F467073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 591 | 281 | 591 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0140527|Ga0495603_0140527_150_902 |
| Length | 250 |
| Sequence | VQWTVAAGSRQIEDRAQRELARGVVSETTINSRKLMRTLSLADAVALIPDGASLMIGGFMAVGTPESVVDELVRQGKRDLTVIANDTAMPGVGIGKLVRARLVKKAIVSHIGTNPETQAQMIGGEMEVDLVPQGTLVERIRAGGFGLGGILTATGVGTVVEEGKQKVTVAGKDYLVEPALRADFALVHAFMADYLGNLAYALTGRNFNPVIAMAADTVIVTVDNIVPVGLISPDHVVTPAPLVDYLIAQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 247 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 248 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 4.23 |
| Rhizosphere | 95.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10013140 | 3300005293 | Bacteria | 2245 |
| 2 | Ga0065715_10134779 | 3300005293 | Bacteria | 1943 |
| 3 | Ga0070676_10000101 | 3300005328 | Bacteria | 30545 |
| 4 | Ga0070676_10069411 | 3300005328 | Bacteria | 2112 |
| 5 | Ga0070676_10262405 | 3300005328 | Bacteria | 1157 |
| 6 | Ga0070690_100008126 | 3300005330 | Bacteria | 6029 |
| 7 | Ga0070690_100300570 | 3300005330 | Bacteria | 1151 |
| 8 | Ga0070670_100044711 | 3300005331 | Bacteria | 3807 |
| 9 | Ga0070670_100198719 | 3300005331 | Bacteria | 1742 |
| 10 | Ga0070670_100247343 | 3300005331 | Bacteria | 1553 |
| 11 | Ga0070670_100256607 | 3300005331 | Bacteria | 1523 |
| 12 | Ga0070670_100354683 | 3300005331 | Bacteria | 1289 |
| 13 | Ga0070670_100722074 | 3300005331 | Bacteria | 897 |
| 14 | Ga0070677_10023693 | 3300005333 | Bacteria | 2275 |
| 15 | Ga0070677_10169596 | 3300005333 | Bacteria | 1030 |
| 16 | Ga0070677_10224284 | 3300005333 | Bacteria | 920 |
| 17 | Ga0068869_100004676 | 3300005334 | Bacteria | 8544 |
| 18 | Ga0068869_100296818 | 3300005334 | Bacteria | 1304 |
| 19 | Ga0070666_10006335 | 3300005335 | Bacteria | 7280 |
| 20 | Ga0070666_10103994 | 3300005335 | Bacteria | 1960 |
| 21 | Ga0070666_10354842 | 3300005335 | Bacteria | 1050 |
| 22 | Ga0070682_100071815 | 3300005337 | Bacteria | 2216 |
| 23 | Ga0068868_100194263 | 3300005338 | Bacteria | 1689 |
| 24 | Ga0068868_100337060 | 3300005338 | Bacteria | 1289 |
| 25 | Ga0070660_100322818 | 3300005339 | Bacteria | 1268 |
| 26 | Ga0070661_100020975 | 3300005344 | Bacteria | 4664 |
| 27 | Ga0070661_100085741 | 3300005344 | Bacteria | 2328 |
| 28 | Ga0070661_100285316 | 3300005344 | Bacteria | 1282 |
| 29 | Ga0070668_100003342 | 3300005347 | Bacteria | 11827 |
| 30 | Ga0070668_100056117 | 3300005347 | Bacteria | 3041 |
| 31 | Ga0070668_100117206 | 3300005347 | Bacteria | 2124 |
| 32 | Ga0070668_100759510 | 3300005347 | Bacteria | 859 |
| 33 | Ga0070669_100000736 | 3300005353 | Bacteria | 23856 |
| 34 | Ga0070669_100031072 | 3300005353 | Bacteria | 3856 |
| 35 | Ga0070669_100210501 | 3300005353 | Bacteria | 1534 |
| 36 | Ga0070669_100857577 | 3300005353 | Bacteria | 774 |
| 37 | Ga0070675_100046723 | 3300005354 | Bacteria | 3546 |
| 38 | Ga0070675_100125332 | 3300005354 | Bacteria | 2184 |
| 39 | Ga0070675_100599912 | 3300005354 | Bacteria | 998 |
| 40 | Ga0070671_100008194 | 3300005355 | Bacteria | 8362 |
| 41 | Ga0070671_100010572 | 3300005355 | Bacteria | 7411 |
| 42 | Ga0070671_100031962 | 3300005355 | Bacteria | 4351 |
| 43 | Ga0070671_100110104 | 3300005355 | Bacteria | 2313 |
| 44 | Ga0070671_100127658 | 3300005355 | Bacteria | 2141 |
| 45 | Ga0070674_100001055 | 3300005356 | Bacteria | 14403 |
| 46 | Ga0070674_100057821 | 3300005356 | Bacteria | 2693 |
| 47 | Ga0070673_100059057 | 3300005364 | Bacteria | 3035 |
| 48 | Ga0070659_100002514 | 3300005366 | Bacteria | 13020 |
| 49 | Ga0070667_100000911 | 3300005367 | Bacteria | 27330 |
| 50 | Ga0070709_10008851 | 3300005434 | Bacteria | 5541 |
| 51 | Ga0070713_100054486 | 3300005436 | Bacteria | 3318 |
| 52 | Ga0070713_100663126 | 3300005436 | Unclassified | 994 |
| 53 | Ga0070711_100853846 | 3300005439 | Bacteria | 775 |
| 54 | Ga0070700_100717075 | 3300005441 | Bacteria | 797 |
| 55 | Ga0070663_100009320 | 3300005455 | Bacteria | 6076 |
| 56 | Ga0070678_100023877 | 3300005456 | Bacteria | 4084 |
| 57 | Ga0070678_100050825 | 3300005456 | Bacteria | 3001 |
| 58 | Ga0070678_100064684 | 3300005456 | Bacteria | 2712 |
| 59 | Ga0070678_100124271 | 3300005456 | Bacteria | 2040 |
| 60 | Ga0070678_101041507 | 3300005456 | Bacteria | 754 |
| 61 | Ga0070662_100000248 | 3300005457 | Bacteria | 31890 |
| 62 | Ga0070662_100009651 | 3300005457 | Bacteria | 6313 |
| 63 | Ga0070662_100032471 | 3300005457 | Bacteria | 3669 |
| 64 | Ga0070662_100186094 | 3300005457 | Bacteria | 1640 |
| 65 | Ga0070662_100279826 | 3300005457 | Bacteria | 1350 |
| 66 | Ga0070681_10008343 | 3300005458 | Bacteria | 10148 |
| 67 | Ga0068867_100002478 | 3300005459 | Bacteria | 12972 |
| 68 | Ga0068867_100006095 | 3300005459 | Bacteria | 8537 |
| 69 | Ga0068867_100018802 | 3300005459 | Bacteria | 4915 |
| 70 | Ga0068867_100161639 | 3300005459 | Bacteria | 1766 |
| 71 | Ga0070685_10681668 | 3300005466 | Bacteria | 748 |
| 72 | Ga0070679_100486878 | 3300005530 | Bacteria | 1178 |
| 73 | Ga0068853_100130371 | 3300005539 | Bacteria | 2250 |
| 74 | Ga0068853_100142181 | 3300005539 | Bacteria | 2155 |
| 75 | Ga0068853_100504936 | 3300005539 | Bacteria | 1142 |
| 76 | Ga0070672_100000298 | 3300005543 | Bacteria | 28086 |
| 77 | Ga0070672_100006518 | 3300005543 | Bacteria | 7847 |
| 78 | Ga0070672_100205852 | 3300005543 | Bacteria | 1647 |
| 79 | Ga0070672_100240126 | 3300005543 | Bacteria | 1524 |
| 80 | Ga0070672_100253803 | 3300005543 | Bacteria | 1482 |
| 81 | Ga0070686_100068904 | 3300005544 | Bacteria | 2309 |
| 82 | Ga0070686_100671238 | 3300005544 | Bacteria | 824 |
| 83 | Ga0070696_100780467 | 3300005546 | Bacteria | 785 |
| 84 | Ga0070693_100187682 | 3300005547 | Bacteria | 1335 |
| 85 | Ga0070693_100629414 | 3300005547 | Bacteria | 778 |
| 86 | Ga0068855_100001259 | 3300005563 | Bacteria | 31467 |
| 87 | Ga0068855_100027568 | 3300005563 | Bacteria | 6794 |
| 88 | Ga0068855_100098280 | 3300005563 | Bacteria | 3372 |
| 89 | Ga0068855_100284887 | 3300005563 | Bacteria | 1833 |
| 90 | Ga0070664_100008908 | 3300005564 | Bacteria | 8133 |
| 91 | Ga0070664_100168234 | 3300005564 | Bacteria | 1943 |
| 92 | Ga0070664_100314562 | 3300005564 | Bacteria | 1417 |
| 93 | Ga0068854_100036313 | 3300005578 | Bacteria | 3454 |
| 94 | Ga0068854_100192026 | 3300005578 | Bacteria | 1601 |
| 95 | Ga0068854_100544948 | 3300005578 | Bacteria | 983 |
| 96 | Ga0068856_100000181 | 3300005614 | Bacteria | 65631 |
| 97 | Ga0068856_100004921 | 3300005614 | Bacteria | 13221 |
| 98 | Ga0068852_100003271 | 3300005616 | Bacteria | 11311 |
| 99 | Ga0068852_100152745 | 3300005616 | Bacteria | 2149 |
| 100 | Ga0068852_100812551 | 3300005616 | Bacteria | 949 |
| 101 | Ga0068859_100264425 | 3300005617 | Bacteria | 1812 |
| 102 | Ga0068859_100878201 | 3300005617 | Bacteria | 982 |
| 103 | Ga0068864_100041050 | 3300005618 | Bacteria | 3958 |
| 104 | Ga0068864_100045250 | 3300005618 | Bacteria | 3775 |
| 105 | Ga0068864_100525156 | 3300005618 | Bacteria | 1142 |
| 106 | Ga0068866_10002517 | 3300005718 | Bacteria | 7548 |
| 107 | Ga0068866_10218516 | 3300005718 | Bacteria | 1148 |
| 108 | Ga0068861_100003452 | 3300005719 | Bacteria | 10493 |
| 109 | Ga0068861_100281770 | 3300005719 | Bacteria | 1432 |
| 110 | Ga0068851_10018572 | 3300005834 | Bacteria | 3350 |
| 111 | Ga0068851_10082638 | 3300005834 | Bacteria | 1680 |
| 112 | Ga0068870_10208625 | 3300005840 | Bacteria | 1189 |
| 113 | Ga0068863_100000830 | 3300005841 | Bacteria | 31001 |
| 114 | Ga0068863_100022362 | 3300005841 | Bacteria | 6038 |
| 115 | Ga0068863_100226153 | 3300005841 | Bacteria | 1804 |
| 116 | Ga0068863_100256032 | 3300005841 | Bacteria | 1692 |
| 117 | Ga0068863_100724234 | 3300005841 | Bacteria | 990 |
| 118 | Ga0068863_100872110 | 3300005841 | Bacteria | 900 |
| 119 | Ga0068858_100001155 | 3300005842 | Bacteria | 27330 |
| 120 | Ga0068858_100086524 | 3300005842 | Bacteria | 2915 |
| 121 | Ga0068858_100302774 | 3300005842 | Bacteria | 1525 |
| 122 | Ga0068860_100000796 | 3300005843 | Bacteria | 35406 |
| 123 | Ga0068860_100189421 | 3300005843 | Bacteria | 1990 |
| 124 | Ga0068862_100037681 | 3300005844 | Bacteria | 4099 |
| 125 | Ga0081455_10061678 | 3300005937 | Bacteria | 3154 |
| 126 | Ga0081455_10468054 | 3300005937 | Bacteria | 856 |
| 127 | Ga0081540_1036258 | 3300005983 | Bacteria | 2632 |
| 128 | Ga0070717_10482741 | 3300006028 | Bacteria | 1119 |
| 129 | Ga0070712_100076186 | 3300006175 | Bacteria | 2415 |
| 130 | Ga0070712_100333352 | 3300006175 | Bacteria | 1237 |
| 131 | Ga0097621_100178113 | 3300006237 | Bacteria | 1836 |
| 132 | Ga0097621_100263886 | 3300006237 | Bacteria | 1511 |
| 133 | Ga0097621_100525600 | 3300006237 | Bacteria | 1074 |
| 134 | Ga0068871_100014907 | 3300006358 | Bacteria | 5809 |
| 135 | Ga0068871_100158590 | 3300006358 | Bacteria | 1934 |
| 136 | Ga0075428_100006609 | 3300006844 | Bacteria | 12899 |
| 137 | Ga0075428_100082937 | 3300006844 | Bacteria | 3498 |
| 138 | Ga0075431_100006106 | 3300006847 | Bacteria | 11947 |
| 139 | Ga0075431_100108401 | 3300006847 | Bacteria | 2866 |
| 140 | Ga0075434_100289431 | 3300006871 | Bacteria | 1658 |
| 141 | Ga0075429_100012805 | 3300006880 | Bacteria | 7276 |
| 142 | Ga0068865_100001586 | 3300006881 | Bacteria | 13298 |
| 143 | Ga0068865_100007519 | 3300006881 | Bacteria | 6703 |
| 144 | Ga0068865_100126883 | 3300006881 | Bacteria | 1906 |
| 145 | Ga0068865_100244733 | 3300006881 | Bacteria | 1413 |
| 146 | Ga0068865_100423017 | 3300006881 | Bacteria | 1096 |
| 147 | Ga0068865_100579843 | 3300006881 | Bacteria | 945 |
| 148 | Ga0075436_100315165 | 3300006914 | Bacteria | 1123 |
| 149 | Ga0097620_100264407 | 3300006931 | Bacteria | 1812 |
| 150 | Ga0097620_100878241 | 3300006931 | Bacteria | 982 |
| 151 | Ga0111539_10549676 | 3300009094 | Bacteria | 1345 |
| 152 | Ga0111539_10676348 | 3300009094 | Bacteria | 1202 |
| 153 | Ga0114129_10000005 | 3300009147 | Bacteria | 159906 |
| 154 | Ga0114129_10016886 | 3300009147 | Bacteria | 10393 |
| 155 | Ga0114129_10474476 | 3300009147 | Bacteria | 1638 |
| 156 | Ga0105243_10014891 | 3300009148 | Bacteria | 5887 |
| 157 | Ga0105241_10120373 | 3300009174 | Bacteria | 2113 |
| 158 | Ga0105242_10018254 | 3300009176 | Bacteria | 5482 |
| 159 | Ga0105242_10024340 | 3300009176 | Bacteria | 4781 |
| 160 | Ga0105242_10573080 | 3300009176 | Bacteria | 1086 |
| 161 | Ga0105248_10007457 | 3300009177 | Bacteria | 12001 |
| 162 | Ga0105248_10035717 | 3300009177 | Bacteria | 5559 |
| 163 | Ga0105248_10040894 | 3300009177 | Bacteria | 5197 |
| 164 | Ga0105248_10093743 | 3300009177 | Bacteria | 3382 |
| 165 | Ga0105248_10501479 | 3300009177 | Bacteria | 1368 |
| 166 | Ga0105248_10775716 | 3300009177 | Bacteria | 1082 |
| 167 | Ga0105238_10156942 | 3300009551 | Bacteria | 2251 |
| 168 | Ga0105249_10031876 | 3300009553 | Bacteria | 4769 |
| 169 | Ga0105249_10232531 | 3300009553 | Bacteria | 1818 |
| 170 | Ga0105239_10211046 | 3300010375 | Bacteria | 2176 |
| 171 | Ga0105246_10464190 | 3300011119 | Bacteria | 1067 |
| 172 | Ga0105246_10466640 | 3300011119 | Bacteria | 1065 |
| 173 | Ga0157371_10000221 | 3300013102 | Bacteria | 83267 |
| 174 | Ga0157370_10048936 | 3300013104 | Bacteria | 4048 |
| 175 | Ga0157370_10155262 | 3300013104 | Bacteria | 2129 |
| 176 | Ga0157370_10244033 | 3300013104 | Bacteria | 1662 |
| 177 | Ga0157369_10021715 | 3300013105 | Bacteria | 7179 |
| 178 | Ga0157369_10169159 | 3300013105 | Bacteria | 2304 |
| 179 | Ga0157369_10567331 | 3300013105 | Bacteria | 1172 |
| 180 | Ga0157374_10145614 | 3300013296 | Bacteria | 2301 |
| 181 | Ga0157374_10290105 | 3300013296 | Bacteria | 1617 |
| 182 | Ga0163162_10004930 | 3300013306 | Bacteria | 12865 |
| 183 | Ga0163162_10016912 | 3300013306 | Bacteria | 7132 |
| 184 | Ga0163162_10102989 | 3300013306 | Bacteria | 2948 |
| 185 | Ga0163162_10112431 | 3300013306 | Bacteria | 2822 |
| 186 | Ga0163162_10198646 | 3300013306 | Bacteria | 2134 |
| 187 | Ga0163162_10386687 | 3300013306 | Bacteria | 1532 |
| 188 | Ga0157372_10000546 | 3300013307 | Bacteria | 41467 |
| 189 | Ga0157372_10045693 | 3300013307 | Bacteria | 4859 |
| 190 | Ga0157375_10001027 | 3300013308 | Bacteria | 24079 |
| 191 | Ga0157375_10009764 | 3300013308 | Bacteria | 8435 |
| 192 | Ga0157375_10014497 | 3300013308 | Bacteria | 7033 |
| 193 | Ga0157375_10037005 | 3300013308 | Bacteria | 4672 |
| 194 | Ga0157375_10119027 | 3300013308 | Bacteria | 2748 |
| 195 | Ga0157375_10275507 | 3300013308 | Bacteria | 1845 |
| 196 | Ga0163163_10237752 | 3300014325 | Bacteria | 1871 |
| 197 | Ga0163163_10675326 | 3300014325 | Bacteria | 1096 |
| 198 | Ga0157380_10000360 | 3300014326 | Bacteria | 27339 |
| 199 | Ga0157380_10393696 | 3300014326 | Bacteria | 1312 |
| 200 | Ga0157377_10192749 | 3300014745 | Bacteria | 1289 |
| 201 | Ga0157379_10020533 | 3300014968 | Bacteria | 5842 |
| 202 | Ga0157379_10160371 | 3300014968 | Bacteria | 2030 |
| 203 | Ga0157379_10347311 | 3300014968 | Bacteria | 1358 |
| 204 | Ga0157379_10375481 | 3300014968 | Bacteria | 1304 |
| 205 | Ga0157376_10382129 | 3300014969 | Bacteria | 1357 |
| 206 | Ga0157376_10522774 | 3300014969 | Bacteria | 1170 |
| 207 | Ga0157376_10579637 | 3300014969 | Bacteria | 1114 |
| 208 | Ga0163161_10001228 | 3300017792 | Bacteria | 19212 |
| 209 | Ga0163161_10107246 | 3300017792 | Bacteria | 2085 |
| 210 | Ga0163161_10173461 | 3300017792 | Bacteria | 1650 |
| 211 | Ga0163161_10193158 | 3300017792 | Bacteria | 1566 |
| 212 | Ga0163161_10373089 | 3300017792 | Bacteria | 1139 |
| 213 | Ga0209050_1004532 | 3300025298 | Bacteria | 9342 |
| 214 | Ga0207697_10005006 | 3300025315 | Bacteria | 6233 |
| 215 | Ga0207697_10006847 | 3300025315 | Bacteria | 5119 |
| 216 | Ga0207656_10013551 | 3300025321 | Bacteria | 3120 |
| 217 | Ga0207682_10004587 | 3300025893 | Bacteria | 5755 |
| 218 | Ga0207682_10011771 | 3300025893 | Bacteria | 3417 |
| 219 | Ga0207682_10245730 | 3300025893 | Bacteria | 832 |
| 220 | Ga0207642_10013803 | 3300025899 | Bacteria | 2960 |
| 221 | Ga0207688_10075148 | 3300025901 | Bacteria | 1923 |
| 222 | Ga0207680_10041824 | 3300025903 | Bacteria | 2677 |
| 223 | Ga0207680_10053775 | 3300025903 | Bacteria | 2419 |
| 224 | Ga0207647_10072400 | 3300025904 | Bacteria | 2078 |
| 225 | Ga0207645_10004531 | 3300025907 | Bacteria | 10263 |
| 226 | Ga0207645_10025878 | 3300025907 | Bacteria | 3795 |
| 227 | Ga0207705_10129201 | 3300025909 | Bacteria | 1879 |
| 228 | Ga0207705_10399820 | 3300025909 | Bacteria | 1062 |
| 229 | Ga0207654_10017416 | 3300025911 | Bacteria | 3755 |
| 230 | Ga0207654_10135919 | 3300025911 | Bacteria | 1562 |
| 231 | Ga0207707_10077924 | 3300025912 | Bacteria | 2893 |
| 232 | Ga0207707_10140700 | 3300025912 | Bacteria | 2110 |
| 233 | Ga0207693_10010583 | 3300025915 | Bacteria | 7485 |
| 234 | Ga0207693_10122785 | 3300025915 | Bacteria | 2040 |
| 235 | Ga0207663_10067944 | 3300025916 | Bacteria | 2287 |
| 236 | Ga0207660_10069384 | 3300025917 | Bacteria | 2559 |
| 237 | Ga0207662_10009408 | 3300025918 | Bacteria | 5376 |
| 238 | Ga0207657_10000596 | 3300025919 | Bacteria | 38318 |
| 239 | Ga0207657_10099266 | 3300025919 | Bacteria | 2418 |
| 240 | Ga0207649_10003941 | 3300025920 | Bacteria | 8098 |
| 241 | Ga0207649_10115964 | 3300025920 | Bacteria | 1797 |
| 242 | Ga0207649_10235457 | 3300025920 | Bacteria | 1312 |
| 243 | Ga0207649_10552266 | 3300025920 | Bacteria | 881 |
| 244 | Ga0207652_10243405 | 3300025921 | Bacteria | 1622 |
| 245 | Ga0207681_10000592 | 3300025923 | Bacteria | 24653 |
| 246 | Ga0207681_10013076 | 3300025923 | Bacteria | 5132 |
| 247 | Ga0207681_10065318 | 3300025923 | Bacteria | 2515 |
| 248 | Ga0207650_10010191 | 3300025925 | Bacteria | 6441 |
| 249 | Ga0207650_10084049 | 3300025925 | Bacteria | 2419 |
| 250 | Ga0207650_10087822 | 3300025925 | Bacteria | 2370 |
| 251 | Ga0207650_10212746 | 3300025925 | Bacteria | 1553 |
| 252 | Ga0207650_10256500 | 3300025925 | Bacteria | 1417 |
| 253 | Ga0207650_10662078 | 3300025925 | Bacteria | 881 |
| 254 | Ga0207650_10698994 | 3300025925 | Bacteria | 856 |
| 255 | Ga0207659_10006611 | 3300025926 | Bacteria | 7119 |
| 256 | Ga0207659_10021777 | 3300025926 | Bacteria | 4261 |
| 257 | Ga0207659_10022473 | 3300025926 | Bacteria | 4200 |
| 258 | Ga0207659_10195610 | 3300025926 | Bacteria | 1611 |
| 259 | Ga0207659_10492924 | 3300025926 | Bacteria | 1036 |
| 260 | Ga0207700_10083392 | 3300025928 | Bacteria | 2502 |
| 261 | Ga0207700_10370345 | 3300025928 | Bacteria | 1251 |
| 262 | Ga0207644_10005044 | 3300025931 | Bacteria | 8616 |
| 263 | Ga0207644_10014930 | 3300025931 | Bacteria | 5207 |
| 264 | Ga0207644_10046510 | 3300025931 | Bacteria | 3092 |
| 265 | Ga0207644_10070496 | 3300025931 | Bacteria | 2555 |
| 266 | Ga0207690_10000419 | 3300025932 | Bacteria | 27647 |
| 267 | Ga0207690_10143180 | 3300025932 | Bacteria | 1764 |
| 268 | Ga0207690_10644519 | 3300025932 | Bacteria | 868 |
| 269 | Ga0207706_10000074 | 3300025933 | Bacteria | 103144 |
| 270 | Ga0207706_10002518 | 3300025933 | Bacteria | 17874 |
| 271 | Ga0207706_10019690 | 3300025933 | Bacteria | 6071 |
| 272 | Ga0207706_10227285 | 3300025933 | Bacteria | 1633 |
| 273 | Ga0207686_10020451 | 3300025934 | Bacteria | 3782 |
| 274 | Ga0207686_10035011 | 3300025934 | Bacteria | 3010 |
| 275 | Ga0207686_10214443 | 3300025934 | Bacteria | 1386 |
| 276 | Ga0207686_10228944 | 3300025934 | Bacteria | 1346 |
| 277 | Ga0207709_10003323 | 3300025935 | Bacteria | 9633 |
| 278 | Ga0207669_10000756 | 3300025937 | Bacteria | 13966 |
| 279 | Ga0207669_10107277 | 3300025937 | Bacteria | 1862 |
| 280 | Ga0207669_10109329 | 3300025937 | Bacteria | 1848 |
| 281 | Ga0207669_10177038 | 3300025937 | Bacteria | 1525 |
| 282 | Ga0207704_10000750 | 3300025938 | Bacteria | 14293 |
| 283 | Ga0207704_10048038 | 3300025938 | Bacteria | 2556 |
| 284 | Ga0207704_10083377 | 3300025938 | Bacteria | 2074 |
| 285 | Ga0207704_10134599 | 3300025938 | Bacteria | 1718 |
| 286 | Ga0207704_10390468 | 3300025938 | Bacteria | 1095 |
| 287 | Ga0207691_10001866 | 3300025940 | Bacteria | 20593 |
| 288 | Ga0207691_10014808 | 3300025940 | Bacteria | 7431 |
| 289 | Ga0207691_10103201 | 3300025940 | Bacteria | 2543 |
| 290 | Ga0207691_10178725 | 3300025940 | Bacteria | 1855 |
| 291 | Ga0207711_10011986 | 3300025941 | Bacteria | 7205 |
| 292 | Ga0207711_10014428 | 3300025941 | Bacteria | 6563 |
| 293 | Ga0207711_10031161 | 3300025941 | Bacteria | 4500 |
| 294 | Ga0207711_10041445 | 3300025941 | Bacteria | 3921 |
| 295 | Ga0207711_10222835 | 3300025941 | Bacteria | 1725 |
| 296 | Ga0207689_10006195 | 3300025942 | Bacteria | 10596 |
| 297 | Ga0207661_10118582 | 3300025944 | Bacteria | 2250 |
| 298 | Ga0207679_10007022 | 3300025945 | Bacteria | 7136 |
| 299 | Ga0207679_10126902 | 3300025945 | Bacteria | 2040 |
| 300 | Ga0207679_10183171 | 3300025945 | Bacteria | 1734 |
| 301 | Ga0207679_10240019 | 3300025945 | Bacteria | 1535 |
| 302 | Ga0207667_10030975 | 3300025949 | Bacteria | 5780 |
| 303 | Ga0207667_10307522 | 3300025949 | Bacteria | 1619 |
| 304 | Ga0207667_10899361 | 3300025949 | Bacteria | 877 |
| 305 | Ga0207651_10084601 | 3300025960 | Bacteria | 2298 |
| 306 | Ga0207651_10399649 | 3300025960 | Bacteria | 1169 |
| 307 | Ga0207712_10012206 | 3300025961 | Bacteria | 5488 |
| 308 | Ga0207668_10014767 | 3300025972 | Bacteria | 4840 |
| 309 | Ga0207668_10033851 | 3300025972 | Bacteria | 3388 |
| 310 | Ga0207640_10089134 | 3300025981 | Bacteria | 2131 |
| 311 | Ga0207640_10402079 | 3300025981 | Bacteria | 1116 |
| 312 | Ga0207640_10631853 | 3300025981 | Bacteria | 910 |
| 313 | Ga0207640_10939463 | 3300025981 | Bacteria | 757 |
| 314 | Ga0207658_10000510 | 3300025986 | Bacteria | 35545 |
| 315 | Ga0207658_10067112 | 3300025986 | Bacteria | 2701 |
| 316 | Ga0207658_10086504 | 3300025986 | Bacteria | 2418 |
| 317 | Ga0207658_10255718 | 3300025986 | Bacteria | 1490 |
| 318 | Ga0207658_10376149 | 3300025986 | Bacteria | 1243 |
| 319 | Ga0207677_10445572 | 3300026023 | Bacteria | 1108 |
| 320 | Ga0207677_11011019 | 3300026023 | Bacteria | 754 |
| 321 | Ga0207703_10001422 | 3300026035 | Bacteria | 21834 |
| 322 | Ga0207703_10293490 | 3300026035 | Bacteria | 1480 |
| 323 | Ga0207639_10032306 | 3300026041 | Bacteria | 3852 |
| 324 | Ga0207639_10283807 | 3300026041 | Bacteria | 1457 |
| 325 | Ga0207639_10540742 | 3300026041 | Bacteria | 1069 |
| 326 | Ga0207639_10553527 | 3300026041 | Bacteria | 1056 |
| 327 | Ga0207678_10007835 | 3300026067 | Bacteria | 9427 |
| 328 | Ga0207708_10484405 | 3300026075 | Bacteria | 1035 |
| 329 | Ga0207702_10001390 | 3300026078 | Bacteria | 24132 |
| 330 | Ga0207702_10153702 | 3300026078 | Bacteria | 2095 |
| 331 | Ga0207641_10001218 | 3300026088 | Bacteria | 25753 |
| 332 | Ga0207641_10056997 | 3300026088 | Bacteria | 3322 |
| 333 | Ga0207641_10162067 | 3300026088 | Bacteria | 2034 |
| 334 | Ga0207641_10210230 | 3300026088 | Bacteria | 1799 |
| 335 | Ga0207648_10001492 | 3300026089 | Bacteria | 25769 |
| 336 | Ga0207648_10012368 | 3300026089 | Bacteria | 7990 |
| 337 | Ga0207648_10018499 | 3300026089 | Bacteria | 6306 |
| 338 | Ga0207648_10104243 | 3300026089 | Bacteria | 2487 |
| 339 | Ga0207676_10036241 | 3300026095 | Bacteria | 3751 |
| 340 | Ga0207676_10040883 | 3300026095 | Bacteria | 3556 |
| 341 | Ga0207676_10151988 | 3300026095 | Bacteria | 1995 |
| 342 | Ga0207676_10418284 | 3300026095 | Bacteria | 1256 |
| 343 | Ga0207675_100001773 | 3300026118 | Bacteria | 21566 |
| 344 | Ga0207675_100275507 | 3300026118 | Bacteria | 1634 |
| 345 | Ga0207683_10005185 | 3300026121 | Bacteria | 11189 |
| 346 | Ga0207683_10085823 | 3300026121 | Bacteria | 2798 |
| 347 | Ga0207683_10150989 | 3300026121 | Bacteria | 2096 |
| 348 | Ga0207683_10227010 | 3300026121 | Bacteria | 1702 |
| 349 | Ga0207683_11180612 | 3300026121 | Bacteria | 709 |
| 350 | Ga0207698_10012687 | 3300026142 | Bacteria | 5526 |
| 351 | Ga0207698_10060728 | 3300026142 | Bacteria | 2941 |
| 352 | Ga0207698_10196320 | 3300026142 | Bacteria | 1803 |
| 353 | Ga0207698_10406415 | 3300026142 | Bacteria | 1303 |
| 354 | Ga0207428_10613387 | 3300027907 | Bacteria | 783 |
| 355 | Ga0268265_10005696 | 3300028380 | Bacteria | 8507 |
| 356 | Ga0268264_10028083 | 3300028381 | Bacteria | 4602 |
| 357 | Ga0268264_10192730 | 3300028381 | Bacteria | 1859 |
| 358 | Ga0268264_10988880 | 3300028381 | Bacteria | 847 |
| 359 | Ga0307416_100220057 | 3300032002 | Bacteria | 1820 |
| 360 | Ga0307414_10585342 | 3300032004 | Bacteria | 999 |
| 361 | Ga0307415_100133291 | 3300032126 | Bacteria | 1885 |
| 362 | Ga0373926_0034130 | 3300035083 | Bacteria | 1800 |
| 363 | Ga0373926_0181272 | 3300035083 | Bacteria | 808 |
| 364 | Ga0373945_0177915 | 3300035116 | Bacteria | 874 |
| 365 | Ga0373943_0026826 | 3300035170 | Bacteria | 2702 |
| 366 | Ga0373924_0020099 | 3300035410 | Bacteria | 2592 |
| 367 | Ga0373931_0069174 | 3300035691 | Bacteria | 1923 |
| 368 | Ga0373935_0112178 | 3300035692 | Bacteria | 1811 |
| 369 | Ga0373933_0161205 | 3300035724 | Bacteria | 1424 |
| 370 | Ga0373947_0088546 | 3300035725 | Bacteria | 1927 |
| 371 | Ga0373925_0026288 | 3300037068 | Bacteria | 4259 |
| 372 | Ga0373925_0336654 | 3300037068 | Bacteria | 1223 |
| 373 | Ga0395899_0003912 | 3300037312 | Bacteria | 11741 |
| 374 | Ga0395899_0011242 | 3300037312 | Bacteria | 6857 |
| 375 | Ga0395900_0001162 | 3300037418 | Bacteria | 32955 |
| 376 | Ga0395900_0020459 | 3300037418 | Bacteria | 6755 |
| 377 | Ga0395898_0003358 | 3300037466 | Bacteria | 17956 |
| 378 | Ga0395905_0004279 | 3300037471 | Bacteria | 14891 |
| 379 | Ga0395905_0238031 | 3300037471 | Bacteria | 1701 |
| 380 | Ga0395901_0011447 | 3300038443 | Bacteria | 8989 |
| 381 | Ga0395901_0175269 | 3300038443 | Bacteria | 2249 |
| 382 | Ga0439449_0027200 | 3300042007 | Bacteria | 2134 |
| 383 | Ga0451577_0000058 | 3300042876 | Bacteria | 272673 |
| 384 | Ga0453684_0000279 | 3300044712 | Bacteria | 220016 |
| 385 | Ga0466971_0093729 | 3300044719 | Bacteria | 1376 |
| 386 | Ga0466957_0035583 | 3300044842 | Bacteria | 2988 |
| 387 | Ga0451576_0001134 | 3300045051 | Bacteria | 48176 |
| 388 | Ga0466967_0005963 | 3300045976 | Bacteria | 8551 |
| 389 | Ga0495617_000030 | 3300046452 | Bacteria | 152392 |
| 390 | Ga0495627_000228 | 3300046453 | Bacteria | 59535 |
| 391 | Ga0495627_022678 | 3300046453 | Bacteria | 2063 |
| 392 | Ga0495603_0140527 | 3300046455 | Bacteria | 1405 |
| 393 | Ga0495629_0011521 | 3300046459 | Bacteria | 6423 |
| 394 | Ga0495653_0007080 | 3300046463 | Bacteria | 9199 |
| 395 | Ga0495580_0156956 | 3300046472 | Bacteria | 1575 |
| 396 | Ga0495582_0113473 | 3300046473 | Bacteria | 1523 |
| 397 | Ga0495605_0000046 | 3300046474 | Bacteria | 175985 |
| 398 | Ga0495605_0012885 | 3300046474 | Bacteria | 4627 |
| 399 | Ga0495605_0017171 | 3300046474 | Bacteria | 3903 |
| 400 | Ga0495605_0035670 | 3300046474 | Bacteria | 2512 |
| 401 | Ga0495584_0001630 | 3300046491 | Bacteria | 13194 |
| 402 | Ga0495584_0064863 | 3300046491 | Bacteria | 1836 |
| 403 | Ga0495584_0172202 | 3300046491 | Bacteria | 1100 |
| 404 | Ga0495585_0000410 | 3300046492 | Bacteria | 41579 |
| 405 | Ga0495585_0003320 | 3300046492 | Bacteria | 10923 |
| 406 | Ga0495594_0033471 | 3300046499 | Bacteria | 2794 |
| 407 | Ga0495594_0289775 | 3300046499 | Bacteria | 933 |
| 408 | Ga0495596_0000846 | 3300046500 | Bacteria | 18508 |
| 409 | Ga0495596_0005147 | 3300046500 | Bacteria | 6226 |
| 410 | Ga0495596_0005570 | 3300046500 | Bacteria | 5916 |
| 411 | Ga0495596_0019781 | 3300046500 | Bacteria | 2762 |
| 412 | Ga0495607_0001168 | 3300046501 | Bacteria | 23749 |
| 413 | Ga0495607_0052992 | 3300046501 | Bacteria | 2347 |
| 414 | Ga0495583_0000142 | 3300046506 | Bacteria | 121513 |
| 415 | Ga0495583_0007855 | 3300046506 | Bacteria | 6626 |
| 416 | Ga0495583_0012652 | 3300046506 | Bacteria | 4756 |
| 417 | Ga0495583_0023203 | 3300046506 | Bacteria | 3144 |
| 418 | Ga0495583_0143298 | 3300046506 | Bacteria | 994 |
| 419 | Ga0495606_0089051 | 3300046507 | Bacteria | 1902 |
| 420 | Ga0495616_0034366 | 3300046513 | Bacteria | 2633 |
| 421 | Ga0495616_0041717 | 3300046513 | Bacteria | 2339 |
| 422 | Ga0495616_0064515 | 3300046513 | Bacteria | 1787 |
| 423 | Ga0495630_0014901 | 3300046517 | Bacteria | 5670 |
| 424 | Ga0495631_0006519 | 3300046518 | Bacteria | 6021 |
| 425 | Ga0495631_0009677 | 3300046518 | Bacteria | 4806 |
| 426 | Ga0495631_0014950 | 3300046518 | Bacteria | 3732 |
| 427 | Ga0495631_0203581 | 3300046518 | Bacteria | 846 |
| 428 | Ga0495632_0003811 | 3300046519 | Bacteria | 10511 |
| 429 | Ga0495632_0049842 | 3300046519 | Bacteria | 2068 |
| 430 | Ga0495643_0018799 | 3300046522 | Bacteria | 4004 |
| 431 | Ga0495644_0002504 | 3300046523 | Bacteria | 7326 |
| 432 | Ga0495644_0017039 | 3300046523 | Bacteria | 2780 |
| 433 | Ga0495644_0029568 | 3300046523 | Bacteria | 2070 |
| 434 | Ga0495648_0000815 | 3300046524 | Bacteria | 32978 |
| 435 | Ga0495666_0003566 | 3300046526 | Bacteria | 7869 |
| 436 | Ga0495666_0156403 | 3300046526 | Bacteria | 1058 |
| 437 | Ga0495642_0000013 | 3300046528 | Bacteria | 123896 |
| 438 | Ga0495642_0017369 | 3300046528 | Bacteria | 2811 |
| 439 | Ga0495642_0040232 | 3300046528 | Bacteria | 1898 |
| 440 | Ga0495642_0093510 | 3300046528 | Bacteria | 1274 |
| 441 | Ga0495654_0004974 | 3300046530 | Bacteria | 7808 |
| 442 | Ga0495665_0007660 | 3300046531 | Bacteria | 5843 |
| 443 | Ga0495586_0089053 | 3300046535 | Bacteria | 1703 |
| 444 | Ga0495586_0385626 | 3300046535 | Unclassified | 806 |
| 445 | Ga0495587_0018542 | 3300046536 | Bacteria | 4316 |
| 446 | Ga0495609_0000948 | 3300046538 | Bacteria | 20986 |
| 447 | Ga0495609_0005910 | 3300046538 | Bacteria | 6324 |
| 448 | Ga0495609_0021179 | 3300046538 | Bacteria | 2999 |
| 449 | Ga0495609_0102637 | 3300046538 | Bacteria | 1238 |
| 450 | Ga0495621_0033547 | 3300046539 | Bacteria | 1770 |
| 451 | Ga0495621_0101783 | 3300046539 | Bacteria | 1094 |
| 452 | Ga0495597_0006125 | 3300046542 | Bacteria | 6258 |
| 453 | Ga0495597_0020490 | 3300046542 | Bacteria | 3079 |
| 454 | Ga0495645_0571727 | 3300046543 | Bacteria | 698 |
| 455 | Ga0495622_0094057 | 3300046557 | Bacteria | 1376 |
| 456 | Ga0495633_0037882 | 3300046558 | Bacteria | 2305 |
| 457 | Ga0495633_0045305 | 3300046558 | Bacteria | 2083 |
| 458 | Ga0495656_0150497 | 3300046615 | Bacteria | 1123 |
| 459 | Ga0495656_0166527 | 3300046615 | Bacteria | 1075 |
| 460 | Ga0495668_0000373 | 3300046616 | Bacteria | 59298 |
| 461 | Ga0495668_0046915 | 3300046616 | Bacteria | 2399 |
| 462 | Ga0495668_0134968 | 3300046616 | Bacteria | 1350 |
| 463 | Ga0495668_0162213 | 3300046616 | Bacteria | 1224 |
| 464 | Ga0495611_0011487 | 3300046648 | Bacteria | 3755 |
| 465 | Ga0495611_0049033 | 3300046648 | Bacteria | 1899 |
| 466 | Ga0495625_0006300 | 3300046660 | Bacteria | 10610 |
| 467 | Ga0495661_0009522 | 3300046665 | Bacteria | 6665 |
| 468 | Ga0495661_0013871 | 3300046665 | Bacteria | 5406 |
| 469 | Ga0495661_0024686 | 3300046665 | Bacteria | 3891 |
| 470 | Ga0495661_0056187 | 3300046665 | Bacteria | 2356 |
| 471 | Ga0495661_0065767 | 3300046665 | Bacteria | 2135 |
| 472 | Ga0495661_0272031 | 3300046665 | Bacteria | 857 |
| 473 | Ga0495588_0002056 | 3300046674 | Bacteria | 8606 |
| 474 | Ga0495623_0060908 | 3300046679 | Bacteria | 2367 |
| 475 | Ga0495658_0247497 | 3300046683 | Bacteria | 1120 |
| 476 | Ga0495669_0001491 | 3300046684 | Bacteria | 9648 |
| 477 | Ga0495669_0006852 | 3300046684 | Bacteria | 4768 |
| 478 | Ga0495669_0048252 | 3300046684 | Bacteria | 1904 |
| 479 | Ga0495613_0109696 | 3300046689 | Bacteria | 1990 |
| 480 | Ga0495613_0307319 | 3300046689 | Bacteria | 1096 |
| 481 | Ga0495624_0001290 | 3300046690 | Bacteria | 19765 |
| 482 | Ga0495670_0012853 | 3300046691 | Bacteria | 4116 |
| 483 | Ga0495670_0029128 | 3300046691 | Bacteria | 2739 |
| 484 | Ga0495671_0000989 | 3300046692 | Bacteria | 19828 |
| 485 | Ga0495589_0018014 | 3300046794 | Bacteria | 3624 |
| 486 | Ga0495589_0027534 | 3300046794 | Bacteria | 2873 |
| 487 | Ga0495600_0149738 | 3300046809 | Bacteria | 1511 |
| 488 | Ga0495660_0047873 | 3300046810 | Bacteria | 2339 |
| 489 | Ga0495581_0208481 | 3300047315 | Bacteria | 1143 |
| 490 | Ga0495604_0060867 | 3300047317 | Bacteria | 2889 |
| 491 | Ga0495604_0232047 | 3300047317 | Bacteria | 1265 |
| 492 | Ga0495672_0042963 | 3300047320 | Bacteria | 2721 |
| 493 | Ga0495672_0112700 | 3300047320 | Bacteria | 1457 |
| 494 | Ga0495676_0009654 | 3300047321 | Bacteria | 8779 |
| 495 | Ga0495676_0015149 | 3300047321 | Bacteria | 6880 |
| 496 | Ga0495676_0041025 | 3300047321 | Bacteria | 3814 |
| 497 | Ga0495676_0492953 | 3300047321 | Bacteria | 805 |
| 498 | Ga0495680_0036776 | 3300047322 | Bacteria | 3927 |
| 499 | Ga0495675_0141733 | 3300047444 | Bacteria | 1489 |
| 500 | Ga0495677_0002312 | 3300047445 | Bacteria | 7514 |
| 501 | Ga0495677_0005272 | 3300047445 | Bacteria | 4910 |
| 502 | Ga0495679_026066 | 3300047446 | Bacteria | 1946 |
| 503 | Ga0495685_076668 | 3300047447 | Bacteria | 1116 |
| 504 | Ga0495673_0007840 | 3300047469 | Bacteria | 6071 |
| 505 | Ga0495681_0009180 | 3300047470 | Bacteria | 6115 |
| 506 | Ga0495681_0012177 | 3300047470 | Bacteria | 5069 |
| 507 | Ga0495593_0006234 | 3300047673 | Bacteria | 7004 |
| 508 | Ga0495602_0012852 | 3300048088 | Bacteria | 8583 |
| 509 | Ga0495614_0103330 | 3300048089 | Bacteria | 1247 |
| 510 | Ga0495615_0003349 | 3300048090 | Bacteria | 2675 |
| 511 | Ga0495626_0001381 | 3300048091 | Bacteria | 19521 |
| 512 | Ga0495626_0002812 | 3300048091 | Bacteria | 11650 |
| 513 | Ga0495626_0006393 | 3300048091 | Bacteria | 6707 |
| 514 | Ga0495626_0009558 | 3300048091 | Bacteria | 5237 |
| 515 | Ga0495626_0027417 | 3300048091 | Bacteria | 2770 |
| 516 | Ga0495626_0028758 | 3300048091 | Bacteria | 2691 |
| 517 | Ga0495626_0040255 | 3300048091 | Bacteria | 2208 |
| 518 | Ga0496101_0606039 | 3300048904 | Bacteria | 866 |
| 519 | Ga0496102_0000231 | 3300048905 | Bacteria | 73157 |
| 520 | Ga0496102_0000943 | 3300048905 | Bacteria | 27451 |
| 521 | Ga0496102_0001702 | 3300048905 | Bacteria | 19248 |
| 522 | Ga0496102_0301316 | 3300048905 | Bacteria | 1511 |
| 523 | Ga0496103_0049971 | 3300048906 | Bacteria | 2586 |
| 524 | Ga0496103_0051518 | 3300048906 | Bacteria | 2548 |
| 525 | Ga0496103_0103977 | 3300048906 | Bacteria | 1799 |
| 526 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 527 | Ga0496104_0047410 | 3300048907 | Bacteria | 4050 |
| 528 | Ga0496105_0000106 | 3300048908 | Bacteria | 56944 |
| 529 | Ga0496105_0141427 | 3300048908 | Bacteria | 1981 |
| 530 | Ga0496105_0611819 | 3300048908 | Bacteria | 844 |
| 531 | Ga0496106_0001506 | 3300048909 | Bacteria | 17507 |
| 532 | Ga0496107_0012164 | 3300048910 | Bacteria | 6002 |
| 533 | Ga0496107_0142314 | 3300048910 | Bacteria | 1773 |
| 534 | Ga0496108_0263696 | 3300048911 | Bacteria | 1499 |
| 535 | Ga0496108_0452342 | 3300048911 | Bacteria | 1122 |
| 536 | Ga0496109_0084620 | 3300048912 | Bacteria | 2926 |
| 537 | Ga0496109_0104821 | 3300048912 | Bacteria | 2626 |
| 538 | Ga0496110_0159180 | 3300048913 | Bacteria | 2046 |
| 539 | Ga0496110_0630742 | 3300048913 | Bacteria | 971 |
| 540 | Ga0496112_0038804 | 3300048915 | Bacteria | 4652 |
| 541 | Ga0496113_0303283 | 3300048916 | Bacteria | 1279 |
| 542 | Ga0496114_0012861 | 3300048917 | Bacteria | 6703 |
| 543 | Ga0496121_0230157 | 3300048924 | Bacteria | 1299 |
| 544 | Ga0496124_0002249 | 3300048927 | Bacteria | 25656 |
| 545 | Ga0495678_007207 | 3300049459 | Bacteria | 5795 |
| 546 | Ga0495682_0014012 | 3300049460 | Bacteria | 3044 |
| 547 | Ga0495682_0051125 | 3300049460 | Bacteria | 1504 |
| 548 | Ga0501033_0105330 | 3300049570 | Bacteria | 2056 |
| 549 | Ga0501034_0002589 | 3300049571 | Bacteria | 21507 |
| 550 | Ga0501036_0214161 | 3300049572 | Bacteria | 1618 |
| 551 | Ga0501037_0218628 | 3300049573 | Bacteria | 1341 |
| 552 | Ga0501038_0196655 | 3300049574 | Bacteria | 1620 |
| 553 | Ga0501038_0483855 | 3300049574 | Bacteria | 948 |
| 554 | Ga0501039_0052036 | 3300049575 | Bacteria | 3169 |
| 555 | Ga0501039_0076109 | 3300049575 | Bacteria | 2609 |
| 556 | Ga0501040_0044724 | 3300049576 | Bacteria | 3019 |
| 557 | Ga0501041_0150614 | 3300049577 | Bacteria | 1452 |
| 558 | Ga0501043_0177384 | 3300049579 | Bacteria | 1661 |
| 559 | Ga0501046_0061483 | 3300049580 | Bacteria | 2936 |
| 560 | Ga0501046_0148497 | 3300049580 | Bacteria | 1769 |
| 561 | Ga0501048_0088350 | 3300049582 | Bacteria | 2186 |
| 562 | Ga0501068_0096756 | 3300049584 | Bacteria | 1826 |
| 563 | Ga0501071_0019978 | 3300049587 | Bacteria | 4653 |
| 564 | Ga0501071_0121639 | 3300049587 | Bacteria | 1935 |
| 565 | Ga0501072_0043830 | 3300049588 | Bacteria | 3517 |
| 566 | Ga0501074_0424267 | 3300049590 | Bacteria | 943 |
| 567 | Ga0501075_0010572 | 3300049591 | Bacteria | 6489 |
| 568 | Ga0501075_0256244 | 3300049591 | Bacteria | 1333 |
| 569 | Ga0501076_0012122 | 3300049592 | Bacteria | 6444 |
| 570 | Ga0501076_0560963 | 3300049592 | Bacteria | 942 |
| 571 | Ga0501077_0222286 | 3300049593 | Bacteria | 1200 |
| 572 | Ga0501079_0040966 | 3300049741 | Bacteria | 3574 |
| 573 | Ga0501079_0228273 | 3300049741 | Bacteria | 1454 |
| 574 | Ga0501081_0026219 | 3300049743 | Bacteria | 3928 |
| 575 | Ga0501081_0039813 | 3300049743 | Bacteria | 3217 |
| 576 | Ga0501083_0142869 | 3300049744 | Bacteria | 1567 |
| 577 | Ga0501035_0321483 | 3300049822 | Bacteria | 1300 |
| 578 | Ga0501045_0061879 | 3300049824 | Bacteria | 2746 |
| 579 | nmdc:mga05p37_16495_c1 | 3300050507 | Bacteria | 8897 |
| 580 | nmdc:mga05p37_534646_c1 | 3300050507 | Bacteria | 1338 |
| 581 | nmdc:mga05p37_75835_c1 | 3300050507 | Bacteria | 4140 |
| 582 | nmdc:mga09592_11152_c1 | 3300050508 | Bacteria | 7313 |
| 583 | nmdc:mga06r32_176363_c1 | 3300050510 | Bacteria | 2122 |
| 584 | nmdc:mga06r32_458597_c1 | 3300050510 | Bacteria | 1254 |
| 585 | nmdc:mga06r32_771_c1 | 3300050510 | Bacteria | 28266 |
| 586 | nmdc:mga0n895_233101_c1 | 3300050512 | Bacteria | 1868 |
| 587 | Ga0495612_0018286 | 3300053078 | Bacteria | 2808 |
| 588 | Ga0495619_0111174 | 3300053085 | Bacteria | 1872 |
| 589 | Ga0501084_0110106 | 3300054114 | Bacteria | 2314 |
| 590 | Ga0501082_0063082 | 3300060353 | Bacteria | 3191 |
| 591 | Ga0530510_0007515 | 3300061734 | Bacteria | 7590 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025925 | Ga0207650_10087822 | Ga0207650_100878222 | 187 |
| 2 | 3300046674 | Ga0495588_0002056 | Ga0495588_0002056_7976_8587 | 203 |
| 3 | 3300005436 | Ga0070713_100663126 | Ga0070713_1006631262 | 204 |
| 4 | 3300032002 | Ga0307416_100220057 | Ga0307416_1002200572 | 204 |
| 5 | 3300032126 | Ga0307415_100133291 | Ga0307415_1001332912 | 204 |
| 6 | 3300046535 | Ga0495586_0385626 | Ga0495586_0385626_31_645 | 204 |
| 7 | 3300035083 | Ga0373926_0181272 | Ga0373926_0181272_173_793 | 206 |
| 8 | 3300046528 | Ga0495642_0017369 | Ga0495642_0017369_1321_1959 | 212 |
| 9 | 3300005339 | Ga0070660_100322818 | Ga0070660_1003228182 | 214 |
| 10 | 3300005563 | Ga0068855_100098280 | Ga0068855_1000982803 | 214 |
| 11 | 3300005578 | Ga0068854_100544948 | Ga0068854_1005449481 | 214 |
| 12 | 3300005616 | Ga0068852_100812551 | Ga0068852_1008125512 | 214 |
| 13 | 3300005937 | Ga0081455_10061678 | Ga0081455_100616783 | 214 |
| 14 | 3300006844 | Ga0075428_100006609 | Ga0075428_1000066099 | 214 |
| 15 | 3300006844 | Ga0075428_100082937 | Ga0075428_1000829373 | 214 |
| 16 | 3300006847 | Ga0075431_100006106 | Ga0075431_1000061069 | 214 |
| 17 | 3300006847 | Ga0075431_100108401 | Ga0075431_1001084013 | 214 |
| 18 | 3300006880 | Ga0075429_100012805 | Ga0075429_1000128052 | 214 |
| 19 | 3300006881 | Ga0068865_100579843 | Ga0068865_1005798432 | 214 |
| 20 | 3300006914 | Ga0075436_100315165 | Ga0075436_1003151652 | 214 |
| 21 | 3300009147 | Ga0114129_10000005 | Ga0114129_1000000519 | 214 |
| 22 | 3300009147 | Ga0114129_10016886 | Ga0114129_100168867 | 214 |
| 23 | 3300010375 | Ga0105239_10211046 | Ga0105239_102110462 | 214 |
| 24 | 3300025909 | Ga0207705_10129201 | Ga0207705_101292012 | 214 |
| 25 | 3300025911 | Ga0207654_10017416 | Ga0207654_100174164 | 214 |
| 26 | 3300025938 | Ga0207704_10390468 | Ga0207704_103904682 | 214 |
| 27 | 3300025945 | Ga0207679_10126902 | Ga0207679_101269023 | 214 |
| 28 | 3300026142 | Ga0207698_10060728 | Ga0207698_100607282 | 214 |
| 29 | 3300037312 | Ga0395899_0003912 | Ga0395899_0003912_10756_11400 | 214 |
| 30 | 3300037312 | Ga0395899_0011242 | Ga0395899_0011242_4693_5337 | 214 |
| 31 | 3300037418 | Ga0395900_0001162 | Ga0395900_0001162_24513_25157 | 214 |
| 32 | 3300037418 | Ga0395900_0020459 | Ga0395900_0020459_4947_5591 | 214 |
| 33 | 3300037466 | Ga0395898_0003358 | Ga0395898_0003358_11252_11896 | 214 |
| 34 | 3300037471 | Ga0395905_0004279 | Ga0395905_0004279_7476_8120 | 214 |
| 35 | 3300037471 | Ga0395905_0238031 | Ga0395905_0238031_959_1603 | 214 |
| 36 | 3300038443 | Ga0395901_0011447 | Ga0395901_0011447_6989_7633 | 214 |
| 37 | 3300038443 | Ga0395901_0175269 | Ga0395901_0175269_536_1180 | 214 |
| 38 | 3300042007 | Ga0439449_0027200 | Ga0439449_0027200_1429_2073 | 214 |
| 39 | 3300042876 | Ga0451577_0000058 | Ga0451577_0000058_50172_50816 | 214 |
| 40 | 3300044712 | Ga0453684_0000279 | Ga0453684_0000279_146829_147473 | 214 |
| 41 | 3300044719 | Ga0466971_0093729 | Ga0466971_0093729_466_1110 | 214 |
| 42 | 3300044842 | Ga0466957_0035583 | Ga0466957_0035583_731_1375 | 214 |
| 43 | 3300045051 | Ga0451576_0001134 | Ga0451576_0001134_40367_41011 | 214 |
| 44 | 3300045976 | Ga0466967_0005963 | Ga0466967_0005963_3784_4428 | 214 |
| 45 | 3300046452 | Ga0495617_000030 | Ga0495617_000030_116666_117310 | 214 |
| 46 | 3300046453 | Ga0495627_000228 | Ga0495627_000228_23805_24449 | 214 |
| 47 | 3300046459 | Ga0495629_0011521 | Ga0495629_0011521_45_689 | 214 |
| 48 | 3300046463 | Ga0495653_0007080 | Ga0495653_0007080_5982_6626 | 214 |
| 49 | 3300046472 | Ga0495580_0156956 | Ga0495580_0156956_724_1368 | 214 |
| 50 | 3300046473 | Ga0495582_0113473 | Ga0495582_0113473_688_1332 | 214 |
| 51 | 3300046474 | Ga0495605_0000046 | Ga0495605_0000046_140259_140903 | 214 |
| 52 | 3300046474 | Ga0495605_0012885 | Ga0495605_0012885_1737_2381 | 214 |
| 53 | 3300046474 | Ga0495605_0017171 | Ga0495605_0017171_1509_2153 | 214 |
| 54 | 3300046474 | Ga0495605_0035670 | Ga0495605_0035670_742_1386 | 214 |
| 55 | 3300046491 | Ga0495584_0001630 | Ga0495584_0001630_12326_12970 | 214 |
| 56 | 3300046491 | Ga0495584_0172202 | Ga0495584_0172202_373_1017 | 214 |
| 57 | 3300046492 | Ga0495585_0000410 | Ga0495585_0000410_14022_14666 | 214 |
| 58 | 3300046500 | Ga0495596_0000846 | Ga0495596_0000846_9438_10082 | 214 |
| 59 | 3300046500 | Ga0495596_0019781 | Ga0495596_0019781_588_1232 | 214 |
| 60 | 3300046501 | Ga0495607_0001168 | Ga0495607_0001168_16603_17247 | 214 |
| 61 | 3300046506 | Ga0495583_0000142 | Ga0495583_0000142_3403_4047 | 214 |
| 62 | 3300046506 | Ga0495583_0007855 | Ga0495583_0007855_1319_1963 | 214 |
| 63 | 3300046506 | Ga0495583_0012652 | Ga0495583_0012652_1531_2175 | 214 |
| 64 | 3300046506 | Ga0495583_0023203 | Ga0495583_0023203_1835_2479 | 214 |
| 65 | 3300046507 | Ga0495606_0089051 | Ga0495606_0089051_90_734 | 214 |
| 66 | 3300046513 | Ga0495616_0034366 | Ga0495616_0034366_81_725 | 214 |
| 67 | 3300046513 | Ga0495616_0041717 | Ga0495616_0041717_165_809 | 214 |
| 68 | 3300046513 | Ga0495616_0064515 | Ga0495616_0064515_161_805 | 214 |
| 69 | 3300046517 | Ga0495630_0014901 | Ga0495630_0014901_3562_4206 | 214 |
| 70 | 3300046518 | Ga0495631_0014950 | Ga0495631_0014950_2699_3343 | 214 |
| 71 | 3300046518 | Ga0495631_0203581 | Ga0495631_0203581_98_742 | 214 |
| 72 | 3300046519 | Ga0495632_0003811 | Ga0495632_0003811_5809_6453 | 214 |
| 73 | 3300046519 | Ga0495632_0049842 | Ga0495632_0049842_592_1236 | 214 |
| 74 | 3300046523 | Ga0495644_0002504 | Ga0495644_0002504_6561_7205 | 214 |
| 75 | 3300046523 | Ga0495644_0017039 | Ga0495644_0017039_229_873 | 214 |
| 76 | 3300046524 | Ga0495648_0000815 | Ga0495648_0000815_16698_17342 | 214 |
| 77 | 3300046526 | Ga0495666_0003566 | Ga0495666_0003566_2554_3198 | 214 |
| 78 | 3300046526 | Ga0495666_0156403 | Ga0495666_0156403_385_1029 | 214 |
| 79 | 3300046528 | Ga0495642_0000013 | Ga0495642_0000013_31689_32333 | 214 |
| 80 | 3300046528 | Ga0495642_0093510 | Ga0495642_0093510_56_700 | 214 |
| 81 | 3300046530 | Ga0495654_0004974 | Ga0495654_0004974_6432_7076 | 214 |
| 82 | 3300046531 | Ga0495665_0007660 | Ga0495665_0007660_4624_5268 | 214 |
| 83 | 3300046538 | Ga0495609_0000948 | Ga0495609_0000948_184_828 | 214 |
| 84 | 3300046538 | Ga0495609_0005910 | Ga0495609_0005910_2155_2799 | 214 |
| 85 | 3300046538 | Ga0495609_0021179 | Ga0495609_0021179_880_1524 | 214 |
| 86 | 3300046538 | Ga0495609_0102637 | Ga0495609_0102637_582_1226 | 214 |
| 87 | 3300046542 | Ga0495597_0006125 | Ga0495597_0006125_5513_6157 | 214 |
| 88 | 3300046542 | Ga0495597_0020490 | Ga0495597_0020490_1062_1706 | 214 |
| 89 | 3300046558 | Ga0495633_0037882 | Ga0495633_0037882_813_1457 | 214 |
| 90 | 3300046558 | Ga0495633_0045305 | Ga0495633_0045305_1415_2059 | 214 |
| 91 | 3300046615 | Ga0495656_0150497 | Ga0495656_0150497_353_997 | 214 |
| 92 | 3300046616 | Ga0495668_0000373 | Ga0495668_0000373_23819_24463 | 214 |
| 93 | 3300046616 | Ga0495668_0134968 | Ga0495668_0134968_206_850 | 214 |
| 94 | 3300046616 | Ga0495668_0162213 | Ga0495668_0162213_64_708 | 214 |
| 95 | 3300046648 | Ga0495611_0049033 | Ga0495611_0049033_14_658 | 214 |
| 96 | 3300046660 | Ga0495625_0006300 | Ga0495625_0006300_1950_2594 | 214 |
| 97 | 3300046665 | Ga0495661_0009522 | Ga0495661_0009522_726_1370 | 214 |
| 98 | 3300046665 | Ga0495661_0013871 | Ga0495661_0013871_3384_4028 | 214 |
| 99 | 3300046665 | Ga0495661_0024686 | Ga0495661_0024686_3234_3878 | 214 |
| 100 | 3300046665 | Ga0495661_0065767 | Ga0495661_0065767_917_1561 | 214 |
| 101 | 3300046665 | Ga0495661_0272031 | Ga0495661_0272031_181_825 | 214 |
| 102 | 3300046679 | Ga0495623_0060908 | Ga0495623_0060908_1664_2308 | 214 |
| 103 | 3300046684 | Ga0495669_0006852 | Ga0495669_0006852_3068_3712 | 214 |
| 104 | 3300046684 | Ga0495669_0048252 | Ga0495669_0048252_1012_1656 | 214 |
| 105 | 3300046689 | Ga0495613_0307319 | Ga0495613_0307319_406_1050 | 214 |
| 106 | 3300046690 | Ga0495624_0001290 | Ga0495624_0001290_12195_12839 | 214 |
| 107 | 3300046691 | Ga0495670_0012853 | Ga0495670_0012853_1396_2040 | 214 |
| 108 | 3300046691 | Ga0495670_0029128 | Ga0495670_0029128_1871_2515 | 214 |
| 109 | 3300046692 | Ga0495671_0000989 | Ga0495671_0000989_373_1017 | 214 |
| 110 | 3300046794 | Ga0495589_0018014 | Ga0495589_0018014_1070_1714 | 214 |
| 111 | 3300046794 | Ga0495589_0027534 | Ga0495589_0027534_844_1488 | 214 |
| 112 | 3300046809 | Ga0495600_0149738 | Ga0495600_0149738_689_1333 | 214 |
| 113 | 3300046810 | Ga0495660_0047873 | Ga0495660_0047873_705_1349 | 214 |
| 114 | 3300047317 | Ga0495604_0060867 | Ga0495604_0060867_484_1128 | 214 |
| 115 | 3300047320 | Ga0495672_0042963 | Ga0495672_0042963_351_995 | 214 |
| 116 | 3300047321 | Ga0495676_0009654 | Ga0495676_0009654_4538_5182 | 214 |
| 117 | 3300047444 | Ga0495675_0141733 | Ga0495675_0141733_404_1048 | 214 |
| 118 | 3300047445 | Ga0495677_0002312 | Ga0495677_0002312_6131_6775 | 214 |
| 119 | 3300047445 | Ga0495677_0005272 | Ga0495677_0005272_2939_3583 | 214 |
| 120 | 3300047447 | Ga0495685_076668 | Ga0495685_076668_38_682 | 214 |
| 121 | 3300047470 | Ga0495681_0009180 | Ga0495681_0009180_3412_4056 | 214 |
| 122 | 3300047470 | Ga0495681_0012177 | Ga0495681_0012177_3042_3686 | 214 |
| 123 | 3300047673 | Ga0495593_0006234 | Ga0495593_0006234_6047_6691 | 214 |
| 124 | 3300048088 | Ga0495602_0012852 | Ga0495602_0012852_488_1132 | 214 |
| 125 | 3300048089 | Ga0495614_0103330 | Ga0495614_0103330_379_1023 | 214 |
| 126 | 3300048090 | Ga0495615_0003349 | Ga0495615_0003349_469_1113 | 214 |
| 127 | 3300048091 | Ga0495626_0001381 | Ga0495626_0001381_13575_14219 | 214 |
| 128 | 3300048091 | Ga0495626_0002812 | Ga0495626_0002812_7144_7788 | 214 |
| 129 | 3300048091 | Ga0495626_0009558 | Ga0495626_0009558_2840_3484 | 214 |
| 130 | 3300048091 | Ga0495626_0027417 | Ga0495626_0027417_482_1126 | 214 |
| 131 | 3300048091 | Ga0495626_0040255 | Ga0495626_0040255_114_758 | 214 |
| 132 | 3300048905 | Ga0496102_0000231 | Ga0496102_0000231_63183_63827 | 214 |
| 133 | 3300048905 | Ga0496102_0000943 | Ga0496102_0000943_17519_18163 | 214 |
| 134 | 3300048906 | Ga0496103_0049971 | Ga0496103_0049971_1887_2531 | 214 |
| 135 | 3300048906 | Ga0496103_0051518 | Ga0496103_0051518_326_970 | 214 |
| 136 | 3300048906 | Ga0496103_0103977 | Ga0496103_0103977_790_1434 | 214 |
| 137 | 3300048924 | Ga0496121_0230157 | Ga0496121_0230157_403_1047 | 214 |
| 138 | 3300049459 | Ga0495678_007207 | Ga0495678_007207_676_1320 | 214 |
| 139 | 3300049460 | Ga0495682_0014012 | Ga0495682_0014012_23_667 | 214 |
| 140 | 3300050507 | nmdc:mga05p37_16495_c1 | nmdc:mga05p37_16495_c1_4801_5445 | 214 |
| 141 | 3300050507 | nmdc:mga05p37_75835_c1 | nmdc:mga05p37_75835_c1_3217_3861 | 214 |
| 142 | 3300050508 | nmdc:mga09592_11152_c1 | nmdc:mga09592_11152_c1_6261_6905 | 214 |
| 143 | 3300050510 | nmdc:mga06r32_176363_c1 | nmdc:mga06r32_176363_c1_185_829 | 214 |
| 144 | 3300050510 | nmdc:mga06r32_771_c1 | nmdc:mga06r32_771_c1_17376_18020 | 214 |
| 145 | 3300005293 | Ga0065715_10013140 | Ga0065715_100131403 | 215 |
| 146 | 3300005293 | Ga0065715_10134779 | Ga0065715_101347791 | 215 |
| 147 | 3300005328 | Ga0070676_10000101 | Ga0070676_1000010114 | 215 |
| 148 | 3300005328 | Ga0070676_10069411 | Ga0070676_100694111 | 215 |
| 149 | 3300005328 | Ga0070676_10262405 | Ga0070676_102624052 | 215 |
| 150 | 3300005330 | Ga0070690_100008126 | Ga0070690_1000081266 | 215 |
| 151 | 3300005330 | Ga0070690_100300570 | Ga0070690_1003005702 | 215 |
| 152 | 3300005331 | Ga0070670_100044711 | Ga0070670_1000447113 | 215 |
| 153 | 3300005331 | Ga0070670_100198719 | Ga0070670_1001987191 | 215 |
| 154 | 3300005331 | Ga0070670_100247343 | Ga0070670_1002473432 | 215 |
| 155 | 3300005331 | Ga0070670_100256607 | Ga0070670_1002566073 | 215 |
| 156 | 3300005331 | Ga0070670_100354683 | Ga0070670_1003546832 | 215 |
| 157 | 3300005331 | Ga0070670_100722074 | Ga0070670_1007220741 | 215 |
| 158 | 3300005333 | Ga0070677_10023693 | Ga0070677_100236934 | 215 |
| 159 | 3300005333 | Ga0070677_10169596 | Ga0070677_101695962 | 215 |
| 160 | 3300005333 | Ga0070677_10224284 | Ga0070677_102242841 | 215 |
| 161 | 3300005334 | Ga0068869_100004676 | Ga0068869_1000046767 | 215 |
| 162 | 3300005334 | Ga0068869_100296818 | Ga0068869_1002968181 | 215 |
| 163 | 3300005335 | Ga0070666_10006335 | Ga0070666_100063357 | 215 |
| 164 | 3300005335 | Ga0070666_10103994 | Ga0070666_101039942 | 215 |
| 165 | 3300005335 | Ga0070666_10354842 | Ga0070666_103548422 | 215 |
| 166 | 3300005337 | Ga0070682_100071815 | Ga0070682_1000718152 | 215 |
| 167 | 3300005338 | Ga0068868_100194263 | Ga0068868_1001942632 | 215 |
| 168 | 3300005338 | Ga0068868_100337060 | Ga0068868_1003370602 | 215 |
| 169 | 3300005344 | Ga0070661_100020975 | Ga0070661_1000209752 | 215 |
| 170 | 3300005344 | Ga0070661_100085741 | Ga0070661_1000857412 | 215 |
| 171 | 3300005344 | Ga0070661_100285316 | Ga0070661_1002853162 | 215 |
| 172 | 3300005347 | Ga0070668_100003342 | Ga0070668_1000033429 | 215 |
| 173 | 3300005347 | Ga0070668_100056117 | Ga0070668_1000561172 | 215 |
| 174 | 3300005347 | Ga0070668_100117206 | Ga0070668_1001172062 | 215 |
| 175 | 3300005347 | Ga0070668_100759510 | Ga0070668_1007595101 | 215 |
| 176 | 3300005353 | Ga0070669_100000736 | Ga0070669_1000007364 | 215 |
| 177 | 3300005353 | Ga0070669_100031072 | Ga0070669_1000310722 | 215 |
| 178 | 3300005353 | Ga0070669_100210501 | Ga0070669_1002105012 | 215 |
| 179 | 3300005353 | Ga0070669_100857577 | Ga0070669_1008575771 | 215 |
| 180 | 3300005354 | Ga0070675_100046723 | Ga0070675_1000467234 | 215 |
| 181 | 3300005354 | Ga0070675_100125332 | Ga0070675_1001253323 | 215 |
| 182 | 3300005354 | Ga0070675_100599912 | Ga0070675_1005999121 | 215 |
| 183 | 3300005355 | Ga0070671_100008194 | Ga0070671_1000081945 | 215 |
| 184 | 3300005355 | Ga0070671_100010572 | Ga0070671_1000105726 | 215 |
| 185 | 3300005355 | Ga0070671_100031962 | Ga0070671_1000319623 | 215 |
| 186 | 3300005355 | Ga0070671_100110104 | Ga0070671_1001101043 | 215 |
| 187 | 3300005355 | Ga0070671_100127658 | Ga0070671_1001276582 | 215 |
| 188 | 3300005356 | Ga0070674_100001055 | Ga0070674_1000010557 | 215 |
| 189 | 3300005356 | Ga0070674_100057821 | Ga0070674_1000578213 | 215 |
| 190 | 3300005364 | Ga0070673_100059057 | Ga0070673_1000590571 | 215 |
| 191 | 3300005366 | Ga0070659_100002514 | Ga0070659_1000025147 | 215 |
| 192 | 3300005367 | Ga0070667_100000911 | Ga0070667_10000091113 | 215 |
| 193 | 3300005434 | Ga0070709_10008851 | Ga0070709_100088514 | 215 |
| 194 | 3300005436 | Ga0070713_100054486 | Ga0070713_1000544863 | 215 |
| 195 | 3300005439 | Ga0070711_100853846 | Ga0070711_1008538461 | 215 |
| 196 | 3300005441 | Ga0070700_100717075 | Ga0070700_1007170751 | 215 |
| 197 | 3300005455 | Ga0070663_100009320 | Ga0070663_1000093202 | 215 |
| 198 | 3300005456 | Ga0070678_100023877 | Ga0070678_1000238775 | 215 |
| 199 | 3300005456 | Ga0070678_100050825 | Ga0070678_1000508253 | 215 |
| 200 | 3300005456 | Ga0070678_100064684 | Ga0070678_1000646842 | 215 |
| 201 | 3300005456 | Ga0070678_100124271 | Ga0070678_1001242712 | 215 |
| 202 | 3300005456 | Ga0070678_101041507 | Ga0070678_1010415071 | 215 |
| 203 | 3300005457 | Ga0070662_100000248 | Ga0070662_10000024821 | 215 |
| 204 | 3300005457 | Ga0070662_100009651 | Ga0070662_1000096515 | 215 |
| 205 | 3300005457 | Ga0070662_100032471 | Ga0070662_1000324715 | 215 |
| 206 | 3300005457 | Ga0070662_100186094 | Ga0070662_1001860942 | 215 |
| 207 | 3300005457 | Ga0070662_100279826 | Ga0070662_1002798262 | 215 |
| 208 | 3300005458 | Ga0070681_10008343 | Ga0070681_100083433 | 215 |
| 209 | 3300005459 | Ga0068867_100002478 | Ga0068867_1000024786 | 215 |
| 210 | 3300005459 | Ga0068867_100006095 | Ga0068867_1000060953 | 215 |
| 211 | 3300005459 | Ga0068867_100018802 | Ga0068867_1000188023 | 215 |
| 212 | 3300005459 | Ga0068867_100161639 | Ga0068867_1001616391 | 215 |
| 213 | 3300005466 | Ga0070685_10681668 | Ga0070685_106816681 | 215 |
| 214 | 3300005530 | Ga0070679_100486878 | Ga0070679_1004868782 | 215 |
| 215 | 3300005539 | Ga0068853_100130371 | Ga0068853_1001303713 | 215 |
| 216 | 3300005539 | Ga0068853_100142181 | Ga0068853_1001421813 | 215 |
| 217 | 3300005539 | Ga0068853_100504936 | Ga0068853_1005049362 | 215 |
| 218 | 3300005543 | Ga0070672_100000298 | Ga0070672_10000029812 | 215 |
| 219 | 3300005543 | Ga0070672_100006518 | Ga0070672_1000065185 | 215 |
| 220 | 3300005543 | Ga0070672_100205852 | Ga0070672_1002058521 | 215 |
| 221 | 3300005543 | Ga0070672_100240126 | Ga0070672_1002401261 | 215 |
| 222 | 3300005543 | Ga0070672_100253803 | Ga0070672_1002538032 | 215 |
| 223 | 3300005544 | Ga0070686_100068904 | Ga0070686_1000689042 | 215 |
| 224 | 3300005544 | Ga0070686_100671238 | Ga0070686_1006712381 | 215 |
| 225 | 3300005546 | Ga0070696_100780467 | Ga0070696_1007804671 | 215 |
| 226 | 3300005547 | Ga0070693_100187682 | Ga0070693_1001876821 | 215 |
| 227 | 3300005547 | Ga0070693_100629414 | Ga0070693_1006294141 | 215 |
| 228 | 3300005563 | Ga0068855_100001259 | Ga0068855_1000012596 | 215 |
| 229 | 3300005563 | Ga0068855_100027568 | Ga0068855_1000275686 | 215 |
| 230 | 3300005563 | Ga0068855_100284887 | Ga0068855_1002848873 | 215 |
| 231 | 3300005564 | Ga0070664_100008908 | Ga0070664_1000089085 | 215 |
| 232 | 3300005564 | Ga0070664_100168234 | Ga0070664_1001682342 | 215 |
| 233 | 3300005564 | Ga0070664_100314562 | Ga0070664_1003145622 | 215 |
| 234 | 3300005578 | Ga0068854_100036313 | Ga0068854_1000363134 | 215 |
| 235 | 3300005578 | Ga0068854_100192026 | Ga0068854_1001920262 | 215 |
| 236 | 3300005614 | Ga0068856_100000181 | Ga0068856_10000018119 | 215 |
| 237 | 3300005614 | Ga0068856_100004921 | Ga0068856_1000049215 | 215 |
| 238 | 3300005616 | Ga0068852_100003271 | Ga0068852_1000032719 | 215 |
| 239 | 3300005616 | Ga0068852_100152745 | Ga0068852_1001527453 | 215 |
| 240 | 3300005617 | Ga0068859_100264425 | Ga0068859_1002644251 | 215 |
| 241 | 3300005617 | Ga0068859_100878201 | Ga0068859_1008782011 | 215 |
| 242 | 3300005618 | Ga0068864_100041050 | Ga0068864_1000410502 | 215 |
| 243 | 3300005618 | Ga0068864_100045250 | Ga0068864_1000452504 | 215 |
| 244 | 3300005618 | Ga0068864_100525156 | Ga0068864_1005251562 | 215 |
| 245 | 3300005718 | Ga0068866_10002517 | Ga0068866_100025177 | 215 |
| 246 | 3300005718 | Ga0068866_10218516 | Ga0068866_102185162 | 215 |
| 247 | 3300005719 | Ga0068861_100003452 | Ga0068861_10000345210 | 215 |
| 248 | 3300005719 | Ga0068861_100281770 | Ga0068861_1002817702 | 215 |
| 249 | 3300005834 | Ga0068851_10018572 | Ga0068851_100185724 | 215 |
| 250 | 3300005834 | Ga0068851_10082638 | Ga0068851_100826381 | 215 |
| 251 | 3300005840 | Ga0068870_10208625 | Ga0068870_102086252 | 215 |
| 252 | 3300005841 | Ga0068863_100000830 | Ga0068863_10000083015 | 215 |
| 253 | 3300005841 | Ga0068863_100022362 | Ga0068863_1000223625 | 215 |
| 254 | 3300005841 | Ga0068863_100226153 | Ga0068863_1002261532 | 215 |
| 255 | 3300005841 | Ga0068863_100256032 | Ga0068863_1002560322 | 215 |
| 256 | 3300005841 | Ga0068863_100724234 | Ga0068863_1007242341 | 215 |
| 257 | 3300005841 | Ga0068863_100872110 | Ga0068863_1008721101 | 215 |
| 258 | 3300005842 | Ga0068858_100001155 | Ga0068858_10000115513 | 215 |
| 259 | 3300005842 | Ga0068858_100086524 | Ga0068858_1000865243 | 215 |
| 260 | 3300005842 | Ga0068858_100302774 | Ga0068858_1003027742 | 215 |
| 261 | 3300005843 | Ga0068860_100000796 | Ga0068860_10000079621 | 215 |
| 262 | 3300005843 | Ga0068860_100189421 | Ga0068860_1001894212 | 215 |
| 263 | 3300005844 | Ga0068862_100037681 | Ga0068862_1000376814 | 215 |
| 264 | 3300005937 | Ga0081455_10468054 | Ga0081455_104680541 | 215 |
| 265 | 3300005983 | Ga0081540_1036258 | Ga0081540_10362582 | 215 |
| 266 | 3300006028 | Ga0070717_10482741 | Ga0070717_104827412 | 215 |
| 267 | 3300006175 | Ga0070712_100076186 | Ga0070712_1000761863 | 215 |
| 268 | 3300006175 | Ga0070712_100333352 | Ga0070712_1003333522 | 215 |
| 269 | 3300006237 | Ga0097621_100178113 | Ga0097621_1001781133 | 215 |
| 270 | 3300006237 | Ga0097621_100263886 | Ga0097621_1002638862 | 215 |
| 271 | 3300006237 | Ga0097621_100525600 | Ga0097621_1005256001 | 215 |
| 272 | 3300006358 | Ga0068871_100014907 | Ga0068871_1000149077 | 215 |
| 273 | 3300006358 | Ga0068871_100158590 | Ga0068871_1001585901 | 215 |
| 274 | 3300006871 | Ga0075434_100289431 | Ga0075434_1002894312 | 215 |
| 275 | 3300006881 | Ga0068865_100001586 | Ga0068865_1000015862 | 215 |
| 276 | 3300006881 | Ga0068865_100007519 | Ga0068865_1000075192 | 215 |
| 277 | 3300006881 | Ga0068865_100126883 | Ga0068865_1001268832 | 215 |
| 278 | 3300006881 | Ga0068865_100244733 | Ga0068865_1002447331 | 215 |
| 279 | 3300006881 | Ga0068865_100423017 | Ga0068865_1004230172 | 215 |
| 280 | 3300006931 | Ga0097620_100264407 | Ga0097620_1002644072 | 215 |
| 281 | 3300006931 | Ga0097620_100878241 | Ga0097620_1008782411 | 215 |
| 282 | 3300009094 | Ga0111539_10549676 | Ga0111539_105496762 | 215 |
| 283 | 3300009094 | Ga0111539_10676348 | Ga0111539_106763481 | 215 |
| 284 | 3300009147 | Ga0114129_10474476 | Ga0114129_104744762 | 215 |
| 285 | 3300009148 | Ga0105243_10014891 | Ga0105243_100148915 | 215 |
| 286 | 3300009174 | Ga0105241_10120373 | Ga0105241_101203733 | 215 |
| 287 | 3300009176 | Ga0105242_10018254 | Ga0105242_100182544 | 215 |
| 288 | 3300009176 | Ga0105242_10024340 | Ga0105242_100243405 | 215 |
| 289 | 3300009176 | Ga0105242_10573080 | Ga0105242_105730802 | 215 |
| 290 | 3300009177 | Ga0105248_10007457 | Ga0105248_100074578 | 215 |
| 291 | 3300009177 | Ga0105248_10035717 | Ga0105248_100357174 | 215 |
| 292 | 3300009177 | Ga0105248_10040894 | Ga0105248_100408944 | 215 |
| 293 | 3300009177 | Ga0105248_10093743 | Ga0105248_100937432 | 215 |
| 294 | 3300009177 | Ga0105248_10501479 | Ga0105248_105014792 | 215 |
| 295 | 3300009177 | Ga0105248_10775716 | Ga0105248_107757161 | 215 |
| 296 | 3300009551 | Ga0105238_10156942 | Ga0105238_101569423 | 215 |
| 297 | 3300009553 | Ga0105249_10031876 | Ga0105249_100318766 | 215 |
| 298 | 3300009553 | Ga0105249_10232531 | Ga0105249_102325312 | 215 |
| 299 | 3300011119 | Ga0105246_10464190 | Ga0105246_104641902 | 215 |
| 300 | 3300011119 | Ga0105246_10466640 | Ga0105246_104666402 | 215 |
| 301 | 3300013102 | Ga0157371_10000221 | Ga0157371_1000022113 | 215 |
| 302 | 3300013104 | Ga0157370_10048936 | Ga0157370_100489365 | 215 |
| 303 | 3300013104 | Ga0157370_10155262 | Ga0157370_101552622 | 215 |
| 304 | 3300013104 | Ga0157370_10244033 | Ga0157370_102440331 | 215 |
| 305 | 3300013105 | Ga0157369_10021715 | Ga0157369_100217157 | 215 |
| 306 | 3300013105 | Ga0157369_10169159 | Ga0157369_101691593 | 215 |
| 307 | 3300013105 | Ga0157369_10567331 | Ga0157369_105673312 | 215 |
| 308 | 3300013296 | Ga0157374_10145614 | Ga0157374_101456143 | 215 |
| 309 | 3300013296 | Ga0157374_10290105 | Ga0157374_102901052 | 215 |
| 310 | 3300013306 | Ga0163162_10004930 | Ga0163162_100049309 | 215 |
| 311 | 3300013306 | Ga0163162_10016912 | Ga0163162_100169127 | 215 |
| 312 | 3300013306 | Ga0163162_10102989 | Ga0163162_101029892 | 215 |
| 313 | 3300013306 | Ga0163162_10112431 | Ga0163162_101124312 | 215 |
| 314 | 3300013306 | Ga0163162_10198646 | Ga0163162_101986463 | 215 |
| 315 | 3300013306 | Ga0163162_10386687 | Ga0163162_103866872 | 215 |
| 316 | 3300013307 | Ga0157372_10000546 | Ga0157372_100005464 | 215 |
| 317 | 3300013307 | Ga0157372_10045693 | Ga0157372_100456932 | 215 |
| 318 | 3300013308 | Ga0157375_10001027 | Ga0157375_100010276 | 215 |
| 319 | 3300013308 | Ga0157375_10009764 | Ga0157375_100097648 | 215 |
| 320 | 3300013308 | Ga0157375_10014497 | Ga0157375_100144972 | 215 |
| 321 | 3300013308 | Ga0157375_10037005 | Ga0157375_100370054 | 215 |
| 322 | 3300013308 | Ga0157375_10119027 | Ga0157375_101190273 | 215 |
| 323 | 3300013308 | Ga0157375_10275507 | Ga0157375_102755071 | 215 |
| 324 | 3300014325 | Ga0163163_10237752 | Ga0163163_102377522 | 215 |
| 325 | 3300014325 | Ga0163163_10675326 | Ga0163163_106753263 | 215 |
| 326 | 3300014326 | Ga0157380_10000360 | Ga0157380_1000036012 | 215 |
| 327 | 3300014326 | Ga0157380_10393696 | Ga0157380_103936962 | 215 |
| 328 | 3300014745 | Ga0157377_10192749 | Ga0157377_101927493 | 215 |
| 329 | 3300014968 | Ga0157379_10020533 | Ga0157379_100205334 | 215 |
| 330 | 3300014968 | Ga0157379_10160371 | Ga0157379_101603712 | 215 |
| 331 | 3300014968 | Ga0157379_10347311 | Ga0157379_103473112 | 215 |
| 332 | 3300014968 | Ga0157379_10375481 | Ga0157379_103754812 | 215 |
| 333 | 3300014969 | Ga0157376_10382129 | Ga0157376_103821291 | 215 |
| 334 | 3300014969 | Ga0157376_10522774 | Ga0157376_105227742 | 215 |
| 335 | 3300014969 | Ga0157376_10579637 | Ga0157376_105796372 | 215 |
| 336 | 3300017792 | Ga0163161_10001228 | Ga0163161_1000122810 | 215 |
| 337 | 3300017792 | Ga0163161_10107246 | Ga0163161_101072462 | 215 |
| 338 | 3300017792 | Ga0163161_10173461 | Ga0163161_101734612 | 215 |
| 339 | 3300017792 | Ga0163161_10193158 | Ga0163161_101931582 | 215 |
| 340 | 3300017792 | Ga0163161_10373089 | Ga0163161_103730892 | 215 |
| 341 | 3300025298 | Ga0209050_1004532 | Ga0209050_10045328 | 215 |
| 342 | 3300025315 | Ga0207697_10005006 | Ga0207697_100050062 | 215 |
| 343 | 3300025315 | Ga0207697_10006847 | Ga0207697_100068475 | 215 |
| 344 | 3300025321 | Ga0207656_10013551 | Ga0207656_100135512 | 215 |
| 345 | 3300025893 | Ga0207682_10004587 | Ga0207682_100045872 | 215 |
| 346 | 3300025893 | Ga0207682_10011771 | Ga0207682_100117714 | 215 |
| 347 | 3300025893 | Ga0207682_10245730 | Ga0207682_102457302 | 215 |
| 348 | 3300025899 | Ga0207642_10013803 | Ga0207642_100138033 | 215 |
| 349 | 3300025901 | Ga0207688_10075148 | Ga0207688_100751481 | 215 |
| 350 | 3300025903 | Ga0207680_10041824 | Ga0207680_100418244 | 215 |
| 351 | 3300025903 | Ga0207680_10053775 | Ga0207680_100537752 | 215 |
| 352 | 3300025904 | Ga0207647_10072400 | Ga0207647_100724001 | 215 |
| 353 | 3300025907 | Ga0207645_10004531 | Ga0207645_100045314 | 215 |
| 354 | 3300025907 | Ga0207645_10025878 | Ga0207645_100258785 | 215 |
| 355 | 3300025909 | Ga0207705_10399820 | Ga0207705_103998201 | 215 |
| 356 | 3300025911 | Ga0207654_10135919 | Ga0207654_101359192 | 215 |
| 357 | 3300025912 | Ga0207707_10077924 | Ga0207707_100779243 | 215 |
| 358 | 3300025912 | Ga0207707_10140700 | Ga0207707_101407002 | 215 |
| 359 | 3300025915 | Ga0207693_10010583 | Ga0207693_100105832 | 215 |
| 360 | 3300025915 | Ga0207693_10122785 | Ga0207693_101227852 | 215 |
| 361 | 3300025916 | Ga0207663_10067944 | Ga0207663_100679442 | 215 |
| 362 | 3300025917 | Ga0207660_10069384 | Ga0207660_100693842 | 215 |
| 363 | 3300025918 | Ga0207662_10009408 | Ga0207662_100094086 | 215 |
| 364 | 3300025919 | Ga0207657_10000596 | Ga0207657_1000059627 | 215 |
| 365 | 3300025919 | Ga0207657_10099266 | Ga0207657_100992663 | 215 |
| 366 | 3300025920 | Ga0207649_10003941 | Ga0207649_100039415 | 215 |
| 367 | 3300025920 | Ga0207649_10115964 | Ga0207649_101159642 | 215 |
| 368 | 3300025920 | Ga0207649_10235457 | Ga0207649_102354572 | 215 |
| 369 | 3300025920 | Ga0207649_10552266 | Ga0207649_105522662 | 215 |
| 370 | 3300025921 | Ga0207652_10243405 | Ga0207652_102434051 | 215 |
| 371 | 3300025923 | Ga0207681_10000592 | Ga0207681_1000059211 | 215 |
| 372 | 3300025923 | Ga0207681_10013076 | Ga0207681_100130764 | 215 |
| 373 | 3300025923 | Ga0207681_10065318 | Ga0207681_100653184 | 215 |
| 374 | 3300025925 | Ga0207650_10010191 | Ga0207650_100101914 | 215 |
| 375 | 3300025925 | Ga0207650_10084049 | Ga0207650_100840493 | 215 |
| 376 | 3300025925 | Ga0207650_10212746 | Ga0207650_102127462 | 215 |
| 377 | 3300025925 | Ga0207650_10256500 | Ga0207650_102565002 | 215 |
| 378 | 3300025925 | Ga0207650_10662078 | Ga0207650_106620782 | 215 |
| 379 | 3300025925 | Ga0207650_10698994 | Ga0207650_106989942 | 215 |
| 380 | 3300025926 | Ga0207659_10006611 | Ga0207659_100066114 | 215 |
| 381 | 3300025926 | Ga0207659_10021777 | Ga0207659_100217774 | 215 |
| 382 | 3300025926 | Ga0207659_10022473 | Ga0207659_100224734 | 215 |
| 383 | 3300025926 | Ga0207659_10195610 | Ga0207659_101956102 | 215 |
| 384 | 3300025926 | Ga0207659_10492924 | Ga0207659_104929242 | 215 |
| 385 | 3300025928 | Ga0207700_10083392 | Ga0207700_100833923 | 215 |
| 386 | 3300025928 | Ga0207700_10370345 | Ga0207700_103703452 | 215 |
| 387 | 3300025931 | Ga0207644_10005044 | Ga0207644_100050446 | 215 |
| 388 | 3300025931 | Ga0207644_10014930 | Ga0207644_100149302 | 215 |
| 389 | 3300025931 | Ga0207644_10046510 | Ga0207644_100465103 | 215 |
| 390 | 3300025931 | Ga0207644_10070496 | Ga0207644_100704963 | 215 |
| 391 | 3300025932 | Ga0207690_10000419 | Ga0207690_1000041921 | 215 |
| 392 | 3300025932 | Ga0207690_10143180 | Ga0207690_101431802 | 215 |
| 393 | 3300025932 | Ga0207690_10644519 | Ga0207690_106445192 | 215 |
| 394 | 3300025933 | Ga0207706_10000074 | Ga0207706_1000007420 | 215 |
| 395 | 3300025933 | Ga0207706_10002518 | Ga0207706_1000251815 | 215 |
| 396 | 3300025933 | Ga0207706_10019690 | Ga0207706_100196904 | 215 |
| 397 | 3300025933 | Ga0207706_10227285 | Ga0207706_102272852 | 215 |
| 398 | 3300025934 | Ga0207686_10020451 | Ga0207686_100204514 | 215 |
| 399 | 3300025934 | Ga0207686_10035011 | Ga0207686_100350113 | 215 |
| 400 | 3300025934 | Ga0207686_10214443 | Ga0207686_102144432 | 215 |
| 401 | 3300025934 | Ga0207686_10228944 | Ga0207686_102289442 | 215 |
| 402 | 3300025935 | Ga0207709_10003323 | Ga0207709_100033238 | 215 |
| 403 | 3300025937 | Ga0207669_10000756 | Ga0207669_100007567 | 215 |
| 404 | 3300025937 | Ga0207669_10107277 | Ga0207669_101072773 | 215 |
| 405 | 3300025937 | Ga0207669_10109329 | Ga0207669_101093292 | 215 |
| 406 | 3300025937 | Ga0207669_10177038 | Ga0207669_101770382 | 215 |
| 407 | 3300025938 | Ga0207704_10000750 | Ga0207704_100007507 | 215 |
| 408 | 3300025938 | Ga0207704_10048038 | Ga0207704_100480382 | 215 |
| 409 | 3300025938 | Ga0207704_10083377 | Ga0207704_100833772 | 215 |
| 410 | 3300025938 | Ga0207704_10134599 | Ga0207704_101345992 | 215 |
| 411 | 3300025940 | Ga0207691_10001866 | Ga0207691_1000186610 | 215 |
| 412 | 3300025940 | Ga0207691_10014808 | Ga0207691_100148085 | 215 |
| 413 | 3300025940 | Ga0207691_10103201 | Ga0207691_101032013 | 215 |
| 414 | 3300025940 | Ga0207691_10178725 | Ga0207691_101787252 | 215 |
| 415 | 3300025941 | Ga0207711_10011986 | Ga0207711_100119866 | 215 |
| 416 | 3300025941 | Ga0207711_10014428 | Ga0207711_100144284 | 215 |
| 417 | 3300025941 | Ga0207711_10031161 | Ga0207711_100311613 | 215 |
| 418 | 3300025941 | Ga0207711_10041445 | Ga0207711_100414454 | 215 |
| 419 | 3300025941 | Ga0207711_10222835 | Ga0207711_102228352 | 215 |
| 420 | 3300025942 | Ga0207689_10006195 | Ga0207689_100061951 | 215 |
| 421 | 3300025944 | Ga0207661_10118582 | Ga0207661_101185822 | 215 |
| 422 | 3300025945 | Ga0207679_10007022 | Ga0207679_100070225 | 215 |
| 423 | 3300025945 | Ga0207679_10183171 | Ga0207679_101831712 | 215 |
| 424 | 3300025945 | Ga0207679_10240019 | Ga0207679_102400193 | 215 |
| 425 | 3300025949 | Ga0207667_10030975 | Ga0207667_100309755 | 215 |
| 426 | 3300025949 | Ga0207667_10307522 | Ga0207667_103075223 | 215 |
| 427 | 3300025949 | Ga0207667_10899361 | Ga0207667_108993612 | 215 |
| 428 | 3300025960 | Ga0207651_10084601 | Ga0207651_100846013 | 215 |
| 429 | 3300025960 | Ga0207651_10399649 | Ga0207651_103996492 | 215 |
| 430 | 3300025961 | Ga0207712_10012206 | Ga0207712_100122064 | 215 |
| 431 | 3300025972 | Ga0207668_10014767 | Ga0207668_100147673 | 215 |
| 432 | 3300025972 | Ga0207668_10033851 | Ga0207668_100338513 | 215 |
| 433 | 3300025981 | Ga0207640_10089134 | Ga0207640_100891342 | 215 |
| 434 | 3300025981 | Ga0207640_10402079 | Ga0207640_104020792 | 215 |
| 435 | 3300025981 | Ga0207640_10631853 | Ga0207640_106318532 | 215 |
| 436 | 3300025981 | Ga0207640_10939463 | Ga0207640_109394631 | 215 |
| 437 | 3300025986 | Ga0207658_10000510 | Ga0207658_100005107 | 215 |
| 438 | 3300025986 | Ga0207658_10067112 | Ga0207658_100671123 | 215 |
| 439 | 3300025986 | Ga0207658_10086504 | Ga0207658_100865042 | 215 |
| 440 | 3300025986 | Ga0207658_10255718 | Ga0207658_102557182 | 215 |
| 441 | 3300025986 | Ga0207658_10376149 | Ga0207658_103761492 | 215 |
| 442 | 3300026023 | Ga0207677_10445572 | Ga0207677_104455722 | 215 |
| 443 | 3300026023 | Ga0207677_11011019 | Ga0207677_110110191 | 215 |
| 444 | 3300026035 | Ga0207703_10001422 | Ga0207703_1000142215 | 215 |
| 445 | 3300026035 | Ga0207703_10293490 | Ga0207703_102934902 | 215 |
| 446 | 3300026041 | Ga0207639_10032306 | Ga0207639_100323063 | 215 |
| 447 | 3300026041 | Ga0207639_10283807 | Ga0207639_102838072 | 215 |
| 448 | 3300026041 | Ga0207639_10540742 | Ga0207639_105407421 | 215 |
| 449 | 3300026041 | Ga0207639_10553527 | Ga0207639_105535272 | 215 |
| 450 | 3300026067 | Ga0207678_10007835 | Ga0207678_1000783510 | 215 |
| 451 | 3300026075 | Ga0207708_10484405 | Ga0207708_104844052 | 215 |
| 452 | 3300026078 | Ga0207702_10001390 | Ga0207702_1000139019 | 215 |
| 453 | 3300026078 | Ga0207702_10153702 | Ga0207702_101537022 | 215 |
| 454 | 3300026088 | Ga0207641_10001218 | Ga0207641_1000121810 | 215 |
| 455 | 3300026088 | Ga0207641_10056997 | Ga0207641_100569974 | 215 |
| 456 | 3300026088 | Ga0207641_10162067 | Ga0207641_101620672 | 215 |
| 457 | 3300026088 | Ga0207641_10210230 | Ga0207641_102102303 | 215 |
| 458 | 3300026089 | Ga0207648_10001492 | Ga0207648_1000149216 | 215 |
| 459 | 3300026089 | Ga0207648_10012368 | Ga0207648_100123685 | 215 |
| 460 | 3300026089 | Ga0207648_10018499 | Ga0207648_100184996 | 215 |
| 461 | 3300026089 | Ga0207648_10104243 | Ga0207648_101042433 | 215 |
| 462 | 3300026095 | Ga0207676_10036241 | Ga0207676_100362414 | 215 |
| 463 | 3300026095 | Ga0207676_10040883 | Ga0207676_100408832 | 215 |
| 464 | 3300026095 | Ga0207676_10151988 | Ga0207676_101519882 | 215 |
| 465 | 3300026095 | Ga0207676_10418284 | Ga0207676_104182842 | 215 |
| 466 | 3300026118 | Ga0207675_100001773 | Ga0207675_10000177315 | 215 |
| 467 | 3300026118 | Ga0207675_100275507 | Ga0207675_1002755072 | 215 |
| 468 | 3300026121 | Ga0207683_10005185 | Ga0207683_100051856 | 215 |
| 469 | 3300026121 | Ga0207683_10085823 | Ga0207683_100858233 | 215 |
| 470 | 3300026121 | Ga0207683_10150989 | Ga0207683_101509892 | 215 |
| 471 | 3300026121 | Ga0207683_10227010 | Ga0207683_102270102 | 215 |
| 472 | 3300026121 | Ga0207683_11180612 | Ga0207683_111806121 | 215 |
| 473 | 3300026142 | Ga0207698_10012687 | Ga0207698_100126873 | 215 |
| 474 | 3300026142 | Ga0207698_10196320 | Ga0207698_101963203 | 215 |
| 475 | 3300026142 | Ga0207698_10406415 | Ga0207698_104064152 | 215 |
| 476 | 3300027907 | Ga0207428_10613387 | Ga0207428_106133872 | 215 |
| 477 | 3300028380 | Ga0268265_10005696 | Ga0268265_100056964 | 215 |
| 478 | 3300028381 | Ga0268264_10028083 | Ga0268264_100280834 | 215 |
| 479 | 3300028381 | Ga0268264_10192730 | Ga0268264_101927303 | 215 |
| 480 | 3300028381 | Ga0268264_10988880 | Ga0268264_109888801 | 215 |
| 481 | 3300032004 | Ga0307414_10585342 | Ga0307414_105853422 | 215 |
| 482 | 3300035083 | Ga0373926_0034130 | Ga0373926_0034130_654_1301 | 215 |
| 483 | 3300035116 | Ga0373945_0177915 | Ga0373945_0177915_129_776 | 215 |
| 484 | 3300035170 | Ga0373943_0026826 | Ga0373943_0026826_1605_2252 | 215 |
| 485 | 3300035410 | Ga0373924_0020099 | Ga0373924_0020099_1200_1847 | 215 |
| 486 | 3300035691 | Ga0373931_0069174 | Ga0373931_0069174_130_786 | 215 |
| 487 | 3300035692 | Ga0373935_0112178 | Ga0373935_0112178_497_1144 | 215 |
| 488 | 3300035724 | Ga0373933_0161205 | Ga0373933_0161205_38_685 | 215 |
| 489 | 3300035725 | Ga0373947_0088546 | Ga0373947_0088546_47_694 | 215 |
| 490 | 3300037068 | Ga0373925_0026288 | Ga0373925_0026288_2236_2883 | 215 |
| 491 | 3300037068 | Ga0373925_0336654 | Ga0373925_0336654_15_662 | 215 |
| 492 | 3300046453 | Ga0495627_022678 | Ga0495627_022678_335_982 | 215 |
| 493 | 3300046455 | Ga0495603_0140527 | Ga0495603_0140527_150_902 | 215 |
| 494 | 3300046491 | Ga0495584_0064863 | Ga0495584_0064863_605_1252 | 215 |
| 495 | 3300046492 | Ga0495585_0003320 | Ga0495585_0003320_8432_9079 | 215 |
| 496 | 3300046499 | Ga0495594_0033471 | Ga0495594_0033471_1769_2416 | 215 |
| 497 | 3300046499 | Ga0495594_0289775 | Ga0495594_0289775_153_800 | 215 |
| 498 | 3300046500 | Ga0495596_0005147 | Ga0495596_0005147_3098_3745 | 215 |
| 499 | 3300046500 | Ga0495596_0005570 | Ga0495596_0005570_5090_5737 | 215 |
| 500 | 3300046501 | Ga0495607_0052992 | Ga0495607_0052992_1139_1786 | 215 |
| 501 | 3300046506 | Ga0495583_0143298 | Ga0495583_0143298_177_824 | 215 |
| 502 | 3300046518 | Ga0495631_0006519 | Ga0495631_0006519_2776_3423 | 215 |
| 503 | 3300046518 | Ga0495631_0009677 | Ga0495631_0009677_697_1344 | 215 |
| 504 | 3300046522 | Ga0495643_0018799 | Ga0495643_0018799_2753_3400 | 215 |
| 505 | 3300046523 | Ga0495644_0029568 | Ga0495644_0029568_1181_1828 | 215 |
| 506 | 3300046528 | Ga0495642_0040232 | Ga0495642_0040232_795_1442 | 215 |
| 507 | 3300046535 | Ga0495586_0089053 | Ga0495586_0089053_208_855 | 215 |
| 508 | 3300046536 | Ga0495587_0018542 | Ga0495587_0018542_3148_3795 | 215 |
| 509 | 3300046539 | Ga0495621_0033547 | Ga0495621_0033547_455_1105 | 215 |
| 510 | 3300046539 | Ga0495621_0101783 | Ga0495621_0101783_394_1041 | 215 |
| 511 | 3300046543 | Ga0495645_0571727 | Ga0495645_0571727_16_663 | 215 |
| 512 | 3300046557 | Ga0495622_0094057 | Ga0495622_0094057_620_1267 | 215 |
| 513 | 3300046615 | Ga0495656_0166527 | Ga0495656_0166527_176_823 | 215 |
| 514 | 3300046616 | Ga0495668_0046915 | Ga0495668_0046915_363_1010 | 215 |
| 515 | 3300046648 | Ga0495611_0011487 | Ga0495611_0011487_1695_2342 | 215 |
| 516 | 3300046665 | Ga0495661_0056187 | Ga0495661_0056187_23_670 | 215 |
| 517 | 3300046683 | Ga0495658_0247497 | Ga0495658_0247497_174_821 | 215 |
| 518 | 3300046684 | Ga0495669_0001491 | Ga0495669_0001491_8867_9514 | 215 |
| 519 | 3300046689 | Ga0495613_0109696 | Ga0495613_0109696_695_1342 | 215 |
| 520 | 3300047315 | Ga0495581_0208481 | Ga0495581_0208481_464_1111 | 215 |
| 521 | 3300047317 | Ga0495604_0232047 | Ga0495604_0232047_552_1199 | 215 |
| 522 | 3300047320 | Ga0495672_0112700 | Ga0495672_0112700_206_853 | 215 |
| 523 | 3300047321 | Ga0495676_0015149 | Ga0495676_0015149_768_1415 | 215 |
| 524 | 3300047321 | Ga0495676_0041025 | Ga0495676_0041025_713_1360 | 215 |
| 525 | 3300047321 | Ga0495676_0492953 | Ga0495676_0492953_58_705 | 215 |
| 526 | 3300047322 | Ga0495680_0036776 | Ga0495680_0036776_1725_2372 | 215 |
| 527 | 3300047446 | Ga0495679_026066 | Ga0495679_026066_56_703 | 215 |
| 528 | 3300047469 | Ga0495673_0007840 | Ga0495673_0007840_1669_2316 | 215 |
| 529 | 3300048091 | Ga0495626_0006393 | Ga0495626_0006393_2087_2734 | 215 |
| 530 | 3300048091 | Ga0495626_0028758 | Ga0495626_0028758_1391_2038 | 215 |
| 531 | 3300048904 | Ga0496101_0606039 | Ga0496101_0606039_13_660 | 215 |
| 532 | 3300048905 | Ga0496102_0001702 | Ga0496102_0001702_6128_6775 | 215 |
| 533 | 3300048905 | Ga0496102_0301316 | Ga0496102_0301316_710_1357 | 215 |
| 534 | 3300048907 | Ga0496104_0000005 | Ga0496104_0000005_41894_42541 | 215 |
| 535 | 3300048907 | Ga0496104_0047410 | Ga0496104_0047410_2893_3540 | 215 |
| 536 | 3300048908 | Ga0496105_0000106 | Ga0496105_0000106_6010_6657 | 215 |
| 537 | 3300048908 | Ga0496105_0141427 | Ga0496105_0141427_756_1403 | 215 |
| 538 | 3300048908 | Ga0496105_0611819 | Ga0496105_0611819_185_832 | 215 |
| 539 | 3300048909 | Ga0496106_0001506 | Ga0496106_0001506_12118_12765 | 215 |
| 540 | 3300048910 | Ga0496107_0012164 | Ga0496107_0012164_4817_5464 | 215 |
| 541 | 3300048910 | Ga0496107_0142314 | Ga0496107_0142314_677_1324 | 215 |
| 542 | 3300048911 | Ga0496108_0263696 | Ga0496108_0263696_813_1460 | 215 |
| 543 | 3300048911 | Ga0496108_0452342 | Ga0496108_0452342_52_699 | 215 |
| 544 | 3300048912 | Ga0496109_0084620 | Ga0496109_0084620_868_1515 | 215 |
| 545 | 3300048912 | Ga0496109_0104821 | Ga0496109_0104821_738_1385 | 215 |
| 546 | 3300048913 | Ga0496110_0159180 | Ga0496110_0159180_497_1144 | 215 |
| 547 | 3300048913 | Ga0496110_0630742 | Ga0496110_0630742_96_848 | 215 |
| 548 | 3300048915 | Ga0496112_0038804 | Ga0496112_0038804_1573_2220 | 215 |
| 549 | 3300048916 | Ga0496113_0303283 | Ga0496113_0303283_596_1243 | 215 |
| 550 | 3300048917 | Ga0496114_0012861 | Ga0496114_0012861_3571_4218 | 215 |
| 551 | 3300048927 | Ga0496124_0002249 | Ga0496124_0002249_4969_5616 | 215 |
| 552 | 3300049460 | Ga0495682_0051125 | Ga0495682_0051125_616_1263 | 215 |
| 553 | 3300049570 | Ga0501033_0105330 | Ga0501033_0105330_616_1263 | 215 |
| 554 | 3300049571 | Ga0501034_0002589 | Ga0501034_0002589_7521_8168 | 215 |
| 555 | 3300049572 | Ga0501036_0214161 | Ga0501036_0214161_530_1177 | 215 |
| 556 | 3300049573 | Ga0501037_0218628 | Ga0501037_0218628_516_1163 | 215 |
| 557 | 3300049574 | Ga0501038_0196655 | Ga0501038_0196655_280_927 | 215 |
| 558 | 3300049574 | Ga0501038_0483855 | Ga0501038_0483855_220_867 | 215 |
| 559 | 3300049575 | Ga0501039_0052036 | Ga0501039_0052036_156_803 | 215 |
| 560 | 3300049575 | Ga0501039_0076109 | Ga0501039_0076109_564_1211 | 215 |
| 561 | 3300049576 | Ga0501040_0044724 | Ga0501040_0044724_892_1539 | 215 |
| 562 | 3300049577 | Ga0501041_0150614 | Ga0501041_0150614_466_1113 | 215 |
| 563 | 3300049579 | Ga0501043_0177384 | Ga0501043_0177384_11_658 | 215 |
| 564 | 3300049580 | Ga0501046_0061483 | Ga0501046_0061483_1858_2505 | 215 |
| 565 | 3300049580 | Ga0501046_0148497 | Ga0501046_0148497_472_1119 | 215 |
| 566 | 3300049582 | Ga0501048_0088350 | Ga0501048_0088350_506_1153 | 215 |
| 567 | 3300049584 | Ga0501068_0096756 | Ga0501068_0096756_1108_1755 | 215 |
| 568 | 3300049587 | Ga0501071_0019978 | Ga0501071_0019978_2894_3541 | 215 |
| 569 | 3300049587 | Ga0501071_0121639 | Ga0501071_0121639_880_1527 | 215 |
| 570 | 3300049588 | Ga0501072_0043830 | Ga0501072_0043830_1518_2165 | 215 |
| 571 | 3300049590 | Ga0501074_0424267 | Ga0501074_0424267_153_800 | 215 |
| 572 | 3300049591 | Ga0501075_0010572 | Ga0501075_0010572_4035_4682 | 215 |
| 573 | 3300049591 | Ga0501075_0256244 | Ga0501075_0256244_190_837 | 215 |
| 574 | 3300049592 | Ga0501076_0012122 | Ga0501076_0012122_440_1087 | 215 |
| 575 | 3300049592 | Ga0501076_0560963 | Ga0501076_0560963_140_787 | 215 |
| 576 | 3300049593 | Ga0501077_0222286 | Ga0501077_0222286_50_697 | 215 |
| 577 | 3300049741 | Ga0501079_0040966 | Ga0501079_0040966_135_782 | 215 |
| 578 | 3300049741 | Ga0501079_0228273 | Ga0501079_0228273_289_936 | 215 |
| 579 | 3300049743 | Ga0501081_0026219 | Ga0501081_0026219_2372_3019 | 215 |
| 580 | 3300049743 | Ga0501081_0039813 | Ga0501081_0039813_753_1400 | 215 |
| 581 | 3300049744 | Ga0501083_0142869 | Ga0501083_0142869_411_1058 | 215 |
| 582 | 3300049822 | Ga0501035_0321483 | Ga0501035_0321483_303_950 | 215 |
| 583 | 3300049824 | Ga0501045_0061879 | Ga0501045_0061879_809_1456 | 215 |
| 584 | 3300050507 | nmdc:mga05p37_534646_c1 | nmdc:mga05p37_534646_c1_380_1027 | 215 |
| 585 | 3300050510 | nmdc:mga06r32_458597_c1 | nmdc:mga06r32_458597_c1_239_886 | 215 |
| 586 | 3300050512 | nmdc:mga0n895_233101_c1 | nmdc:mga0n895_233101_c1_187_834 | 215 |
| 587 | 3300053078 | Ga0495612_0018286 | Ga0495612_0018286_511_1158 | 215 |
| 588 | 3300053085 | Ga0495619_0111174 | Ga0495619_0111174_638_1285 | 215 |
| 589 | 3300054114 | Ga0501084_0110106 | Ga0501084_0110106_1101_1748 | 215 |
| 590 | 3300060353 | Ga0501082_0063082 | Ga0501082_0063082_926_1573 | 215 |
| 591 | 3300061734 | Ga0530510_0007515 | Ga0530510_0007515_2095_2742 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k6m-assembly2.cif.gz_D | dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. | 0.9192 | 3 | 199 |
| 1ooz-assembly1.cif.gz_B | deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart | 0.9164 | 3 | 199 |
| 3dlx-assembly2.cif.gz_C | crystal structure of human 3-oxoacid coa transferase 1 | 0.9164 | 6 | 199 |
| 5dbn-assembly2.cif.gz_E | crystal structure of atoda complex | 0.9157 | 4 | 200 |
| 1ooz-assembly1.cif.gz_A | deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart | 0.9154 | 3 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2nrbB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.907 | 3 | 199 | 3.40.1080.10 |
| af_A4I5L9_2_259_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8998 | 4 | 201 | 3.40.1080.10 |
| af_Q4E2P8_5_264_3.40.1080.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8894 | 3 | 200 | 3.40.1080.10 |
| 5dbnA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8838 | 4 | 207 | 3.40.1080.10 |
| 2nrbB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8307 | 3 | 199 | 3.40.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A559GBE8-F1-model_v4 | CoA transferase subunit A | 0.9539 | 1 | 154 |
GO:0008410
|
| AF-A0A0F2S9H6-F1-model_v4 | Branched-chain amino acid dehydrogenase | 0.9487 | 1 | 154 |
GO:0008410
|
| AF-Q7P939-F1-model_v4 | Putative succinyl-CoA:3-ketoacid-coenzyme A transferase | 0.9435 | 18 | 152 |
GO:0008410
|
| AF-A0A7Z9KKT0-F1-model_v4 | CoA transferase subunit A | 0.9394 | 1 | 125 |
GO:0008410
|
| AF-A0A5A7MRX1-F1-model_v4 | merged | 0.9387 | 5 | 152 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar