F467063

General Info

Members Datasets Scaffolds Average Seq Length
591 273 590 319

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0088627|Ga0436365_0088627_833_1948
Length 371
Sequence LTRLLSARSIYVHEISSKQRVRSGAHGVSLRHEAMSEIVADPQQIIAASSASMAQQMSPPSRAGDKVFEWFTLLMAFSVVVLIGLVGWQLFSGSSLAIKKFGASFLIKSNWDPVSDDYGALPFIYGTLVSSFLALLIAVPLSIGAAVYLTELAPRWLRQPITSLVEMLAAIPSVILGLWGIFVMVPWMRDHVLPGLKWFFHFKPFVLIGVSKLFSGPAYGPSMLAGGVIIAIMIIPIITSVSREIISSVPGLQREAAYGLGATRWEVIRIAVLSYAKRGLFGAAILGLGRALGETMAVTMVIGNTPQISASLFAPGYTLASVIANEFAEATTDVYLQALFEIGLVLFLLTVAVNFGAQLILKTFSGSTPSA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.4
Rhizosphere 94.42
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13531447 2162886012 Bacteria 1750
2 JGI24035J26624_1000704 3300002126 Bacteria 3109
3 JGI25406J46586_10002390 3300003203 Bacteria 8871
4 rootH2_10018718 3300003320 Bacteria 16064
5 JGI25405J52794_10000611 3300003911 Bacteria 5315
6 JGI25405J52794_10000691 3300003911 Bacteria 5114
7 JGI25405J52794_10008393 3300003911 Bacteria 1928
8 Ga0065704_10009476 3300005289 Bacteria 2170
9 Ga0065712_10002131 3300005290 Bacteria 5852
10 Ga0065712_10025814 3300005290 Bacteria 1382
11 Ga0065712_10029097 3300005290 Bacteria 1230
12 Ga0065715_10089596 3300005293 Bacteria 9308
13 Ga0065715_10108395 3300005293 Bacteria 2717
14 Ga0065715_10123494 3300005293 Bacteria 2176
15 Ga0070658_10003195 3300005327 Bacteria 13523
16 Ga0070676_10005125 3300005328 Bacteria 6954
17 Ga0070676_10061401 3300005328 Bacteria 2234
18 Ga0070676_10116663 3300005328 Bacteria 1670
19 Ga0070683_100007398 3300005329 Bacteria 9276
20 Ga0070683_100008160 3300005329 Bacteria 8894
21 Ga0070683_100024861 3300005329 Bacteria 5371
22 Ga0070683_100043968 3300005329 Bacteria 4118
23 Ga0070690_100012793 3300005330 Bacteria 4943
24 Ga0070690_100184554 3300005330 Bacteria 1443
25 Ga0068869_100055530 3300005334 Bacteria 2886
26 Ga0068869_100090048 3300005334 Bacteria 2305
27 Ga0070666_10017358 3300005335 Bacteria 4614
28 Ga0070666_10021350 3300005335 Bacteria 4197
29 Ga0070666_10032040 3300005335 Bacteria 3471
30 Ga0068868_100017480 3300005338 Bacteria 5345
31 Ga0068868_100022079 3300005338 Bacteria 4799
32 Ga0070660_100039606 3300005339 Bacteria 3583
33 Ga0070689_100021708 3300005340 Bacteria 4785
34 Ga0070689_100437384 3300005340 Bacteria 1111
35 Ga0070687_100018808 3300005343 Bacteria 3203
36 Ga0070687_100044468 3300005343 Bacteria 2262
37 Ga0070661_100181896 3300005344 Bacteria 1600
38 Ga0070661_100388183 3300005344 Bacteria 1102
39 Ga0070668_100012876 3300005347 Bacteria 6227
40 Ga0070668_100028413 3300005347 Bacteria 4246
41 Ga0070668_100100172 3300005347 Bacteria 2295
42 Ga0070668_100108472 3300005347 Bacteria 2208
43 Ga0070668_100439826 3300005347 Bacteria 1119
44 Ga0070669_100004046 3300005353 Bacteria 10603
45 Ga0070669_100015181 3300005353 Bacteria 5485
46 Ga0070669_100023651 3300005353 Bacteria 4401
47 Ga0070669_100214248 3300005353 Unclassified 1521
48 Ga0070669_100237464 3300005353 Bacteria 1447
49 Ga0070675_100005748 3300005354 Bacteria 9486
50 Ga0070675_100125420 3300005354 Bacteria 2184
51 Ga0070671_100186576 3300005355 Bacteria 1757
52 Ga0070671_100189558 3300005355 Bacteria 1743
53 Ga0070674_100018632 3300005356 Bacteria 4394
54 Ga0070674_100032634 3300005356 Bacteria 3459
55 Ga0070674_100150950 3300005356 Unclassified 1753
56 Ga0070688_100014311 3300005365 Bacteria 4492
57 Ga0070688_100021608 3300005365 Bacteria 3761
58 Ga0070659_100004328 3300005366 Bacteria 10138
59 Ga0070659_100058634 3300005366 Bacteria 3039
60 Ga0070709_10024407 3300005434 Bacteria 3558
61 Ga0070709_10096578 3300005434 Bacteria 1960
62 Ga0070714_100439885 3300005435 Unclassified 1237
63 Ga0070713_100003736 3300005436 Bacteria 10073
64 Ga0070713_100058292 3300005436 Bacteria 3220
65 Ga0070713_100137793 3300005436 Bacteria 2158
66 Ga0070713_100140544 3300005436 Bacteria 2138
67 Ga0070710_10031139 3300005437 Bacteria 2876
68 Ga0070710_10094786 3300005437 Bacteria 1767
69 Ga0070701_10036622 3300005438 Bacteria 2473
70 Ga0070711_100000950 3300005439 Bacteria 15342
71 Ga0070711_100057733 3300005439 Bacteria 2688
72 Ga0070711_100074335 3300005439 Bacteria 2403
73 Ga0070705_100028900 3300005440 Bacteria 3041
74 Ga0070700_100127980 3300005441 Bacteria 1710
75 Ga0070694_100014482 3300005444 Bacteria 4937
76 Ga0070694_100140964 3300005444 Bacteria 1751
77 Ga0070694_100174695 3300005444 Bacteria 1585
78 Ga0070708_100032998 3300005445 Bacteria 4496
79 Ga0070708_100058676 3300005445 Bacteria 3429
80 Ga0070708_100097212 3300005445 Bacteria 2692
81 Ga0070708_100181820 3300005445 Bacteria 1966
82 Ga0070708_100210046 3300005445 Unclassified 1824
83 Ga0070708_100216441 3300005445 Bacteria 1796
84 Ga0070708_100441319 3300005445 Bacteria 1228
85 Ga0070663_100007062 3300005455 Bacteria 6809
86 Ga0070678_100012839 3300005456 Bacteria 5226
87 Ga0070662_100010223 3300005457 Bacteria 6152
88 Ga0070662_100012551 3300005457 Bacteria 5619
89 Ga0070662_100017224 3300005457 Bacteria 4865
90 Ga0070662_100036429 3300005457 Bacteria 3480
91 Ga0070681_10025209 3300005458 Bacteria 5982
92 Ga0070681_10415332 3300005458 Bacteria 1257
93 Ga0068867_100166489 3300005459 Bacteria 1742
94 Ga0070685_10022603 3300005466 Bacteria 3430
95 Ga0070706_100001327 3300005467 Bacteria 26298
96 Ga0070706_100015914 3300005467 Bacteria 6945
97 Ga0070706_100031117 3300005467 Bacteria 4921
98 Ga0070706_100036817 3300005467 Bacteria 4520
99 Ga0070706_100045321 3300005467 Bacteria 4063
100 Ga0070706_100055775 3300005467 Bacteria 3647
101 Ga0070706_100056804 3300005467 Bacteria 3611
102 Ga0070706_100094307 3300005467 Bacteria 2777
103 Ga0070706_100126514 3300005467 Bacteria 2383
104 Ga0070707_100011295 3300005468 Bacteria 8326
105 Ga0070707_100036460 3300005468 Bacteria 4692
106 Ga0070707_100233875 3300005468 Bacteria 1788
107 Ga0070707_100255046 3300005468 Bacteria 1707
108 Ga0070707_100404217 3300005468 Unclassified 1326
109 Ga0070698_100013758 3300005471 Bacteria 8565
110 Ga0070698_100027521 3300005471 Bacteria 5911
111 Ga0070698_100067488 3300005471 Bacteria 3596
112 Ga0070699_100023541 3300005518 Bacteria 5305
113 Ga0070699_100078744 3300005518 Bacteria 2870
114 Ga0070699_100151449 3300005518 Bacteria 2052
115 Ga0070679_100151360 3300005530 Bacteria 2296
116 Ga0070684_100000223 3300005535 Bacteria 39444
117 Ga0070684_100011106 3300005535 Bacteria 7165
118 Ga0070684_100055629 3300005535 Bacteria 3450
119 Ga0070697_100015613 3300005536 Bacteria 5963
120 Ga0070697_100048691 3300005536 Bacteria 3437
121 Ga0070697_100054603 3300005536 Bacteria 3247
122 Ga0070697_100206949 3300005536 Bacteria 1669
123 Ga0070697_100272323 3300005536 Bacteria 1451
124 Ga0070686_100026204 3300005544 Bacteria 3517
125 Ga0070686_100054255 3300005544 Bacteria 2563
126 Ga0070695_100043472 3300005545 Bacteria 2857
127 Ga0070696_100049479 3300005546 Bacteria 2920
128 Ga0070665_100047160 3300005548 Bacteria 4325
129 Ga0070665_100081633 3300005548 Bacteria 3238
130 Ga0070665_100120142 3300005548 Unclassified 2630
131 Ga0070704_100017404 3300005549 Bacteria 4570
132 Ga0070704_100069712 3300005549 Bacteria 2548
133 Ga0068855_100015366 3300005563 Bacteria 9216
134 Ga0068855_100030442 3300005563 Bacteria 6456
135 Ga0070664_100004288 3300005564 Bacteria 11473
136 Ga0068857_100080005 3300005577 Bacteria 2918
137 Ga0068857_100261923 3300005577 Bacteria 1587
138 Ga0068856_100000067 3300005614 Bacteria 98357
139 Ga0068856_100015211 3300005614 Bacteria 7435
140 Ga0068856_100039179 3300005614 Bacteria 4652
141 Ga0068856_100293362 3300005614 Bacteria 1643
142 Ga0068852_100080149 3300005616 Bacteria 2894
143 Ga0068859_100001429 3300005617 Bacteria 24213
144 Ga0068859_100024859 3300005617 Bacteria 6012
145 Ga0068859_100168674 3300005617 Bacteria 2269
146 Ga0068859_100427982 3300005617 Bacteria 1420
147 Ga0068864_100076359 3300005618 Bacteria 2927
148 Ga0068864_100105311 3300005618 Bacteria 2507
149 Ga0068861_100194846 3300005719 Bacteria 1697
150 Ga0068851_10031501 3300005834 Bacteria 2634
151 Ga0068870_10000669 3300005840 Bacteria 13042
152 Ga0068863_100109828 3300005841 Bacteria 2626
153 Ga0068858_100022153 3300005842 Bacteria 5932
154 Ga0068860_100004814 3300005843 Bacteria 13743
155 Ga0068860_100122620 3300005843 Bacteria 2490
156 Ga0068860_100133189 3300005843 Bacteria 2386
157 Ga0068860_100286106 3300005843 Bacteria 1612
158 Ga0068862_100017802 3300005844 Bacteria 5915
159 Ga0081455_10000141 3300005937 Bacteria 84891
160 Ga0081455_10000442 3300005937 Bacteria 54571
161 Ga0081455_10000878 3300005937 Bacteria 38886
162 Ga0081455_10003024 3300005937 Bacteria 19610
163 Ga0081455_10006792 3300005937 Bacteria 12200
164 Ga0081455_10022425 3300005937 Bacteria 5901
165 Ga0081455_10024667 3300005937 Bacteria 5564
166 Ga0081455_10126549 3300005937 Bacteria 2004
167 Ga0081538_10102503 3300005981 Bacteria 1435
168 Ga0081540_1000119 3300005983 Bacteria 84020
169 Ga0081539_10000511 3300005985 Bacteria 80587
170 Ga0081539_10015188 3300005985 Bacteria 5619
171 Ga0070717_10000233 3300006028 Bacteria 38420
172 Ga0070717_10006543 3300006028 Bacteria 8578
173 Ga0070717_10022647 3300006028 Bacteria 4968
174 Ga0070717_10039863 3300006028 Bacteria 3823
175 Ga0070717_10099374 3300006028 Bacteria 2469
176 Ga0070717_10292978 3300006028 Bacteria 1445
177 Ga0070715_10025201 3300006163 Bacteria 2352
178 Ga0070715_10051471 3300006163 Bacteria 1772
179 Ga0070716_100023425 3300006173 Bacteria 3275
180 Ga0070712_100020461 3300006175 Bacteria 4330
181 Ga0070712_100060515 3300006175 Bacteria 2671
182 Ga0070712_100067405 3300006175 Bacteria 2546
183 Ga0070712_100155560 3300006175 Bacteria 1760
184 Ga0070712_100172264 3300006175 Bacteria 1680
185 Ga0070712_100462665 3300006175 Bacteria 1058
186 Ga0097621_100028114 3300006237 Bacteria 4430
187 Ga0097621_100074601 3300006237 Bacteria 2810
188 Ga0068871_100233205 3300006358 Bacteria 1598
189 Ga0075428_100217448 3300006844 Bacteria 2064
190 Ga0075433_10071106 3300006852 Bacteria 3059
191 Ga0075434_100003234 3300006871 Bacteria 14541
192 Ga0075434_100141318 3300006871 Bacteria 2427
193 Ga0075429_100157479 3300006880 Bacteria 1989
194 Ga0075436_100118301 3300006914 Bacteria 1853
195 Ga0097620_100001429 3300006931 Bacteria 24213
196 Ga0097620_100024859 3300006931 Bacteria 6012
197 Ga0097620_100168667 3300006931 Bacteria 2269
198 Ga0097620_100427940 3300006931 Bacteria 1420
199 Ga0075435_100025147 3300007076 Bacteria 4632
200 Ga0099795_10083407 3300007788 Bacteria 1227
201 Ga0105240_10002189 3300009093 Bacteria 31899
202 Ga0105240_10011512 3300009093 Bacteria 12312
203 Ga0105240_10014651 3300009093 Bacteria 10699
204 Ga0111539_10013426 3300009094 Bacteria 10240
205 Ga0111539_10096732 3300009094 Bacteria 3468
206 Ga0111539_10485383 3300009094 Bacteria 1439
207 Ga0105245_10087814 3300009098 Bacteria 2855
208 Ga0114129_10037392 3300009147 Bacteria 6854
209 Ga0105243_10308499 3300009148 Bacteria 1437
210 Ga0105241_10035636 3300009174 Bacteria 3742
211 Ga0105237_10000060 3300009545 Bacteria 146242
212 Ga0105237_10076553 3300009545 Bacteria 3336
213 Ga0105237_10655807 3300009545 Unclassified 1056
214 Ga0105238_10015914 3300009551 Bacteria 7610
215 Ga0105238_10054640 3300009551 Bacteria 4010
216 Ga0105249_10004437 3300009553 Bacteria 12144
217 Ga0105249_10026632 3300009553 Bacteria 5213
218 Ga0099796_10000695 3300010159 Bacteria 5936
219 Ga0105239_10012918 3300010375 Bacteria 9289
220 Ga0105239_10059026 3300010375 Bacteria 4211
221 Ga0105239_10156193 3300010375 Bacteria 2547
222 Ga0105239_10341888 3300010375 Bacteria 1689
223 Ga0157374_10008015 3300013296 Bacteria 9030
224 Ga0157374_10008725 3300013296 Bacteria 8673
225 Ga0157374_10048651 3300013296 Bacteria 3935
226 Ga0157374_10108086 3300013296 Bacteria 2673
227 Ga0157378_10023559 3300013297 Bacteria 5415
228 Ga0157378_10032232 3300013297 Bacteria 4630
229 Ga0157378_10099957 3300013297 Bacteria 2647
230 Ga0163162_10078748 3300013306 Bacteria 3361
231 Ga0163162_10098033 3300013306 Bacteria 3020
232 Ga0163162_10247446 3300013306 Bacteria 1914
233 Ga0157375_10000535 3300013308 Bacteria 34074
234 Ga0157375_10018832 3300013308 Bacteria 6266
235 Ga0157375_10081930 3300013308 Bacteria 3268
236 Ga0157375_10517400 3300013308 Bacteria 1357
237 Ga0163163_10092152 3300014325 Bacteria 3045
238 Ga0157380_10008103 3300014326 Bacteria 7487
239 Ga0157380_10092815 3300014326 Bacteria 2495
240 Ga0157380_10636363 3300014326 Bacteria 1061
241 Ga0157377_10070182 3300014745 Bacteria 2023
242 Ga0157377_10159554 3300014745 Bacteria 1401
243 Ga0157379_10049697 3300014968 Bacteria 3744
244 Ga0157379_10158765 3300014968 Bacteria 2041
245 Ga0157376_10137172 3300014969 Bacteria 2191
246 Ga0157376_10280494 3300014969 Bacteria 1569
247 Ga0163161_10018478 3300017792 Bacteria 4886
248 Ga0213876_10034313 3300021384 Bacteria 2675
249 Ga0207666_1004174 3300025271 Unclassified 1804
250 Ga0207673_1000151 3300025290 Bacteria 6812
251 Ga0207697_10000729 3300025315 Bacteria 18691
252 Ga0207697_10001324 3300025315 Bacteria 13631
253 Ga0207697_10003386 3300025315 Bacteria 7917
254 Ga0207682_10009256 3300025893 Bacteria 3892
255 Ga0207688_10005226 3300025901 Bacteria 7056
256 Ga0207680_10019778 3300025903 Bacteria 3609
257 Ga0207680_10258644 3300025903 Bacteria 1204
258 Ga0207647_10026358 3300025904 Bacteria 3804
259 Ga0207685_10002637 3300025905 Bacteria 4163
260 Ga0207685_10031272 3300025905 Bacteria 1904
261 Ga0207699_10022909 3300025906 Bacteria 3392
262 Ga0207645_10000666 3300025907 Bacteria 28512
263 Ga0207645_10004600 3300025907 Bacteria 10169
264 Ga0207645_10033189 3300025907 Bacteria 3318
265 Ga0207643_10009182 3300025908 Bacteria 5310
266 Ga0207684_10001353 3300025910 Bacteria 26848
267 Ga0207684_10002867 3300025910 Bacteria 17113
268 Ga0207684_10009680 3300025910 Bacteria 8495
269 Ga0207684_10015018 3300025910 Bacteria 6667
270 Ga0207684_10029928 3300025910 Bacteria 4635
271 Ga0207684_10030434 3300025910 Bacteria 4595
272 Ga0207684_10046004 3300025910 Bacteria 3702
273 Ga0207684_10097705 3300025910 Bacteria 2507
274 Ga0207654_10026058 3300025911 Bacteria 3162
275 Ga0207695_10009082 3300025913 Bacteria 12344
276 Ga0207695_10037041 3300025913 Bacteria 5265
277 Ga0207695_10064803 3300025913 Bacteria 3760
278 Ga0207695_10268787 3300025913 Bacteria 1601
279 Ga0207671_10000062 3300025914 Bacteria 172081
280 Ga0207693_10031088 3300025915 Bacteria 4218
281 Ga0207693_10074929 3300025915 Bacteria 2650
282 Ga0207693_10086792 3300025915 Bacteria 2452
283 Ga0207693_10089518 3300025915 Bacteria 2412
284 Ga0207693_10203420 3300025915 Bacteria 1557
285 Ga0207663_10001971 3300025916 Bacteria 9723
286 Ga0207663_10159959 3300025916 Bacteria 1589
287 Ga0207660_10019365 3300025917 Bacteria 4549
288 Ga0207662_10000549 3300025918 Bacteria 16650
289 Ga0207657_10036185 3300025919 Bacteria 4420
290 Ga0207657_10077022 3300025919 Bacteria 2812
291 Ga0207649_10279134 3300025920 Bacteria 1214
292 Ga0207646_10002700 3300025922 Bacteria 20809
293 Ga0207646_10013903 3300025922 Bacteria 7675
294 Ga0207646_10042422 3300025922 Bacteria 4086
295 Ga0207646_10116530 3300025922 Bacteria 2399
296 Ga0207646_10118443 3300025922 Bacteria 2379
297 Ga0207646_10130058 3300025922 Bacteria 2265
298 Ga0207646_10193529 3300025922 Bacteria 1837
299 Ga0207646_10304766 3300025922 Bacteria 1439
300 Ga0207681_10008323 3300025923 Bacteria 6342
301 Ga0207681_10017696 3300025923 Bacteria 4479
302 Ga0207681_10067452 3300025923 Bacteria 2481
303 Ga0207681_10131930 3300025923 Bacteria 1848
304 Ga0207694_10033093 3300025924 Bacteria 3960
305 Ga0207650_10060275 3300025925 Bacteria 2832
306 Ga0207659_10004844 3300025926 Bacteria 8155
307 Ga0207659_10027836 3300025926 Bacteria 3832
308 Ga0207659_10062433 3300025926 Bacteria 2689
309 Ga0207659_10100943 3300025926 Bacteria 2175
310 Ga0207687_10415263 3300025927 Bacteria 1109
311 Ga0207700_10002713 3300025928 Bacteria 10206
312 Ga0207700_10003156 3300025928 Bacteria 9513
313 Ga0207700_10134569 3300025928 Bacteria 2023
314 Ga0207700_10318956 3300025928 Bacteria 1346
315 Ga0207664_10288501 3300025929 Unclassified 1441
316 Ga0207644_10271754 3300025931 Bacteria 1358
317 Ga0207690_10042928 3300025932 Bacteria 2973
318 Ga0207690_10044918 3300025932 Bacteria 2915
319 Ga0207706_10001787 3300025933 Bacteria 21123
320 Ga0207706_10016964 3300025933 Bacteria 6569
321 Ga0207706_10018565 3300025933 Bacteria 6258
322 Ga0207706_10042612 3300025933 Bacteria 4023
323 Ga0207686_10235540 3300025934 Bacteria 1330
324 Ga0207709_10123818 3300025935 Bacteria 1750
325 Ga0207670_10005486 3300025936 Bacteria 6968
326 Ga0207670_10011447 3300025936 Bacteria 5152
327 Ga0207670_10065279 3300025936 Bacteria 2497
328 Ga0207669_10043953 3300025937 Bacteria 2620
329 Ga0207669_10074439 3300025937 Bacteria 2147
330 Ga0207669_10119200 3300025937 Bacteria 1787
331 Ga0207704_10028118 3300025938 Bacteria 3115
332 Ga0207704_10167283 3300025938 Unclassified 1572
333 Ga0207665_10005229 3300025939 Bacteria 8669
334 Ga0207665_10005429 3300025939 Bacteria 8510
335 Ga0207665_10306060 3300025939 Unclassified 1189
336 Ga0207691_10001303 3300025940 Bacteria 24901
337 Ga0207689_10002826 3300025942 Bacteria 16029
338 Ga0207689_10021207 3300025942 Bacteria 5462
339 Ga0207661_10039508 3300025944 Bacteria 3703
340 Ga0207679_10021619 3300025945 Bacteria 4366
341 Ga0207679_10170781 3300025945 Bacteria 1790
342 Ga0207651_10109956 3300025960 Bacteria 2066
343 Ga0207712_10035457 3300025961 Bacteria 3390
344 Ga0207712_10385136 3300025961 Bacteria 1175
345 Ga0207668_10016132 3300025972 Bacteria 4656
346 Ga0207668_10020650 3300025972 Bacteria 4189
347 Ga0207668_10053426 3300025972 Bacteria 2800
348 Ga0207658_10010445 3300025986 Bacteria 6306
349 Ga0207658_10096481 3300025986 Bacteria 2306
350 Ga0207658_10156236 3300025986 Bacteria 1864
351 Ga0207677_10009851 3300026023 Bacteria 5387
352 Ga0207677_10207344 3300026023 Bacteria 1562
353 Ga0207703_10007514 3300026035 Bacteria 8650
354 Ga0207703_10192433 3300026035 Unclassified 1807
355 Ga0207678_10005675 3300026067 Bacteria 11151
356 Ga0207678_10143482 3300026067 Bacteria 2038
357 Ga0207708_10025496 3300026075 Bacteria 4473
358 Ga0207702_10001092 3300026078 Bacteria 27756
359 Ga0207702_10021652 3300026078 Bacteria 5323
360 Ga0207641_10035705 3300026088 Bacteria 4144
361 Ga0207648_10149035 3300026089 Bacteria 2064
362 Ga0207676_10018908 3300026095 Bacteria 5017
363 Ga0207675_100016560 3300026118 Bacteria 6884
364 Ga0207675_100031844 3300026118 Bacteria 4912
365 Ga0207683_10022659 3300026121 Bacteria 5394
366 Ga0207683_10201312 3300026121 Bacteria 1810
367 Ga0207698_10116862 3300026142 Bacteria 2249
368 Ga0207698_10123477 3300026142 Bacteria 2197
369 Ga0207698_10227532 3300026142 Bacteria 1690
370 Ga0207428_10012852 3300027907 Bacteria 7339
371 Ga0268266_10019532 3300028379 Bacteria 5775
372 Ga0268266_10127746 3300028379 Bacteria 2270
373 Ga0268266_10168157 3300028379 Bacteria 1988
374 Ga0268266_10305348 3300028379 Bacteria 1486
375 Ga0268264_10011548 3300028381 Bacteria 7296
376 Ga0268264_10291254 3300028381 Bacteria 1533
377 Ga0265337_1000553 3300028556 Bacteria 19769
378 Ga0265326_10006663 3300028558 Unclassified 3572
379 Ga0265319_1000004 3300028563 Bacteria 305085
380 Ga0265319_1000080 3300028563 Bacteria 75462
381 Ga0265319_1016514 3300028563 Bacteria 2830
382 Ga0265319_1047688 3300028563 Bacteria 1424
383 Ga0265334_10001707 3300028573 Bacteria 10492
384 Ga0265318_10054599 3300028577 Bacteria 1496
385 Ga0265323_10000587 3300028653 Bacteria 20017
386 Ga0265323_10001529 3300028653 Bacteria 11231
387 Ga0265323_10002916 3300028653 Bacteria 7655
388 Ga0265323_10012908 3300028653 Bacteria 3340
389 Ga0265323_10013672 3300028653 Bacteria 3230
390 Ga0265323_10020765 3300028653 Bacteria 2524
391 Ga0265323_10032891 3300028653 Bacteria 1923
392 Ga0265322_10000722 3300028654 Bacteria 12084
393 Ga0265322_10001433 3300028654 Bacteria 7846
394 Ga0265336_10000513 3300028666 Bacteria 22444
395 Ga0265336_10015766 3300028666 Bacteria 2480
396 Ga0265338_10000009 3300028800 Bacteria 448611
397 Ga0265338_10000016 3300028800 Bacteria 347424
398 Ga0265338_10000305 3300028800 Bacteria 88659
399 Ga0265338_10000382 3300028800 Bacteria 79298
400 Ga0265338_10003154 3300028800 Bacteria 23528
401 Ga0265338_10007112 3300028800 Bacteria 14017
402 Ga0265338_10008854 3300028800 Bacteria 12136
403 Ga0265338_10011655 3300028800 Bacteria 10126
404 Ga0265338_10017673 3300028800 Bacteria 7671
405 Ga0265338_10020306 3300028800 Bacteria 6999
406 Ga0265338_10025374 3300028800 Bacteria 6016
407 Ga0265338_10039916 3300028800 Bacteria 4417
408 Ga0265338_10041374 3300028800 Bacteria 4310
409 Ga0265338_10057616 3300028800 Bacteria 3435
410 Ga0265338_10059968 3300028800 Bacteria 3348
411 Ga0265338_10093520 3300028800 Bacteria 2477
412 Ga0265338_10167311 3300028800 Bacteria 1691
413 Ga0265338_10182992 3300028800 Bacteria 1595
414 Ga0265338_10225015 3300028800 Bacteria 1399
415 Ga0265324_10000470 3300029957 Bacteria 28358
416 Ga0265324_10008996 3300029957 Bacteria 3925
417 Ga0265324_10026380 3300029957 Bacteria 2057
418 Ga0265324_10048159 3300029957 Bacteria 1466
419 Ga0265330_10001245 3300031235 Bacteria 14912
420 Ga0265330_10024640 3300031235 Bacteria 2729
421 Ga0265330_10046423 3300031235 Bacteria 1914
422 Ga0265332_10050831 3300031238 Bacteria 1781
423 Ga0265320_10000823 3300031240 Bacteria 23388
424 Ga0265320_10003116 3300031240 Bacteria 11256
425 Ga0265320_10007793 3300031240 Bacteria 6614
426 Ga0265320_10011010 3300031240 Bacteria 5346
427 Ga0265320_10020278 3300031240 Bacteria 3607
428 Ga0265320_10021739 3300031240 Unclassified 3445
429 Ga0265320_10033975 3300031240 Bacteria 2599
430 Ga0265320_10096045 3300031240 Bacteria 1369
431 Ga0265325_10004610 3300031241 Bacteria 8656
432 Ga0265340_10001439 3300031247 Bacteria 13655
433 Ga0265339_10018464 3300031249 Bacteria 4109
434 Ga0265327_10000029 3300031251 Bacteria 352607
435 Ga0265327_10000709 3300031251 Bacteria 52606
436 Ga0265316_10012560 3300031344 Bacteria 7585
437 Ga0265316_10018306 3300031344 Bacteria 6022
438 Ga0265316_10025719 3300031344 Bacteria 4908
439 Ga0265316_10026612 3300031344 Bacteria 4807
440 Ga0265316_10044070 3300031344 Bacteria 3550
441 Ga0265316_10066114 3300031344 Bacteria 2799
442 Ga0265313_10000385 3300031595 Bacteria 47503
443 Ga0265313_10005257 3300031595 Bacteria 9585
444 Ga0265313_10015567 3300031595 Bacteria 4419
445 Ga0265313_10031656 3300031595 Bacteria 2709
446 Ga0265313_10035342 3300031595 Bacteria 2517
447 Ga0265313_10092410 3300031595 Bacteria 1356
448 Ga0265314_10023363 3300031711 Bacteria 4715
449 Ga0265314_10026658 3300031711 Bacteria 4338
450 Ga0265314_10132046 3300031711 Bacteria 1556
451 Ga0265342_10073766 3300031712 Bacteria 1984
452 Ga0307410_10107412 3300031852 Bacteria 2013
453 Ga0373940_0022985 3300035088 Bacteria 1606
454 Ga0373923_0046800 3300035111 Bacteria 1801
455 Ga0373957_0078976 3300035120 Bacteria 1297
456 Ga0373946_0076622 3300035171 Bacteria 1456
457 Ga0373931_0098230 3300035691 Bacteria 1643
458 Ga0373935_0004881 3300035692 Bacteria 7882
459 Ga0373927_0200670 3300035695 Bacteria 1310
460 Ga0373933_0353585 3300035724 Bacteria 955
461 Ga0373947_0166343 3300035725 Unclassified 1429
462 Ga0373947_0176939 3300035725 Bacteria 1387
463 Ga0373937_0117781 3300036401 Unclassified 2474
464 Ga0373937_0179878 3300036401 Unclassified 1986
465 Ga0373937_0368727 3300036401 Bacteria 1361
466 Ga0373937_0390149 3300036401 Bacteria 1321
467 Ga0395899_0131825 3300037312 Bacteria 1784
468 Ga0395900_0022806 3300037418 Bacteria 6405
469 Ga0395900_0032121 3300037418 Bacteria 5397
470 Ga0395898_0059428 3300037466 Bacteria 3719
471 Ga0395898_0060691 3300037466 Bacteria 3674
472 Ga0395898_0602556 3300037466 Bacteria 1041
473 Ga0436364_0565274 3300037853 Bacteria 1538
474 Ga0395901_0001234 3300038443 Bacteria 27294
475 Ga0395901_0005808 3300038443 Bacteria 12501
476 Ga0436365_0088627 3300039437 Bacteria 5125
477 Ga0436365_0428430 3300039437 Bacteria 9841
478 Ga0439455_0004416 3300042012 Bacteria 2785
479 Ga0451577_0513404 3300042876 Bacteria 1088
480 Ga0453683_0011603 3300044673 Bacteria 5804
481 Ga0451576_0001932 3300045051 Bacteria 33128
482 Ga0451576_0065872 3300045051 Bacteria 3771
483 Ga0451576_0084753 3300045051 Bacteria 3297
484 Ga0451576_0096490 3300045051 Bacteria 3075
485 Ga0451576_0212502 3300045051 Bacteria 2020
486 Ga0451576_0270247 3300045051 Bacteria 1777
487 Ga0451576_0516443 3300045051 Bacteria 1255
488 Ga0466967_0233987 3300045976 Unclassified 1750
489 Ga0495592_0066630 3300046454 Bacteria 2634
490 Ga0495641_0060442 3300046461 Bacteria 1712
491 Ga0495582_0021898 3300046473 Bacteria 3497
492 Ga0495639_0194142 3300046475 Bacteria 992
493 Ga0495628_0093711 3300046516 Bacteria 2322
494 Ga0495630_0000041 3300046517 Bacteria 104947
495 Ga0495630_0031492 3300046517 Bacteria 3949
496 Ga0495630_0047276 3300046517 Bacteria 3218
497 Ga0495630_0383603 3300046517 Bacteria 1076
498 Ga0495666_0041901 3300046526 Bacteria 2215
499 Ga0495640_0081674 3300046533 Bacteria 2148
500 Ga0495586_0000001 3300046535 Bacteria 231314
501 Ga0495586_0001421 3300046535 Bacteria 13244
502 Ga0495598_0003894 3300046537 Bacteria 3199
503 Ga0495645_0092789 3300046543 Bacteria 2155
504 Ga0495667_0014300 3300046559 Bacteria 5361
505 Ga0495667_0087804 3300046559 Bacteria 2016
506 Ga0495667_0131042 3300046559 Bacteria 1617
507 Ga0495634_0022051 3300046642 Bacteria 4489
508 Ga0495599_0039722 3300046678 Bacteria 2956
509 Ga0495623_0072989 3300046679 Bacteria 2133
510 Ga0495647_0030754 3300046681 Bacteria 1994
511 Ga0495658_0221270 3300046683 Bacteria 1185
512 Ga0495613_0000924 3300046689 Bacteria 22535
513 Ga0495613_0048230 3300046689 Bacteria 3145
514 Ga0495581_0209430 3300047315 Bacteria 1140
515 Ga0495604_0092622 3300047317 Bacteria 2238
516 Ga0495674_0005088 3300047319 Bacteria 12631
517 Ga0495676_0017861 3300047321 Bacteria 6262
518 Ga0495680_0157999 3300047322 Bacteria 1648
519 Ga0495680_0358536 3300047322 Bacteria 1014
520 Ga0495602_0255991 3300048088 Bacteria 1301
521 Ga0496100_0028170 3300048903 Bacteria 3463
522 Ga0496100_0072360 3300048903 Bacteria 2304
523 Ga0496101_0166252 3300048904 Bacteria 1694
524 Ga0496101_0195275 3300048904 Bacteria 1563
525 Ga0496102_0044485 3300048905 Bacteria 4030
526 Ga0496102_0150582 3300048905 Bacteria 2186
527 Ga0496103_0076315 3300048906 Bacteria 2103
528 Ga0496103_0099684 3300048906 Bacteria 1838
529 Ga0496104_0180378 3300048907 Bacteria 2022
530 Ga0496104_0254731 3300048907 Bacteria 1668
531 Ga0496106_0051439 3300048909 Bacteria 3106
532 Ga0496108_0364780 3300048911 Bacteria 1261
533 Ga0496110_0159754 3300048913 Bacteria 2043
534 Ga0496112_0031005 3300048915 Bacteria 5181
535 Ga0496112_0041724 3300048915 Bacteria 4490
536 Ga0496112_0109452 3300048915 Bacteria 2733
537 Ga0496112_0180624 3300048915 Bacteria 2074
538 Ga0496112_0569330 3300048915 Bacteria 1066
539 Ga0496113_0029349 3300048916 Bacteria 3970
540 Ga0496113_0099631 3300048916 Bacteria 2251
541 Ga0496113_0137166 3300048916 Bacteria 1923
542 Ga0496115_0002359 3300048918 Bacteria 13546
543 Ga0496115_0003943 3300048918 Bacteria 10697
544 Ga0496115_0017508 3300048918 Bacteria 5481
545 Ga0496115_0031446 3300048918 Bacteria 4184
546 Ga0496115_0083338 3300048918 Bacteria 2606
547 Ga0501031_0000004 3300049568 Bacteria 202781
548 Ga0501031_0052526 3300049568 Bacteria 2655
549 Ga0501032_0001747 3300049569 Bacteria 17137
550 Ga0501033_0000212 3300049570 Bacteria 55695
551 Ga0501033_0020520 3300049570 Bacteria 4992
552 Ga0501034_0153609 3300049571 Bacteria 2277
553 Ga0501034_0179178 3300049571 Bacteria 2084
554 Ga0501036_0077706 3300049572 Bacteria 2808
555 Ga0501036_0097402 3300049572 Bacteria 2486
556 Ga0501038_0001965 3300049574 Bacteria 18969
557 Ga0501039_0013681 3300049575 Bacteria 6205
558 Ga0501042_0004559 3300049578 Bacteria 8840
559 Ga0501043_0080320 3300049579 Bacteria 2562
560 Ga0501043_0186667 3300049579 Bacteria 1614
561 Ga0501046_0010345 3300049580 Bacteria 8018
562 Ga0501047_0001901 3300049581 Bacteria 20079
563 Ga0501047_0017386 3300049581 Bacteria 6886
564 Ga0501047_0446848 3300049581 Bacteria 1122
565 Ga0501070_0081888 3300049586 Bacteria 2671
566 Ga0501080_0110769 3300049742 Bacteria 2544
567 Ga0501080_0116706 3300049742 Bacteria 2474
568 Ga0501083_0003937 3300049744 Bacteria 10435
569 Ga0501083_0012768 3300049744 Bacteria 5875
570 Ga0501035_0000780 3300049822 Bacteria 34053
571 Ga0501035_0005405 3300049822 Bacteria 12074
572 Ga0501035_0039230 3300049822 Unclassified 4286
573 Ga0501035_0098327 3300049822 Bacteria 2569
574 Ga0501044_0000226 3300049823 Bacteria 71150
575 Ga0501044_0001072 3300049823 Bacteria 32802
576 Ga0501044_0013063 3300049823 Bacteria 8986
577 Ga0501044_0019081 3300049823 Bacteria 7341
578 nmdc:mga05p37_2252_c1 3300050507 Bacteria 12666
579 nmdc:mga09592_136355_c1 3300050508 Bacteria 2114
580 nmdc:mga08y16_124908_c1 3300050511 Bacteria 2677
581 nmdc:mga08y16_142519_c1 3300050511 Bacteria 2491
582 nmdc:mga08y16_88040_c1 3300050511 Bacteria 3236
583 nmdc:mga0rr50_93603_c1 3300050513 Bacteria 2345
584 nmdc:mga08x19_203823_c1 3300050514 Bacteria 1356
585 nmdc:mga0a205_3519_c1 3300050515 Bacteria 13993
586 Ga0495601_0088048 3300053077 Bacteria 1996
587 Ga0495595_0053308 3300053084 Bacteria 1879
588 Ga0500592_007184 3300053116 Bacteria 1773
589 Ga0501082_0071871 3300060353 Bacteria 2980
590 Ga0501082_0201450 3300060353 Bacteria 1732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100032634 Ga0070674_1000326343 273
2 3300025937 Ga0207669_10043953 Ga0207669_100439532 273
3 3300037466 Ga0395898_0060691 Ga0395898_0060691_24_902 276
4 3300038443 Ga0395901_0001234 Ga0395901_0001234_3808_4686 276
5 3300048918 Ga0496115_0083338 Ga0496115_0083338_1715_2593 276
6 3300050511 nmdc:mga08y16_142519_c1 nmdc:mga08y16_142519_c1_1094_1972 277
7 3300028800 Ga0265338_10057616 Ga0265338_100576163 278
8 3300031241 Ga0265325_10004610 Ga0265325_100046108 278
9 3300031249 Ga0265339_10018464 Ga0265339_100184642 278
10 3300031344 Ga0265316_10018306 Ga0265316_100183063 278
11 3300031711 Ga0265314_10132046 Ga0265314_101320462 278
12 3300028653 Ga0265323_10032891 Ga0265323_100328912 280
13 3300046537 Ga0495598_0003894 Ga0495598_0003894_1834_2724 281
14 3300028556 Ga0265337_1000553 Ga0265337_100055320 282
15 3300028666 Ga0265336_10000513 Ga0265336_1000051321 282
16 3300028800 Ga0265338_10003154 Ga0265338_100031544 282
17 3300045051 Ga0451576_0270247 Ga0451576_0270247_21_875 284
18 3300031240 Ga0265320_10096045 Ga0265320_100960452 286
19 3300036401 Ga0373937_0390149 Ga0373937_0390149_49_921 290
20 3300005563 Ga0068855_100015366 Ga0068855_1000153663 291
21 3300035724 Ga0373933_0353585 Ga0373933_0353585_53_928 291
22 3300046475 Ga0495639_0194142 Ga0495639_0194142_95_970 291
23 3300047315 Ga0495581_0209430 Ga0495581_0209430_11_886 291
24 3300005353 Ga0070669_100004046 Ga0070669_1000040465 292
25 3300005354 Ga0070675_100005748 Ga0070675_1000057485 292
26 3300005457 Ga0070662_100017224 Ga0070662_1000172244 292
27 3300005535 Ga0070684_100011106 Ga0070684_1000111068 292
28 3300025933 Ga0207706_10018565 Ga0207706_100185655 292
29 3300031711 Ga0265314_10023363 Ga0265314_100233633 292
30 3300046559 Ga0495667_0087804 Ga0495667_0087804_1119_1997 292
31 3300046678 Ga0495599_0039722 Ga0495599_0039722_40_918 292
32 3300046683 Ga0495658_0221270 Ga0495658_0221270_286_1164 292
33 3300048906 Ga0496103_0099684 Ga0496103_0099684_41_919 292
34 3300048918 Ga0496115_0031446 Ga0496115_0031446_14_892 292
35 3300053077 Ga0495601_0088048 Ga0495601_0088048_1079_1957 292
36 3300005530 Ga0070679_100151360 Ga0070679_1001513602 293
37 3300025922 Ga0207646_10118443 Ga0207646_101184432 293
38 3300048913 Ga0496110_0159754 Ga0496110_0159754_57_1040 293
39 3300048916 Ga0496113_0099631 Ga0496113_0099631_564_1547 293
40 3300005445 Ga0070708_100441319 Ga0070708_1004413191 294
41 3300005614 Ga0068856_100000067 Ga0068856_10000006722 295
42 3300026078 Ga0207702_10001092 Ga0207702_1000109222 295
43 3300028800 Ga0265338_10041374 Ga0265338_100413745 295
44 3300045051 Ga0451576_0212502 Ga0451576_0212502_548_1513 295
45 3300005468 Ga0070707_100233875 Ga0070707_1002338751 296
46 3300005563 Ga0068855_100030442 Ga0068855_1000304429 296
47 3300025922 Ga0207646_10130058 Ga0207646_101300583 296
48 3300005439 Ga0070711_100074335 Ga0070711_1000743353 297
49 3300005440 Ga0070705_100028900 Ga0070705_1000289002 297
50 3300005467 Ga0070706_100031117 Ga0070706_1000311174 297
51 3300049568 Ga0501031_0052526 Ga0501031_0052526_1368_2309 297
52 3300049569 Ga0501032_0001747 Ga0501032_0001747_15959_16900 297
53 3300049570 Ga0501033_0020520 Ga0501033_0020520_3684_4625 297
54 3300049571 Ga0501034_0179178 Ga0501034_0179178_776_1717 297
55 3300049572 Ga0501036_0077706 Ga0501036_0077706_1521_2462 297
56 3300049574 Ga0501038_0001965 Ga0501038_0001965_753_1694 297
57 3300049575 Ga0501039_0013681 Ga0501039_0013681_2846_3787 297
58 3300049578 Ga0501042_0004559 Ga0501042_0004559_588_1529 297
59 3300049581 Ga0501047_0017386 Ga0501047_0017386_5578_6519 297
60 3300049586 Ga0501070_0081888 Ga0501070_0081888_514_1455 297
61 3300049742 Ga0501080_0116706 Ga0501080_0116706_495_1436 297
62 3300049822 Ga0501035_0005405 Ga0501035_0005405_7759_8700 297
63 3300049823 Ga0501044_0019081 Ga0501044_0019081_6033_6974 297
64 3300060353 Ga0501082_0071871 Ga0501082_0071871_249_1190 297
65 3300005328 Ga0070676_10005125 Ga0070676_100051255 298
66 3300005330 Ga0070690_100012793 Ga0070690_1000127932 298
67 3300005338 Ga0068868_100017480 Ga0068868_1000174801 298
68 3300005340 Ga0070689_100021708 Ga0070689_1000217084 298
69 3300005347 Ga0070668_100012876 Ga0070668_1000128763 298
70 3300005457 Ga0070662_100012551 Ga0070662_1000125513 298
71 3300005467 Ga0070706_100001327 Ga0070706_10000132713 298
72 3300005843 Ga0068860_100122620 Ga0068860_1001226202 298
73 3300025271 Ga0207666_1004174 Ga0207666_10041741 298
74 3300025910 Ga0207684_10001353 Ga0207684_1000135314 298
75 3300025926 Ga0207659_10027836 Ga0207659_100278365 298
76 3300025933 Ga0207706_10001787 Ga0207706_1000178720 298
77 3300025936 Ga0207670_10011447 Ga0207670_100114473 298
78 3300025972 Ga0207668_10020650 Ga0207668_100206502 298
79 3300025986 Ga0207658_10010445 Ga0207658_100104452 298
80 3300026023 Ga0207677_10009851 Ga0207677_100098515 298
81 3300026035 Ga0207703_10192433 Ga0207703_101924332 298
82 3300042876 Ga0451577_0513404 Ga0451577_0513404_66_998 298
83 3300044673 Ga0453683_0011603 Ga0453683_0011603_294_1193 298
84 3300045051 Ga0451576_0001932 Ga0451576_0001932_18890_19822 298
85 3300060353 Ga0501082_0201450 Ga0501082_0201450_741_1676 298
86 3300006844 Ga0075428_100217448 Ga0075428_1002174482 299
87 3300006871 Ga0075434_100141318 Ga0075434_1001413182 299
88 3300028800 Ga0265338_10000009 Ga0265338_10000009155 299
89 3300005328 Ga0070676_10061401 Ga0070676_100614012 300
90 3300005330 Ga0070690_100184554 Ga0070690_1001845542 300
91 3300005335 Ga0070666_10017358 Ga0070666_100173582 300
92 3300005338 Ga0068868_100022079 Ga0068868_1000220793 300
93 3300005343 Ga0070687_100018808 Ga0070687_1000188083 300
94 3300005344 Ga0070661_100181896 Ga0070661_1001818962 300
95 3300005353 Ga0070669_100015181 Ga0070669_1000151812 300
96 3300005353 Ga0070669_100214248 Ga0070669_1002142482 300
97 3300005355 Ga0070671_100186576 Ga0070671_1001865762 300
98 3300005355 Ga0070671_100189558 Ga0070671_1001895582 300
99 3300005356 Ga0070674_100018632 Ga0070674_1000186322 300
100 3300005356 Ga0070674_100150950 Ga0070674_1001509501 300
101 3300005365 Ga0070688_100021608 Ga0070688_1000216082 300
102 3300005366 Ga0070659_100058634 Ga0070659_1000586343 300
103 3300005438 Ga0070701_10036622 Ga0070701_100366223 300
104 3300005444 Ga0070694_100174695 Ga0070694_1001746952 300
105 3300005456 Ga0070678_100012839 Ga0070678_1000128392 300
106 3300005457 Ga0070662_100036429 Ga0070662_1000364293 300
107 3300005466 Ga0070685_10022603 Ga0070685_100226033 300
108 3300005544 Ga0070686_100026204 Ga0070686_1000262042 300
109 3300005564 Ga0070664_100004288 Ga0070664_1000042888 300
110 3300005577 Ga0068857_100080005 Ga0068857_1000800052 300
111 3300005616 Ga0068852_100080149 Ga0068852_1000801492 300
112 3300005617 Ga0068859_100001429 Ga0068859_10000142912 300
113 3300005617 Ga0068859_100168674 Ga0068859_1001686742 300
114 3300005618 Ga0068864_100105311 Ga0068864_1001053112 300
115 3300005840 Ga0068870_10000669 Ga0068870_100006696 300
116 3300005843 Ga0068860_100133189 Ga0068860_1001331892 300
117 3300005844 Ga0068862_100017802 Ga0068862_1000178024 300
118 3300006358 Ga0068871_100233205 Ga0068871_1002332052 300
119 3300006852 Ga0075433_10071106 Ga0075433_100711063 300
120 3300006871 Ga0075434_100003234 Ga0075434_10000323414 300
121 3300006880 Ga0075429_100157479 Ga0075429_1001574793 300
122 3300006931 Ga0097620_100001429 Ga0097620_10000142912 300
123 3300006931 Ga0097620_100168667 Ga0097620_1001686673 300
124 3300007076 Ga0075435_100025147 Ga0075435_1000251476 300
125 3300009094 Ga0111539_10013426 Ga0111539_100134262 300
126 3300009094 Ga0111539_10096732 Ga0111539_100967323 300
127 3300009553 Ga0105249_10026632 Ga0105249_100266322 300
128 3300013306 Ga0163162_10078748 Ga0163162_100787482 300
129 3300014326 Ga0157380_10008103 Ga0157380_100081039 300
130 3300014326 Ga0157380_10092815 Ga0157380_100928152 300
131 3300014745 Ga0157377_10070182 Ga0157377_100701822 300
132 3300014968 Ga0157379_10158765 Ga0157379_101587652 300
133 3300017792 Ga0163161_10018478 Ga0163161_100184783 300
134 3300025315 Ga0207697_10003386 Ga0207697_100033866 300
135 3300025893 Ga0207682_10009256 Ga0207682_100092562 300
136 3300025901 Ga0207688_10005226 Ga0207688_100052265 300
137 3300025907 Ga0207645_10004600 Ga0207645_100046004 300
138 3300025907 Ga0207645_10033189 Ga0207645_100331893 300
139 3300025908 Ga0207643_10009182 Ga0207643_100091826 300
140 3300025918 Ga0207662_10000549 Ga0207662_100005493 300
141 3300025920 Ga0207649_10279134 Ga0207649_102791342 300
142 3300025923 Ga0207681_10017696 Ga0207681_100176964 300
143 3300025923 Ga0207681_10131930 Ga0207681_101319302 300
144 3300025926 Ga0207659_10004844 Ga0207659_100048443 300
145 3300025926 Ga0207659_10062433 Ga0207659_100624333 300
146 3300025931 Ga0207644_10271754 Ga0207644_102717542 300
147 3300025932 Ga0207690_10042928 Ga0207690_100429283 300
148 3300025933 Ga0207706_10042612 Ga0207706_100426123 300
149 3300025936 Ga0207670_10065279 Ga0207670_100652792 300
150 3300025937 Ga0207669_10074439 Ga0207669_100744392 300
151 3300025937 Ga0207669_10119200 Ga0207669_101192002 300
152 3300025940 Ga0207691_10001303 Ga0207691_1000130313 300
153 3300025942 Ga0207689_10002826 Ga0207689_1000282614 300
154 3300025945 Ga0207679_10021619 Ga0207679_100216192 300
155 3300025960 Ga0207651_10109956 Ga0207651_101099562 300
156 3300025961 Ga0207712_10385136 Ga0207712_103851362 300
157 3300025986 Ga0207658_10156236 Ga0207658_101562362 300
158 3300026089 Ga0207648_10149035 Ga0207648_101490352 300
159 3300026118 Ga0207675_100031844 Ga0207675_1000318442 300
160 3300026121 Ga0207683_10201312 Ga0207683_102013122 300
161 3300026142 Ga0207698_10227532 Ga0207698_102275322 300
162 3300027907 Ga0207428_10012852 Ga0207428_100128525 300
163 3300028381 Ga0268264_10011548 Ga0268264_100115489 300
164 3300035088 Ga0373940_0022985 Ga0373940_0022985_469_1428 300
165 3300048915 Ga0496112_0569330 Ga0496112_0569330_14_982 300
166 3300050508 nmdc:mga09592_136355_c1 nmdc:mga09592_136355_c1_193_1152 300
167 3300050511 nmdc:mga08y16_124908_c1 nmdc:mga08y16_124908_c1_1155_2111 300
168 3300050511 nmdc:mga08y16_88040_c1 nmdc:mga08y16_88040_c1_1082_2041 300
169 3300050513 nmdc:mga0rr50_93603_c1 nmdc:mga0rr50_93603_c1_908_1867 300
170 3300050515 nmdc:mga0a205_3519_c1 nmdc:mga0a205_3519_c1_2096_3055 300
171 3300053116 Ga0500592_007184 Ga0500592_007184_62_1024 300
172 3300028563 Ga0265319_1016514 Ga0265319_10165142 302
173 3300031595 Ga0265313_10005257 Ga0265313_100052573 302
174 3300005290 Ga0065712_10025814 Ga0065712_100258141 303
175 3300025928 Ga0207700_10002713 Ga0207700_100027133 303
176 3300031240 Ga0265320_10007793 Ga0265320_100077935 303
177 3300005471 Ga0070698_100013758 Ga0070698_1000137585 304
178 3300009545 Ga0105237_10076553 Ga0105237_100765534 304
179 3300031595 Ga0265313_10015567 Ga0265313_100155674 304
180 3300035725 Ga0373947_0166343 Ga0373947_0166343_322_1305 304
181 3300005834 Ga0068851_10031501 Ga0068851_100315012 305
182 3300028800 Ga0265338_10000016 Ga0265338_10000016214 305
183 3300037418 Ga0395900_0022806 Ga0395900_0022806_2814_3782 305
184 3300005335 Ga0070666_10021350 Ga0070666_100213503 306
185 3300005459 Ga0068867_100166489 Ga0068867_1001664892 306
186 3300005544 Ga0070686_100054255 Ga0070686_1000542552 306
187 3300013308 Ga0157375_10000535 Ga0157375_1000053518 306
188 3300025903 Ga0207680_10019778 Ga0207680_100197782 306
189 3300037466 Ga0395898_0602556 Ga0395898_0602556_12_1004 306
190 3300049568 Ga0501031_0000004 Ga0501031_0000004_162375_163331 306
191 3300049570 Ga0501033_0000212 Ga0501033_0000212_10837_11793 306
192 3300049579 Ga0501043_0186667 Ga0501043_0186667_307_1263 306
193 3300049822 Ga0501035_0098327 Ga0501035_0098327_1579_2535 306
194 3300049823 Ga0501044_0001072 Ga0501044_0001072_28512_29468 306
195 3300005437 Ga0070710_10094786 Ga0070710_100947862 307
196 3300005439 Ga0070711_100000950 Ga0070711_10000095011 307
197 3300005445 Ga0070708_100210046 Ga0070708_1002100462 307
198 3300005445 Ga0070708_100216441 Ga0070708_1002164412 307
199 3300005518 Ga0070699_100078744 Ga0070699_1000787443 307
200 3300005614 Ga0068856_100015211 Ga0068856_1000152118 307
201 3300006028 Ga0070717_10292978 Ga0070717_102929782 307
202 3300006175 Ga0070712_100060515 Ga0070712_1000605152 307
203 3300025915 Ga0207693_10031088 Ga0207693_100310882 307
204 3300025916 Ga0207663_10001971 Ga0207663_100019713 307
205 3300025916 Ga0207663_10159959 Ga0207663_101599591 307
206 3300025922 Ga0207646_10304766 Ga0207646_103047662 307
207 3300028653 Ga0265323_10020765 Ga0265323_100207652 307
208 3300028800 Ga0265338_10011655 Ga0265338_100116556 307
209 3300028800 Ga0265338_10025374 Ga0265338_100253748 307
210 3300028800 Ga0265338_10039916 Ga0265338_100399163 307
211 3300028800 Ga0265338_10225015 Ga0265338_102250152 307
212 3300029957 Ga0265324_10048159 Ga0265324_100481592 307
213 3300031344 Ga0265316_10025719 Ga0265316_100257191 307
214 3300035171 Ga0373946_0076622 Ga0373946_0076622_74_1057 307
215 3300035692 Ga0373935_0004881 Ga0373935_0004881_3250_4233 307
216 3300035725 Ga0373947_0176939 Ga0373947_0176939_291_1262 307
217 3300045051 Ga0451576_0516443 Ga0451576_0516443_216_1154 307
218 3300046517 Ga0495630_0047276 Ga0495630_0047276_476_1408 307
219 3300046559 Ga0495667_0014300 Ga0495667_0014300_3376_4308 307
220 3300049822 Ga0501035_0039230 Ga0501035_0039230_203_1159 307
221 3300049823 Ga0501044_0013063 Ga0501044_0013063_7472_8428 307
222 3300028653 Ga0265323_10000587 Ga0265323_100005872 308
223 3300028653 Ga0265323_10013672 Ga0265323_100136724 308
224 3300028800 Ga0265338_10000382 Ga0265338_1000038227 308
225 3300028800 Ga0265338_10017673 Ga0265338_100176733 308
226 3300028800 Ga0265338_10093520 Ga0265338_100935202 308
227 3300031595 Ga0265313_10035342 Ga0265313_100353422 308
228 3300036401 Ga0373937_0117781 Ga0373937_0117781_1058_2032 308
229 3300045051 Ga0451576_0084753 Ga0451576_0084753_1222_2157 308
230 3300049742 Ga0501080_0110769 Ga0501080_0110769_44_985 308
231 3300005293 Ga0065715_10089596 Ga0065715_100895969 309
232 3300005983 Ga0081540_1000119 Ga0081540_100011933 309
233 3300009147 Ga0114129_10037392 Ga0114129_100373924 309
234 3300025905 Ga0207685_10031272 Ga0207685_100312722 309
235 3300028558 Ga0265326_10006663 Ga0265326_100066633 309
236 3300028563 Ga0265319_1000004 Ga0265319_1000004291 309
237 3300031595 Ga0265313_10000385 Ga0265313_100003857 309
238 3300050507 nmdc:mga05p37_2252_c1 nmdc:mga05p37_2252_c1_9549_10553 309
239 3300003203 JGI25406J46586_10002390 JGI25406J46586_100023903 310
240 3300003320 rootH2_10018718 rootH2_100187184 310
241 3300005329 Ga0070683_100008160 Ga0070683_10000816010 310
242 3300005340 Ga0070689_100437384 Ga0070689_1004373841 310
243 3300005344 Ga0070661_100388183 Ga0070661_1003881832 310
244 3300005347 Ga0070668_100028413 Ga0070668_1000284134 310
245 3300005354 Ga0070675_100125420 Ga0070675_1001254202 310
246 3300005455 Ga0070663_100007062 Ga0070663_1000070625 310
247 3300005471 Ga0070698_100027521 Ga0070698_1000275212 310
248 3300006175 Ga0070712_100067405 Ga0070712_1000674053 310
249 3300006175 Ga0070712_100462665 Ga0070712_1004626651 310
250 3300009093 Ga0105240_10002189 Ga0105240_1000218924 310
251 3300009545 Ga0105237_10655807 Ga0105237_106558071 310
252 3300021384 Ga0213876_10034313 Ga0213876_100343132 310
253 3300025290 Ga0207673_1000151 Ga0207673_10001518 310
254 3300025315 Ga0207697_10001324 Ga0207697_1000132410 310
255 3300025913 Ga0207695_10037041 Ga0207695_100370415 310
256 3300025915 Ga0207693_10203420 Ga0207693_102034202 310
257 3300026121 Ga0207683_10022659 Ga0207683_100226594 310
258 3300029957 Ga0265324_10008996 Ga0265324_100089963 310
259 3300031251 Ga0265327_10000709 Ga0265327_100007096 310
260 3300037853 Ga0436364_0565274 Ga0436364_0565274_120_1052 310
261 3300039437 Ga0436365_0428430 Ga0436365_0428430_2863_3795 310
262 3300048915 Ga0496112_0109452 Ga0496112_0109452_432_1364 310
263 iso_pu_bacteria 2786546940 2788435189 310
264 3300005436 Ga0070713_100140544 Ga0070713_1001405441 311
265 3300006028 Ga0070717_10099374 Ga0070717_100993742 311
266 3300013296 Ga0157374_10008015 Ga0157374_100080155 311
267 3300025907 Ga0207645_10000666 Ga0207645_1000066613 311
268 3300025923 Ga0207681_10008323 Ga0207681_100083233 311
269 3300028666 Ga0265336_10015766 Ga0265336_100157662 311
270 3300028800 Ga0265338_10007112 Ga0265338_100071127 311
271 3300028800 Ga0265338_10008854 Ga0265338_100088543 311
272 3300028800 Ga0265338_10167311 Ga0265338_101673112 311
273 3300031238 Ga0265332_10050831 Ga0265332_100508312 311
274 3300031240 Ga0265320_10021739 Ga0265320_100217392 311
275 3300031240 Ga0265320_10033975 Ga0265320_100339752 311
276 3300031247 Ga0265340_10001439 Ga0265340_100014397 311
277 3300036401 Ga0373937_0368727 Ga0373937_0368727_136_1089 311
278 3300045051 Ga0451576_0065872 Ga0451576_0065872_2080_3063 311
279 3300045051 Ga0451576_0096490 Ga0451576_0096490_347_1324 311
280 3300046517 Ga0495630_0383603 Ga0495630_0383603_101_1054 311
281 3300046535 Ga0495586_0001421 Ga0495586_0001421_7492_8445 311
282 3300046559 Ga0495667_0131042 Ga0495667_0131042_21_974 311
283 3300046642 Ga0495634_0022051 Ga0495634_0022051_1275_2228 311
284 3300046689 Ga0495613_0000924 Ga0495613_0000924_8213_9166 311
285 3300005937 Ga0081455_10126549 Ga0081455_101265492 312
286 3300025910 Ga0207684_10030434 Ga0207684_100304345 312
287 3300005577 Ga0068857_100261923 Ga0068857_1002619231 313
288 3300005614 Ga0068856_100039179 Ga0068856_1000391793 313
289 3300005614 Ga0068856_100293362 Ga0068856_1002933622 313
290 3300009093 Ga0105240_10014651 Ga0105240_100146514 313
291 3300009094 Ga0111539_10485383 Ga0111539_104853832 313
292 3300009174 Ga0105241_10035636 Ga0105241_100356363 313
293 3300009551 Ga0105238_10015914 Ga0105238_100159143 313
294 3300025911 Ga0207654_10026058 Ga0207654_100260583 313
295 3300025913 Ga0207695_10064803 Ga0207695_100648034 313
296 3300025913 Ga0207695_10268787 Ga0207695_102687871 313
297 3300025924 Ga0207694_10033093 Ga0207694_100330932 313
298 3300026078 Ga0207702_10021652 Ga0207702_100216524 313
299 3300026142 Ga0207698_10123477 Ga0207698_101234772 313
300 3300031235 Ga0265330_10001245 Ga0265330_100012455 313
301 3300031595 Ga0265313_10031656 Ga0265313_100316562 313
302 3300048918 Ga0496115_0017508 Ga0496115_0017508_3617_4597 313
303 3300005617 Ga0068859_100427982 Ga0068859_1004279822 314
304 3300006028 Ga0070717_10000233 Ga0070717_1000023315 314
305 3300006931 Ga0097620_100427940 Ga0097620_1004279401 314
306 3300009545 Ga0105237_10000060 Ga0105237_100000603 314
307 3300009551 Ga0105238_10054640 Ga0105238_100546403 314
308 3300025914 Ga0207671_10000062 Ga0207671_10000062142 314
309 3300028800 Ga0265338_10000305 Ga0265338_1000030572 314
310 3300028800 Ga0265338_10020306 Ga0265338_100203065 314
311 3300028800 Ga0265338_10059968 Ga0265338_100599683 314
312 3300028800 Ga0265338_10182992 Ga0265338_101829922 314
313 3300029957 Ga0265324_10000470 Ga0265324_100004708 314
314 3300031240 Ga0265320_10020278 Ga0265320_100202783 314
315 3300037312 Ga0395899_0131825 Ga0395899_0131825_217_1161 314
316 3300037418 Ga0395900_0032121 Ga0395900_0032121_2022_2966 314
317 3300037466 Ga0395898_0059428 Ga0395898_0059428_2452_3396 314
318 3300038443 Ga0395901_0005808 Ga0395901_0005808_10487_11431 314
319 3300046473 Ga0495582_0021898 Ga0495582_0021898_1932_2903 314
320 3300046517 Ga0495630_0000041 Ga0495630_0000041_103737_104708 314
321 3300046526 Ga0495666_0041901 Ga0495666_0041901_1175_2146 314
322 3300046533 Ga0495640_0081674 Ga0495640_0081674_73_1044 314
323 3300046535 Ga0495586_0000001 Ga0495586_0000001_192633_193604 314
324 3300046681 Ga0495647_0030754 Ga0495647_0030754_593_1564 314
325 3300047319 Ga0495674_0005088 Ga0495674_0005088_11395_12366 314
326 3300047321 Ga0495676_0017861 Ga0495676_0017861_2077_3048 314
327 3300049571 Ga0501034_0153609 Ga0501034_0153609_1028_2005 314
328 3300005436 Ga0070713_100137793 Ga0070713_1001377932 315
329 3300005439 Ga0070711_100057733 Ga0070711_1000577333 315
330 3300006175 Ga0070712_100020461 Ga0070712_1000204611 315
331 3300025915 Ga0207693_10089518 Ga0207693_100895182 315
332 3300025928 Ga0207700_10318956 Ga0207700_103189562 315
333 3300029957 Ga0265324_10026380 Ga0265324_100263803 315
334 3300031852 Ga0307410_10107412 Ga0307410_101074122 315
335 3300005327 Ga0070658_10003195 Ga0070658_1000319513 316
336 3300005339 Ga0070660_100039606 Ga0070660_1000396063 316
337 3300005458 Ga0070681_10415332 Ga0070681_104153321 316
338 3300006163 Ga0070715_10025201 Ga0070715_100252012 316
339 3300025919 Ga0207657_10036185 Ga0207657_100361853 316
340 3300031344 Ga0265316_10044070 Ga0265316_100440703 316
341 3300049572 Ga0501036_0097402 Ga0501036_0097402_918_1874 316
342 3300049579 Ga0501043_0080320 Ga0501043_0080320_870_1826 316
343 3300049580 Ga0501046_0010345 Ga0501046_0010345_2821_3777 316
344 3300049581 Ga0501047_0001901 Ga0501047_0001901_17975_18931 316
345 3300049822 Ga0501035_0000780 Ga0501035_0000780_16210_17166 316
346 3300049823 Ga0501044_0000226 Ga0501044_0000226_40300_41256 316
347 3300005436 Ga0070713_100003736 Ga0070713_1000037368 317
348 3300028563 Ga0265319_1047688 Ga0265319_10476882 317
349 3300028577 Ga0265318_10054599 Ga0265318_100545992 317
350 3300031240 Ga0265320_10003116 Ga0265320_100031161 317
351 3300005347 Ga0070668_100108472 Ga0070668_1001084722 318
352 3300005353 Ga0070669_100237464 Ga0070669_1002374641 318
353 3300005467 Ga0070706_100045321 Ga0070706_1000453212 318
354 3300005468 Ga0070707_100255046 Ga0070707_1002550462 318
355 3300005937 Ga0081455_10000141 Ga0081455_1000014176 318
356 3300005981 Ga0081538_10102503 Ga0081538_101025032 318
357 3300009148 Ga0105243_10308499 Ga0105243_103084992 318
358 3300010375 Ga0105239_10012918 Ga0105239_100129187 318
359 3300025910 Ga0207684_10046004 Ga0207684_100460043 318
360 3300025922 Ga0207646_10193529 Ga0207646_101935292 318
361 3300031235 Ga0265330_10046423 Ga0265330_100464232 318
362 3300031344 Ga0265316_10066114 Ga0265316_100661142 318
363 3300005334 Ga0068869_100090048 Ga0068869_1000900483 319
364 3300005347 Ga0070668_100439826 Ga0070668_1004398261 319
365 3300005444 Ga0070694_100140964 Ga0070694_1001409642 319
366 3300005536 Ga0070697_100206949 Ga0070697_1002069492 319
367 3300005536 Ga0070697_100272323 Ga0070697_1002723232 319
368 3300005546 Ga0070696_100049479 Ga0070696_1000494793 319
369 3300005549 Ga0070704_100069712 Ga0070704_1000697121 319
370 3300005843 Ga0068860_100286106 Ga0068860_1002861062 319
371 3300014326 Ga0157380_10636363 Ga0157380_106363631 319
372 3300025942 Ga0207689_10021207 Ga0207689_100212073 319
373 3300028381 Ga0268264_10291254 Ga0268264_102912542 319
374 3300028563 Ga0265319_1000080 Ga0265319_100008011 319
375 3300031240 Ga0265320_10000823 Ga0265320_100008239 319
376 3300031240 Ga0265320_10011010 Ga0265320_100110102 319
377 3300031595 Ga0265313_10092410 Ga0265313_100924102 319
378 3300031711 Ga0265314_10026658 Ga0265314_100266582 319
379 3300049744 Ga0501083_0003937 Ga0501083_0003937_1915_2883 319
380 3300049744 Ga0501083_0012768 Ga0501083_0012768_4486_5454 319
381 3300028573 Ga0265334_10001707 Ga0265334_100017074 320
382 3300026142 Ga0207698_10116862 Ga0207698_101168622 321
383 3300028653 Ga0265323_10001529 Ga0265323_100015296 321
384 3300031344 Ga0265316_10026612 Ga0265316_100266123 321
385 3300039437 Ga0436365_0088627 Ga0436365_0088627_833_1948 321
386 3300005329 Ga0070683_100007398 Ga0070683_1000073984 322
387 3300005445 Ga0070708_100058676 Ga0070708_1000586761 322
388 3300005467 Ga0070706_100015914 Ga0070706_1000159145 322
389 3300005467 Ga0070706_100094307 Ga0070706_1000943073 322
390 3300005471 Ga0070698_100067488 Ga0070698_1000674883 322
391 3300005518 Ga0070699_100023541 Ga0070699_1000235414 322
392 3300005536 Ga0070697_100015613 Ga0070697_1000156133 322
393 3300006028 Ga0070717_10022647 Ga0070717_100226476 322
394 3300025910 Ga0207684_10009680 Ga0207684_100096805 322
395 3300025910 Ga0207684_10015018 Ga0207684_100150184 322
396 3300025910 Ga0207684_10097705 Ga0207684_100977053 322
397 3300025922 Ga0207646_10002700 Ga0207646_100027003 322
398 3300028653 Ga0265323_10002916 Ga0265323_100029168 322
399 3300028653 Ga0265323_10012908 Ga0265323_100129083 322
400 3300028654 Ga0265322_10000722 Ga0265322_100007222 322
401 3300028654 Ga0265322_10001433 Ga0265322_100014333 322
402 3300031235 Ga0265330_10024640 Ga0265330_100246402 322
403 3300031251 Ga0265327_10000029 Ga0265327_1000002914 322
404 3300031344 Ga0265316_10012560 Ga0265316_100125603 322
405 3300031712 Ga0265342_10073766 Ga0265342_100737662 322
406 3300049581 Ga0501047_0446848 Ga0501047_0446848_13_987 322
407 3300003911 JGI25405J52794_10000611 JGI25405J52794_100006112 323
408 3300003911 JGI25405J52794_10000691 JGI25405J52794_100006913 323
409 3300003911 JGI25405J52794_10008393 JGI25405J52794_100083932 323
410 3300005347 Ga0070668_100100172 Ga0070668_1001001722 323
411 3300005445 Ga0070708_100032998 Ga0070708_1000329983 323
412 3300005445 Ga0070708_100097212 Ga0070708_1000972122 323
413 3300005467 Ga0070706_100036817 Ga0070706_1000368173 323
414 3300005467 Ga0070706_100056804 Ga0070706_1000568044 323
415 3300005467 Ga0070706_100126514 Ga0070706_1001265142 323
416 3300005468 Ga0070707_100011295 Ga0070707_1000112956 323
417 3300005468 Ga0070707_100404217 Ga0070707_1004042171 323
418 3300005536 Ga0070697_100048691 Ga0070697_1000486912 323
419 3300005548 Ga0070665_100120142 Ga0070665_1001201422 323
420 3300005937 Ga0081455_10000442 Ga0081455_1000044214 323
421 3300005937 Ga0081455_10000878 Ga0081455_100008786 323
422 3300005937 Ga0081455_10003024 Ga0081455_1000302415 323
423 3300025910 Ga0207684_10029928 Ga0207684_100299283 323
424 3300025922 Ga0207646_10042422 Ga0207646_100424223 323
425 3300025926 Ga0207659_10100943 Ga0207659_101009432 323
426 3300025939 Ga0207665_10306060 Ga0207665_103060601 323
427 3300025972 Ga0207668_10053426 Ga0207668_100534262 323
428 3300028379 Ga0268266_10019532 Ga0268266_100195324 323
429 3300005353 Ga0070669_100023651 Ga0070669_1000236512 324
430 3300005436 Ga0070713_100058292 Ga0070713_1000582923 324
431 3300005985 Ga0081539_10000511 Ga0081539_100005114 324
432 3300006237 Ga0097621_100028114 Ga0097621_1000281144 324
433 3300009093 Ga0105240_10011512 Ga0105240_100115127 324
434 3300010159 Ga0099796_10000695 Ga0099796_100006954 324
435 3300010375 Ga0105239_10156193 Ga0105239_101561931 324
436 3300013297 Ga0157378_10032232 Ga0157378_100322324 324
437 3300025913 Ga0207695_10009082 Ga0207695_100090825 324
438 3300025922 Ga0207646_10116530 Ga0207646_101165302 324
439 3300025923 Ga0207681_10067452 Ga0207681_100674522 324
440 3300025927 Ga0207687_10415263 Ga0207687_104152632 324
441 3300025928 Ga0207700_10134569 Ga0207700_101345691 324
442 3300025972 Ga0207668_10016132 Ga0207668_100161325 324
443 3300026023 Ga0207677_10207344 Ga0207677_102073442 324
444 3300048903 Ga0496100_0028170 Ga0496100_0028170_2451_3434 324
445 3300048915 Ga0496112_0031005 Ga0496112_0031005_2027_3010 324
446 3300048918 Ga0496115_0003943 Ga0496115_0003943_7922_8905 324
447 2162886012 MBSR1b_contig_13531447 MBSR1b_0201.00003990 325
448 3300002126 JGI24035J26624_1000704 JGI24035J26624_10007042 325
449 3300005289 Ga0065704_10009476 Ga0065704_100094761 325
450 3300005290 Ga0065712_10002131 Ga0065712_100021315 325
451 3300005290 Ga0065712_10029097 Ga0065712_100290972 325
452 3300005293 Ga0065715_10108395 Ga0065715_101083952 325
453 3300005293 Ga0065715_10123494 Ga0065715_101234941 325
454 3300005328 Ga0070676_10116663 Ga0070676_101166632 325
455 3300005329 Ga0070683_100024861 Ga0070683_1000248613 325
456 3300005329 Ga0070683_100043968 Ga0070683_1000439685 325
457 3300005334 Ga0068869_100055530 Ga0068869_1000555304 325
458 3300005335 Ga0070666_10032040 Ga0070666_100320404 325
459 3300005343 Ga0070687_100044468 Ga0070687_1000444683 325
460 3300005365 Ga0070688_100014311 Ga0070688_1000143113 325
461 3300005366 Ga0070659_100004328 Ga0070659_1000043288 325
462 3300005434 Ga0070709_10024407 Ga0070709_100244071 325
463 3300005434 Ga0070709_10096578 Ga0070709_100965782 325
464 3300005435 Ga0070714_100439885 Ga0070714_1004398851 325
465 3300005437 Ga0070710_10031139 Ga0070710_100311393 325
466 3300005441 Ga0070700_100127980 Ga0070700_1001279802 325
467 3300005444 Ga0070694_100014482 Ga0070694_1000144826 325
468 3300005445 Ga0070708_100181820 Ga0070708_1001818202 325
469 3300005457 Ga0070662_100010223 Ga0070662_1000102235 325
470 3300005458 Ga0070681_10025209 Ga0070681_100252092 325
471 3300005467 Ga0070706_100055775 Ga0070706_1000557753 325
472 3300005468 Ga0070707_100036460 Ga0070707_1000364604 325
473 3300005518 Ga0070699_100151449 Ga0070699_1001514492 325
474 3300005535 Ga0070684_100000223 Ga0070684_10000022335 325
475 3300005535 Ga0070684_100055629 Ga0070684_1000556292 325
476 3300005536 Ga0070697_100054603 Ga0070697_1000546033 325
477 3300005545 Ga0070695_100043472 Ga0070695_1000434723 325
478 3300005548 Ga0070665_100047160 Ga0070665_1000471602 325
479 3300005548 Ga0070665_100081633 Ga0070665_1000816334 325
480 3300005549 Ga0070704_100017404 Ga0070704_1000174043 325
481 3300005617 Ga0068859_100024859 Ga0068859_1000248595 325
482 3300005618 Ga0068864_100076359 Ga0068864_1000763592 325
483 3300005719 Ga0068861_100194846 Ga0068861_1001948462 325
484 3300005841 Ga0068863_100109828 Ga0068863_1001098283 325
485 3300005842 Ga0068858_100022153 Ga0068858_1000221534 325
486 3300005843 Ga0068860_100004814 Ga0068860_10000481414 325
487 3300005937 Ga0081455_10006792 Ga0081455_1000679212 325
488 3300005937 Ga0081455_10022425 Ga0081455_100224253 325
489 3300005937 Ga0081455_10024667 Ga0081455_100246672 325
490 3300005985 Ga0081539_10015188 Ga0081539_100151883 325
491 3300006028 Ga0070717_10006543 Ga0070717_100065435 325
492 3300006028 Ga0070717_10039863 Ga0070717_100398632 325
493 3300006163 Ga0070715_10051471 Ga0070715_100514711 325
494 3300006173 Ga0070716_100023425 Ga0070716_1000234254 325
495 3300006175 Ga0070712_100155560 Ga0070712_1001555602 325
496 3300006175 Ga0070712_100172264 Ga0070712_1001722642 325
497 3300006237 Ga0097621_100074601 Ga0097621_1000746013 325
498 3300006914 Ga0075436_100118301 Ga0075436_1001183011 325
499 3300006931 Ga0097620_100024859 Ga0097620_1000248595 325
500 3300007788 Ga0099795_10083407 Ga0099795_100834072 325
501 3300009098 Ga0105245_10087814 Ga0105245_100878142 325
502 3300009553 Ga0105249_10004437 Ga0105249_100044378 325
503 3300010375 Ga0105239_10059026 Ga0105239_100590262 325
504 3300010375 Ga0105239_10341888 Ga0105239_103418881 325
505 3300013296 Ga0157374_10008725 Ga0157374_100087255 325
506 3300013296 Ga0157374_10048651 Ga0157374_100486512 325
507 3300013296 Ga0157374_10108086 Ga0157374_101080863 325
508 3300013297 Ga0157378_10023559 Ga0157378_100235593 325
509 3300013297 Ga0157378_10099957 Ga0157378_100999572 325
510 3300013306 Ga0163162_10098033 Ga0163162_100980331 325
511 3300013306 Ga0163162_10247446 Ga0163162_102474463 325
512 3300013308 Ga0157375_10018832 Ga0157375_100188325 325
513 3300013308 Ga0157375_10081930 Ga0157375_100819303 325
514 3300013308 Ga0157375_10517400 Ga0157375_105174002 325
515 3300014325 Ga0163163_10092152 Ga0163163_100921521 325
516 3300014745 Ga0157377_10159554 Ga0157377_101595542 325
517 3300014968 Ga0157379_10049697 Ga0157379_100496972 325
518 3300014969 Ga0157376_10137172 Ga0157376_101371722 325
519 3300014969 Ga0157376_10280494 Ga0157376_102804941 325
520 3300025315 Ga0207697_10000729 Ga0207697_1000072914 325
521 3300025903 Ga0207680_10258644 Ga0207680_102586441 325
522 3300025904 Ga0207647_10026358 Ga0207647_100263583 325
523 3300025905 Ga0207685_10002637 Ga0207685_100026372 325
524 3300025906 Ga0207699_10022909 Ga0207699_100229094 325
525 3300025910 Ga0207684_10002867 Ga0207684_100028677 325
526 3300025915 Ga0207693_10074929 Ga0207693_100749293 325
527 3300025915 Ga0207693_10086792 Ga0207693_100867922 325
528 3300025917 Ga0207660_10019365 Ga0207660_100193654 325
529 3300025919 Ga0207657_10077022 Ga0207657_100770222 325
530 3300025922 Ga0207646_10013903 Ga0207646_100139034 325
531 3300025925 Ga0207650_10060275 Ga0207650_100602753 325
532 3300025928 Ga0207700_10003156 Ga0207700_100031566 325
533 3300025929 Ga0207664_10288501 Ga0207664_102885012 325
534 3300025932 Ga0207690_10044918 Ga0207690_100449182 325
535 3300025933 Ga0207706_10016964 Ga0207706_100169642 325
536 3300025934 Ga0207686_10235540 Ga0207686_102355402 325
537 3300025935 Ga0207709_10123818 Ga0207709_101238181 325
538 3300025936 Ga0207670_10005486 Ga0207670_100054863 325
539 3300025938 Ga0207704_10028118 Ga0207704_100281182 325
540 3300025938 Ga0207704_10167283 Ga0207704_101672832 325
541 3300025939 Ga0207665_10005229 Ga0207665_100052291 325
542 3300025939 Ga0207665_10005429 Ga0207665_1000542910 325
543 3300025944 Ga0207661_10039508 Ga0207661_100395083 325
544 3300025945 Ga0207679_10170781 Ga0207679_101707812 325
545 3300025961 Ga0207712_10035457 Ga0207712_100354573 325
546 3300025986 Ga0207658_10096481 Ga0207658_100964812 325
547 3300026035 Ga0207703_10007514 Ga0207703_100075142 325
548 3300026067 Ga0207678_10005675 Ga0207678_100056753 325
549 3300026067 Ga0207678_10143482 Ga0207678_101434822 325
550 3300026075 Ga0207708_10025496 Ga0207708_100254964 325
551 3300026088 Ga0207641_10035705 Ga0207641_100357054 325
552 3300026095 Ga0207676_10018908 Ga0207676_100189083 325
553 3300026118 Ga0207675_100016560 Ga0207675_1000165603 325
554 3300028379 Ga0268266_10127746 Ga0268266_101277462 325
555 3300028379 Ga0268266_10168157 Ga0268266_101681572 325
556 3300028379 Ga0268266_10305348 Ga0268266_103053481 325
557 3300035111 Ga0373923_0046800 Ga0373923_0046800_174_1160 325
558 3300035120 Ga0373957_0078976 Ga0373957_0078976_181_1167 325
559 3300035691 Ga0373931_0098230 Ga0373931_0098230_226_1212 325
560 3300035695 Ga0373927_0200670 Ga0373927_0200670_183_1169 325
561 3300036401 Ga0373937_0179878 Ga0373937_0179878_287_1273 325
562 3300042012 Ga0439455_0004416 Ga0439455_0004416_363_1349 325
563 3300045976 Ga0466967_0233987 Ga0466967_0233987_454_1440 325
564 3300046454 Ga0495592_0066630 Ga0495592_0066630_1077_2063 325
565 3300046461 Ga0495641_0060442 Ga0495641_0060442_273_1259 325
566 3300046516 Ga0495628_0093711 Ga0495628_0093711_1024_2010 325
567 3300046517 Ga0495630_0031492 Ga0495630_0031492_2660_3646 325
568 3300046543 Ga0495645_0092789 Ga0495645_0092789_1036_2022 325
569 3300046679 Ga0495623_0072989 Ga0495623_0072989_752_1738 325
570 3300046689 Ga0495613_0048230 Ga0495613_0048230_289_1275 325
571 3300047317 Ga0495604_0092622 Ga0495604_0092622_439_1425 325
572 3300047322 Ga0495680_0157999 Ga0495680_0157999_84_1070 325
573 3300047322 Ga0495680_0358536 Ga0495680_0358536_14_1000 325
574 3300048088 Ga0495602_0255991 Ga0495602_0255991_65_1051 325
575 3300048903 Ga0496100_0072360 Ga0496100_0072360_367_1353 325
576 3300048904 Ga0496101_0166252 Ga0496101_0166252_257_1243 325
577 3300048904 Ga0496101_0195275 Ga0496101_0195275_441_1427 325
578 3300048905 Ga0496102_0044485 Ga0496102_0044485_1437_2423 325
579 3300048905 Ga0496102_0150582 Ga0496102_0150582_933_1919 325
580 3300048906 Ga0496103_0076315 Ga0496103_0076315_809_1795 325
581 3300048907 Ga0496104_0180378 Ga0496104_0180378_740_1726 325
582 3300048907 Ga0496104_0254731 Ga0496104_0254731_123_1109 325
583 3300048909 Ga0496106_0051439 Ga0496106_0051439_833_1819 325
584 3300048911 Ga0496108_0364780 Ga0496108_0364780_175_1152 325
585 3300048915 Ga0496112_0041724 Ga0496112_0041724_2226_3212 325
586 3300048915 Ga0496112_0180624 Ga0496112_0180624_182_1168 325
587 3300048916 Ga0496113_0029349 Ga0496113_0029349_1942_2928 325
588 3300048916 Ga0496113_0137166 Ga0496113_0137166_129_1106 325
589 3300048918 Ga0496115_0002359 Ga0496115_0002359_5199_6185 325
590 3300050514 nmdc:mga08x19_203823_c1 nmdc:mga08x19_203823_c1_10_987 325
591 3300053084 Ga0495595_0053308 Ga0495595_0053308_184_1170 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

138

365

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7971 78 314
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7627 27 308
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7608 78 314
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.7544 27 308
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.751 84 307
ID Description Score Start End Superfamily
af_P0AGH8_17_311_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9693 26 313 1.10.3720.10
af_P9WG07_21_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9465 35 316 1.10.3720.10
af_P0AGH8_17_311_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9437 26 313 1.10.3720.10
af_Q58420_16_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9394 28 314 1.10.3720.10
af_Q58420_16_310_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9119 28 314 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V8QVQ5-F1-model_v4 Phosphate transport system permease protein 0.9776 23 315 GO:0005315
GO:0005886
GO:0006817
AF-A0A1F3V7U2-F1-model_v4 Phosphate transport system permease protein 0.9773 23 314 GO:0005315
GO:0005886
GO:0006817
AF-A0A7V4KJ67-F1-model_v4 Phosphate transport system permease protein 0.9768 18 316 GO:0005315
GO:0005886
GO:0006817
AF-A0A162UGF4-F1-model_v4 Phosphate transport system permease protein 0.9768 21 314 GO:0005315
GO:0005886
GO:0006817
AF-A0A522PK74-F1-model_v4 Phosphate transport system permease protein 0.9766 27 315 GO:0005315
GO:0005886
GO:0006817

Feature Viewer

pLDDT pTM Quality
83.53 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map