6657 215
537 3300048908 Ga0496105_0141427 Ga0496105_0141427_756_1403 215
538 3300048908 Ga0496105_0611819 Ga0496105_0611819_185_832 215
539 3300048909 Ga0496106_0001506 Ga0496106_0001506_12118_12765 215
540 3300048910 Ga0496107_0012164 Ga0496107_0012164_4817_5464 215
541 3300048910 Ga0496107_0142314 Ga0496107_0142314_677_1324 215
542 3300048911 Ga0496108_0263696 Ga0496108_0263696_813_1460 215
543 3300048911 Ga0496108_0452342 Ga0496108_0452342_52_699 215
544 3300048912 Ga0496109_0084620 Ga0496109_0084620_868_1515 215
545 3300048912 Ga0496109_0104821 Ga0496109_0104821_738_1385 215
546 3300048913 Ga0496110_0159180 Ga0496110_0159180_497_1144 215
547 3300048913 Ga0496110_0630742 Ga0496110_0630742_96_848 215
548 3300048915 Ga0496112_0038804 Ga0496112_0038804_1573_2220 215
549 3300048916 Ga0496113_0303283 Ga0496113_0303283_596_1243 215
550 3300048917 Ga0496114_0012861 Ga0496114_0012861_3571_4218 215
551 3300048927 Ga0496124_0002249 Ga0496124_0002249_4969_5616 215
552 3300049460 Ga0495682_0051125 Ga0495682_0051125_616_1263 215
553 3300049570 Ga0501033_0105330 Ga0501033_0105330_616_1263 215
554 3300049571 Ga0501034_0002589 Ga0501034_0002589_7521_8168 215
555 3300049572 Ga0501036_0214161 Ga0501036_0214161_530_1177 215
556 3300049573 Ga0501037_0218628 Ga0501037_0218628_516_1163 215
557 3300049574 Ga0501038_0196655 Ga0501038_0196655_280_927 215
558 3300049574 Ga0501038_0483855 Ga0501038_0483855_220_867 215
559 3300049575 Ga0501039_0052036 Ga0501039_0052036_156_803 215
560 3300049575 Ga0501039_0076109 Ga0501039_0076109_564_1211 215
561 3300049576 Ga0501040_0044724 Ga0501040_0044724_892_1539 215
562 3300049577 Ga0501041_0150614 Ga0501041_0150614_466_1113 215
563 3300049579 Ga0501043_0177384 Ga0501043_0177384_11_658 215
564 3300049580 Ga0501046_0061483 Ga0501046_0061483_1858_2505 215
565 3300049580 Ga0501046_0148497 Ga0501046_0148497_472_1119 215
566 3300049582 Ga0501048_0088350 Ga0501048_0088350_506_1153 215
567 3300049584 Ga0501068_0096756 Ga0501068_0096756_1108_1755 215
568 3300049587 Ga0501071_0019978 Ga0501071_0019978_2894_3541 215
569 3300049587 Ga0501071_0121639 Ga0501071_0121639_880_1527 215
570 3300049588 Ga0501072_0043830 Ga0501072_0043830_1518_2165 215
571 3300049590 Ga0501074_0424267 Ga0501074_0424267_153_800 215
572 3300049591 Ga0501075_0010572 Ga0501075_0010572_4035_4682 215
573 3300049591 Ga0501075_0256244 Ga0501075_0256244_190_837 215
574 3300049592 Ga0501076_0012122 Ga0501076_0012122_440_1087 215
575 3300049592 Ga0501076_0560963 Ga0501076_0560963_140_787 215
576 3300049593 Ga0501077_0222286 Ga0501077_0222286_50_697 215
577 3300049741 Ga0501079_0040966 Ga0501079_0040966_135_782 215
578 3300049741 Ga0501079_0228273 Ga0501079_0228273_289_936 215
579 3300049743 Ga0501081_0026219 Ga0501081_0026219_2372_3019 215
580 3300049743 Ga0501081_0039813 Ga0501081_0039813_753_1400 215
581 3300049744 Ga0501083_0142869 Ga0501083_0142869_411_1058 215
582 3300049822 Ga0501035_0321483 Ga0501035_0321483_303_950 215
583 3300049824 Ga0501045_0061879 Ga0501045_0061879_809_1456 215
584 3300050507 nmdc:mga05p37_534646_c1 nmdc:mga05p37_534646_c1_380_1027 215
585 3300050510 nmdc:mga06r32_458597_c1 nmdc:mga06r32_458597_c1_239_886 215
586 3300050512 nmdc:mga0n895_233101_c1 nmdc:mga0n895_233101_c1_187_834 215
587 3300053078 Ga0495612_0018286 Ga0495612_0018286_511_1158 215
588 3300053085 Ga0495619_0111174 Ga0495619_0111174_638_1285 215
589 3300054114 Ga0501084_0110106 Ga0501084_0110106_1101_1748 215
590 3300060353 Ga0501082_0063082 Ga0501082_0063082_926_1573 215
591 3300061734 Ga0530510_0007515 Ga0530510_0007515_2095_2742 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

38

249

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6m-assembly2.cif.gz_D dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.9192 3 199
1ooz-assembly1.cif.gz_B deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9164 3 199
3dlx-assembly2.cif.gz_C crystal structure of human 3-oxoacid coa transferase 1 0.9164 6 199
5dbn-assembly2.cif.gz_E crystal structure of atoda complex 0.9157 4 200
1ooz-assembly1.cif.gz_A deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9154 3 199
ID Description Score Start End Superfamily
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.907 3 199 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8998 4 201 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8894 3 200 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8838 4 207 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8307 3 199 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A559GBE8-F1-model_v4 CoA transferase subunit A 0.9539 1 154 GO:0008410
AF-A0A0F2S9H6-F1-model_v4 Branched-chain amino acid dehydrogenase 0.9487 1 154 GO:0008410
AF-Q7P939-F1-model_v4 Putative succinyl-CoA:3-ketoacid-coenzyme A transferase 0.9435 18 152 GO:0008410
AF-A0A7Z9KKT0-F1-model_v4 CoA transferase subunit A 0.9394 1 125 GO:0008410
AF-A0A5A7MRX1-F1-model_v4 merged 0.9387 5 152

Feature Viewer

pLDDT pTM Quality
83.72 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map