F467063
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 591 | 273 | 590 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0088627|Ga0436365_0088627_833_1948 |
| Length | 371 |
| Sequence | LTRLLSARSIYVHEISSKQRVRSGAHGVSLRHEAMSEIVADPQQIIAASSASMAQQMSPPSRAGDKVFEWFTLLMAFSVVVLIGLVGWQLFSGSSLAIKKFGASFLIKSNWDPVSDDYGALPFIYGTLVSSFLALLIAVPLSIGAAVYLTELAPRWLRQPITSLVEMLAAIPSVILGLWGIFVMVPWMRDHVLPGLKWFFHFKPFVLIGVSKLFSGPAYGPSMLAGGVIIAIMIIPIITSVSREIISSVPGLQREAAYGLGATRWEVIRIAVLSYAKRGLFGAAILGLGRALGETMAVTMVIGNTPQISASLFAPGYTLASVIANEFAEATTDVYLQALFEIGLVLFLLTVAVNFGAQLILKTFSGSTPSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 209 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 210 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 4.4 |
| Rhizosphere | 94.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_13531447 | 2162886012 | Bacteria | 1750 |
| 2 | JGI24035J26624_1000704 | 3300002126 | Bacteria | 3109 |
| 3 | JGI25406J46586_10002390 | 3300003203 | Bacteria | 8871 |
| 4 | rootH2_10018718 | 3300003320 | Bacteria | 16064 |
| 5 | JGI25405J52794_10000611 | 3300003911 | Bacteria | 5315 |
| 6 | JGI25405J52794_10000691 | 3300003911 | Bacteria | 5114 |
| 7 | JGI25405J52794_10008393 | 3300003911 | Bacteria | 1928 |
| 8 | Ga0065704_10009476 | 3300005289 | Bacteria | 2170 |
| 9 | Ga0065712_10002131 | 3300005290 | Bacteria | 5852 |
| 10 | Ga0065712_10025814 | 3300005290 | Bacteria | 1382 |
| 11 | Ga0065712_10029097 | 3300005290 | Bacteria | 1230 |
| 12 | Ga0065715_10089596 | 3300005293 | Bacteria | 9308 |
| 13 | Ga0065715_10108395 | 3300005293 | Bacteria | 2717 |
| 14 | Ga0065715_10123494 | 3300005293 | Bacteria | 2176 |
| 15 | Ga0070658_10003195 | 3300005327 | Bacteria | 13523 |
| 16 | Ga0070676_10005125 | 3300005328 | Bacteria | 6954 |
| 17 | Ga0070676_10061401 | 3300005328 | Bacteria | 2234 |
| 18 | Ga0070676_10116663 | 3300005328 | Bacteria | 1670 |
| 19 | Ga0070683_100007398 | 3300005329 | Bacteria | 9276 |
| 20 | Ga0070683_100008160 | 3300005329 | Bacteria | 8894 |
| 21 | Ga0070683_100024861 | 3300005329 | Bacteria | 5371 |
| 22 | Ga0070683_100043968 | 3300005329 | Bacteria | 4118 |
| 23 | Ga0070690_100012793 | 3300005330 | Bacteria | 4943 |
| 24 | Ga0070690_100184554 | 3300005330 | Bacteria | 1443 |
| 25 | Ga0068869_100055530 | 3300005334 | Bacteria | 2886 |
| 26 | Ga0068869_100090048 | 3300005334 | Bacteria | 2305 |
| 27 | Ga0070666_10017358 | 3300005335 | Bacteria | 4614 |
| 28 | Ga0070666_10021350 | 3300005335 | Bacteria | 4197 |
| 29 | Ga0070666_10032040 | 3300005335 | Bacteria | 3471 |
| 30 | Ga0068868_100017480 | 3300005338 | Bacteria | 5345 |
| 31 | Ga0068868_100022079 | 3300005338 | Bacteria | 4799 |
| 32 | Ga0070660_100039606 | 3300005339 | Bacteria | 3583 |
| 33 | Ga0070689_100021708 | 3300005340 | Bacteria | 4785 |
| 34 | Ga0070689_100437384 | 3300005340 | Bacteria | 1111 |
| 35 | Ga0070687_100018808 | 3300005343 | Bacteria | 3203 |
| 36 | Ga0070687_100044468 | 3300005343 | Bacteria | 2262 |
| 37 | Ga0070661_100181896 | 3300005344 | Bacteria | 1600 |
| 38 | Ga0070661_100388183 | 3300005344 | Bacteria | 1102 |
| 39 | Ga0070668_100012876 | 3300005347 | Bacteria | 6227 |
| 40 | Ga0070668_100028413 | 3300005347 | Bacteria | 4246 |
| 41 | Ga0070668_100100172 | 3300005347 | Bacteria | 2295 |
| 42 | Ga0070668_100108472 | 3300005347 | Bacteria | 2208 |
| 43 | Ga0070668_100439826 | 3300005347 | Bacteria | 1119 |
| 44 | Ga0070669_100004046 | 3300005353 | Bacteria | 10603 |
| 45 | Ga0070669_100015181 | 3300005353 | Bacteria | 5485 |
| 46 | Ga0070669_100023651 | 3300005353 | Bacteria | 4401 |
| 47 | Ga0070669_100214248 | 3300005353 | Unclassified | 1521 |
| 48 | Ga0070669_100237464 | 3300005353 | Bacteria | 1447 |
| 49 | Ga0070675_100005748 | 3300005354 | Bacteria | 9486 |
| 50 | Ga0070675_100125420 | 3300005354 | Bacteria | 2184 |
| 51 | Ga0070671_100186576 | 3300005355 | Bacteria | 1757 |
| 52 | Ga0070671_100189558 | 3300005355 | Bacteria | 1743 |
| 53 | Ga0070674_100018632 | 3300005356 | Bacteria | 4394 |
| 54 | Ga0070674_100032634 | 3300005356 | Bacteria | 3459 |
| 55 | Ga0070674_100150950 | 3300005356 | Unclassified | 1753 |
| 56 | Ga0070688_100014311 | 3300005365 | Bacteria | 4492 |
| 57 | Ga0070688_100021608 | 3300005365 | Bacteria | 3761 |
| 58 | Ga0070659_100004328 | 3300005366 | Bacteria | 10138 |
| 59 | Ga0070659_100058634 | 3300005366 | Bacteria | 3039 |
| 60 | Ga0070709_10024407 | 3300005434 | Bacteria | 3558 |
| 61 | Ga0070709_10096578 | 3300005434 | Bacteria | 1960 |
| 62 | Ga0070714_100439885 | 3300005435 | Unclassified | 1237 |
| 63 | Ga0070713_100003736 | 3300005436 | Bacteria | 10073 |
| 64 | Ga0070713_100058292 | 3300005436 | Bacteria | 3220 |
| 65 | Ga0070713_100137793 | 3300005436 | Bacteria | 2158 |
| 66 | Ga0070713_100140544 | 3300005436 | Bacteria | 2138 |
| 67 | Ga0070710_10031139 | 3300005437 | Bacteria | 2876 |
| 68 | Ga0070710_10094786 | 3300005437 | Bacteria | 1767 |
| 69 | Ga0070701_10036622 | 3300005438 | Bacteria | 2473 |
| 70 | Ga0070711_100000950 | 3300005439 | Bacteria | 15342 |
| 71 | Ga0070711_100057733 | 3300005439 | Bacteria | 2688 |
| 72 | Ga0070711_100074335 | 3300005439 | Bacteria | 2403 |
| 73 | Ga0070705_100028900 | 3300005440 | Bacteria | 3041 |
| 74 | Ga0070700_100127980 | 3300005441 | Bacteria | 1710 |
| 75 | Ga0070694_100014482 | 3300005444 | Bacteria | 4937 |
| 76 | Ga0070694_100140964 | 3300005444 | Bacteria | 1751 |
| 77 | Ga0070694_100174695 | 3300005444 | Bacteria | 1585 |
| 78 | Ga0070708_100032998 | 3300005445 | Bacteria | 4496 |
| 79 | Ga0070708_100058676 | 3300005445 | Bacteria | 3429 |
| 80 | Ga0070708_100097212 | 3300005445 | Bacteria | 2692 |
| 81 | Ga0070708_100181820 | 3300005445 | Bacteria | 1966 |
| 82 | Ga0070708_100210046 | 3300005445 | Unclassified | 1824 |
| 83 | Ga0070708_100216441 | 3300005445 | Bacteria | 1796 |
| 84 | Ga0070708_100441319 | 3300005445 | Bacteria | 1228 |
| 85 | Ga0070663_100007062 | 3300005455 | Bacteria | 6809 |
| 86 | Ga0070678_100012839 | 3300005456 | Bacteria | 5226 |
| 87 | Ga0070662_100010223 | 3300005457 | Bacteria | 6152 |
| 88 | Ga0070662_100012551 | 3300005457 | Bacteria | 5619 |
| 89 | Ga0070662_100017224 | 3300005457 | Bacteria | 4865 |
| 90 | Ga0070662_100036429 | 3300005457 | Bacteria | 3480 |
| 91 | Ga0070681_10025209 | 3300005458 | Bacteria | 5982 |
| 92 | Ga0070681_10415332 | 3300005458 | Bacteria | 1257 |
| 93 | Ga0068867_100166489 | 3300005459 | Bacteria | 1742 |
| 94 | Ga0070685_10022603 | 3300005466 | Bacteria | 3430 |
| 95 | Ga0070706_100001327 | 3300005467 | Bacteria | 26298 |
| 96 | Ga0070706_100015914 | 3300005467 | Bacteria | 6945 |
| 97 | Ga0070706_100031117 | 3300005467 | Bacteria | 4921 |
| 98 | Ga0070706_100036817 | 3300005467 | Bacteria | 4520 |
| 99 | Ga0070706_100045321 | 3300005467 | Bacteria | 4063 |
| 100 | Ga0070706_100055775 | 3300005467 | Bacteria | 3647 |
| 101 | Ga0070706_100056804 | 3300005467 | Bacteria | 3611 |
| 102 | Ga0070706_100094307 | 3300005467 | Bacteria | 2777 |
| 103 | Ga0070706_100126514 | 3300005467 | Bacteria | 2383 |
| 104 | Ga0070707_100011295 | 3300005468 | Bacteria | 8326 |
| 105 | Ga0070707_100036460 | 3300005468 | Bacteria | 4692 |
| 106 | Ga0070707_100233875 | 3300005468 | Bacteria | 1788 |
| 107 | Ga0070707_100255046 | 3300005468 | Bacteria | 1707 |
| 108 | Ga0070707_100404217 | 3300005468 | Unclassified | 1326 |
| 109 | Ga0070698_100013758 | 3300005471 | Bacteria | 8565 |
| 110 | Ga0070698_100027521 | 3300005471 | Bacteria | 5911 |
| 111 | Ga0070698_100067488 | 3300005471 | Bacteria | 3596 |
| 112 | Ga0070699_100023541 | 3300005518 | Bacteria | 5305 |
| 113 | Ga0070699_100078744 | 3300005518 | Bacteria | 2870 |
| 114 | Ga0070699_100151449 | 3300005518 | Bacteria | 2052 |
| 115 | Ga0070679_100151360 | 3300005530 | Bacteria | 2296 |
| 116 | Ga0070684_100000223 | 3300005535 | Bacteria | 39444 |
| 117 | Ga0070684_100011106 | 3300005535 | Bacteria | 7165 |
| 118 | Ga0070684_100055629 | 3300005535 | Bacteria | 3450 |
| 119 | Ga0070697_100015613 | 3300005536 | Bacteria | 5963 |
| 120 | Ga0070697_100048691 | 3300005536 | Bacteria | 3437 |
| 121 | Ga0070697_100054603 | 3300005536 | Bacteria | 3247 |
| 122 | Ga0070697_100206949 | 3300005536 | Bacteria | 1669 |
| 123 | Ga0070697_100272323 | 3300005536 | Bacteria | 1451 |
| 124 | Ga0070686_100026204 | 3300005544 | Bacteria | 3517 |
| 125 | Ga0070686_100054255 | 3300005544 | Bacteria | 2563 |
| 126 | Ga0070695_100043472 | 3300005545 | Bacteria | 2857 |
| 127 | Ga0070696_100049479 | 3300005546 | Bacteria | 2920 |
| 128 | Ga0070665_100047160 | 3300005548 | Bacteria | 4325 |
| 129 | Ga0070665_100081633 | 3300005548 | Bacteria | 3238 |
| 130 | Ga0070665_100120142 | 3300005548 | Unclassified | 2630 |
| 131 | Ga0070704_100017404 | 3300005549 | Bacteria | 4570 |
| 132 | Ga0070704_100069712 | 3300005549 | Bacteria | 2548 |
| 133 | Ga0068855_100015366 | 3300005563 | Bacteria | 9216 |
| 134 | Ga0068855_100030442 | 3300005563 | Bacteria | 6456 |
| 135 | Ga0070664_100004288 | 3300005564 | Bacteria | 11473 |
| 136 | Ga0068857_100080005 | 3300005577 | Bacteria | 2918 |
| 137 | Ga0068857_100261923 | 3300005577 | Bacteria | 1587 |
| 138 | Ga0068856_100000067 | 3300005614 | Bacteria | 98357 |
| 139 | Ga0068856_100015211 | 3300005614 | Bacteria | 7435 |
| 140 | Ga0068856_100039179 | 3300005614 | Bacteria | 4652 |
| 141 | Ga0068856_100293362 | 3300005614 | Bacteria | 1643 |
| 142 | Ga0068852_100080149 | 3300005616 | Bacteria | 2894 |
| 143 | Ga0068859_100001429 | 3300005617 | Bacteria | 24213 |
| 144 | Ga0068859_100024859 | 3300005617 | Bacteria | 6012 |
| 145 | Ga0068859_100168674 | 3300005617 | Bacteria | 2269 |
| 146 | Ga0068859_100427982 | 3300005617 | Bacteria | 1420 |
| 147 | Ga0068864_100076359 | 3300005618 | Bacteria | 2927 |
| 148 | Ga0068864_100105311 | 3300005618 | Bacteria | 2507 |
| 149 | Ga0068861_100194846 | 3300005719 | Bacteria | 1697 |
| 150 | Ga0068851_10031501 | 3300005834 | Bacteria | 2634 |
| 151 | Ga0068870_10000669 | 3300005840 | Bacteria | 13042 |
| 152 | Ga0068863_100109828 | 3300005841 | Bacteria | 2626 |
| 153 | Ga0068858_100022153 | 3300005842 | Bacteria | 5932 |
| 154 | Ga0068860_100004814 | 3300005843 | Bacteria | 13743 |
| 155 | Ga0068860_100122620 | 3300005843 | Bacteria | 2490 |
| 156 | Ga0068860_100133189 | 3300005843 | Bacteria | 2386 |
| 157 | Ga0068860_100286106 | 3300005843 | Bacteria | 1612 |
| 158 | Ga0068862_100017802 | 3300005844 | Bacteria | 5915 |
| 159 | Ga0081455_10000141 | 3300005937 | Bacteria | 84891 |
| 160 | Ga0081455_10000442 | 3300005937 | Bacteria | 54571 |
| 161 | Ga0081455_10000878 | 3300005937 | Bacteria | 38886 |
| 162 | Ga0081455_10003024 | 3300005937 | Bacteria | 19610 |
| 163 | Ga0081455_10006792 | 3300005937 | Bacteria | 12200 |
| 164 | Ga0081455_10022425 | 3300005937 | Bacteria | 5901 |
| 165 | Ga0081455_10024667 | 3300005937 | Bacteria | 5564 |
| 166 | Ga0081455_10126549 | 3300005937 | Bacteria | 2004 |
| 167 | Ga0081538_10102503 | 3300005981 | Bacteria | 1435 |
| 168 | Ga0081540_1000119 | 3300005983 | Bacteria | 84020 |
| 169 | Ga0081539_10000511 | 3300005985 | Bacteria | 80587 |
| 170 | Ga0081539_10015188 | 3300005985 | Bacteria | 5619 |
| 171 | Ga0070717_10000233 | 3300006028 | Bacteria | 38420 |
| 172 | Ga0070717_10006543 | 3300006028 | Bacteria | 8578 |
| 173 | Ga0070717_10022647 | 3300006028 | Bacteria | 4968 |
| 174 | Ga0070717_10039863 | 3300006028 | Bacteria | 3823 |
| 175 | Ga0070717_10099374 | 3300006028 | Bacteria | 2469 |
| 176 | Ga0070717_10292978 | 3300006028 | Bacteria | 1445 |
| 177 | Ga0070715_10025201 | 3300006163 | Bacteria | 2352 |
| 178 | Ga0070715_10051471 | 3300006163 | Bacteria | 1772 |
| 179 | Ga0070716_100023425 | 3300006173 | Bacteria | 3275 |
| 180 | Ga0070712_100020461 | 3300006175 | Bacteria | 4330 |
| 181 | Ga0070712_100060515 | 3300006175 | Bacteria | 2671 |
| 182 | Ga0070712_100067405 | 3300006175 | Bacteria | 2546 |
| 183 | Ga0070712_100155560 | 3300006175 | Bacteria | 1760 |
| 184 | Ga0070712_100172264 | 3300006175 | Bacteria | 1680 |
| 185 | Ga0070712_100462665 | 3300006175 | Bacteria | 1058 |
| 186 | Ga0097621_100028114 | 3300006237 | Bacteria | 4430 |
| 187 | Ga0097621_100074601 | 3300006237 | Bacteria | 2810 |
| 188 | Ga0068871_100233205 | 3300006358 | Bacteria | 1598 |
| 189 | Ga0075428_100217448 | 3300006844 | Bacteria | 2064 |
| 190 | Ga0075433_10071106 | 3300006852 | Bacteria | 3059 |
| 191 | Ga0075434_100003234 | 3300006871 | Bacteria | 14541 |
| 192 | Ga0075434_100141318 | 3300006871 | Bacteria | 2427 |
| 193 | Ga0075429_100157479 | 3300006880 | Bacteria | 1989 |
| 194 | Ga0075436_100118301 | 3300006914 | Bacteria | 1853 |
| 195 | Ga0097620_100001429 | 3300006931 | Bacteria | 24213 |
| 196 | Ga0097620_100024859 | 3300006931 | Bacteria | 6012 |
| 197 | Ga0097620_100168667 | 3300006931 | Bacteria | 2269 |
| 198 | Ga0097620_100427940 | 3300006931 | Bacteria | 1420 |
| 199 | Ga0075435_100025147 | 3300007076 | Bacteria | 4632 |
| 200 | Ga0099795_10083407 | 3300007788 | Bacteria | 1227 |
| 201 | Ga0105240_10002189 | 3300009093 | Bacteria | 31899 |
| 202 | Ga0105240_10011512 | 3300009093 | Bacteria | 12312 |
| 203 | Ga0105240_10014651 | 3300009093 | Bacteria | 10699 |
| 204 | Ga0111539_10013426 | 3300009094 | Bacteria | 10240 |
| 205 | Ga0111539_10096732 | 3300009094 | Bacteria | 3468 |
| 206 | Ga0111539_10485383 | 3300009094 | Bacteria | 1439 |
| 207 | Ga0105245_10087814 | 3300009098 | Bacteria | 2855 |
| 208 | Ga0114129_10037392 | 3300009147 | Bacteria | 6854 |
| 209 | Ga0105243_10308499 | 3300009148 | Bacteria | 1437 |
| 210 | Ga0105241_10035636 | 3300009174 | Bacteria | 3742 |
| 211 | Ga0105237_10000060 | 3300009545 | Bacteria | 146242 |
| 212 | Ga0105237_10076553 | 3300009545 | Bacteria | 3336 |
| 213 | Ga0105237_10655807 | 3300009545 | Unclassified | 1056 |
| 214 | Ga0105238_10015914 | 3300009551 | Bacteria | 7610 |
| 215 | Ga0105238_10054640 | 3300009551 | Bacteria | 4010 |
| 216 | Ga0105249_10004437 | 3300009553 | Bacteria | 12144 |
| 217 | Ga0105249_10026632 | 3300009553 | Bacteria | 5213 |
| 218 | Ga0099796_10000695 | 3300010159 | Bacteria | 5936 |
| 219 | Ga0105239_10012918 | 3300010375 | Bacteria | 9289 |
| 220 | Ga0105239_10059026 | 3300010375 | Bacteria | 4211 |
| 221 | Ga0105239_10156193 | 3300010375 | Bacteria | 2547 |
| 222 | Ga0105239_10341888 | 3300010375 | Bacteria | 1689 |
| 223 | Ga0157374_10008015 | 3300013296 | Bacteria | 9030 |
| 224 | Ga0157374_10008725 | 3300013296 | Bacteria | 8673 |
| 225 | Ga0157374_10048651 | 3300013296 | Bacteria | 3935 |
| 226 | Ga0157374_10108086 | 3300013296 | Bacteria | 2673 |
| 227 | Ga0157378_10023559 | 3300013297 | Bacteria | 5415 |
| 228 | Ga0157378_10032232 | 3300013297 | Bacteria | 4630 |
| 229 | Ga0157378_10099957 | 3300013297 | Bacteria | 2647 |
| 230 | Ga0163162_10078748 | 3300013306 | Bacteria | 3361 |
| 231 | Ga0163162_10098033 | 3300013306 | Bacteria | 3020 |
| 232 | Ga0163162_10247446 | 3300013306 | Bacteria | 1914 |
| 233 | Ga0157375_10000535 | 3300013308 | Bacteria | 34074 |
| 234 | Ga0157375_10018832 | 3300013308 | Bacteria | 6266 |
| 235 | Ga0157375_10081930 | 3300013308 | Bacteria | 3268 |
| 236 | Ga0157375_10517400 | 3300013308 | Bacteria | 1357 |
| 237 | Ga0163163_10092152 | 3300014325 | Bacteria | 3045 |
| 238 | Ga0157380_10008103 | 3300014326 | Bacteria | 7487 |
| 239 | Ga0157380_10092815 | 3300014326 | Bacteria | 2495 |
| 240 | Ga0157380_10636363 | 3300014326 | Bacteria | 1061 |
| 241 | Ga0157377_10070182 | 3300014745 | Bacteria | 2023 |
| 242 | Ga0157377_10159554 | 3300014745 | Bacteria | 1401 |
| 243 | Ga0157379_10049697 | 3300014968 | Bacteria | 3744 |
| 244 | Ga0157379_10158765 | 3300014968 | Bacteria | 2041 |
| 245 | Ga0157376_10137172 | 3300014969 | Bacteria | 2191 |
| 246 | Ga0157376_10280494 | 3300014969 | Bacteria | 1569 |
| 247 | Ga0163161_10018478 | 3300017792 | Bacteria | 4886 |
| 248 | Ga0213876_10034313 | 3300021384 | Bacteria | 2675 |
| 249 | Ga0207666_1004174 | 3300025271 | Unclassified | 1804 |
| 250 | Ga0207673_1000151 | 3300025290 | Bacteria | 6812 |
| 251 | Ga0207697_10000729 | 3300025315 | Bacteria | 18691 |
| 252 | Ga0207697_10001324 | 3300025315 | Bacteria | 13631 |
| 253 | Ga0207697_10003386 | 3300025315 | Bacteria | 7917 |
| 254 | Ga0207682_10009256 | 3300025893 | Bacteria | 3892 |
| 255 | Ga0207688_10005226 | 3300025901 | Bacteria | 7056 |
| 256 | Ga0207680_10019778 | 3300025903 | Bacteria | 3609 |
| 257 | Ga0207680_10258644 | 3300025903 | Bacteria | 1204 |
| 258 | Ga0207647_10026358 | 3300025904 | Bacteria | 3804 |
| 259 | Ga0207685_10002637 | 3300025905 | Bacteria | 4163 |
| 260 | Ga0207685_10031272 | 3300025905 | Bacteria | 1904 |
| 261 | Ga0207699_10022909 | 3300025906 | Bacteria | 3392 |
| 262 | Ga0207645_10000666 | 3300025907 | Bacteria | 28512 |
| 263 | Ga0207645_10004600 | 3300025907 | Bacteria | 10169 |
| 264 | Ga0207645_10033189 | 3300025907 | Bacteria | 3318 |
| 265 | Ga0207643_10009182 | 3300025908 | Bacteria | 5310 |
| 266 | Ga0207684_10001353 | 3300025910 | Bacteria | 26848 |
| 267 | Ga0207684_10002867 | 3300025910 | Bacteria | 17113 |
| 268 | Ga0207684_10009680 | 3300025910 | Bacteria | 8495 |
| 269 | Ga0207684_10015018 | 3300025910 | Bacteria | 6667 |
| 270 | Ga0207684_10029928 | 3300025910 | Bacteria | 4635 |
| 271 | Ga0207684_10030434 | 3300025910 | Bacteria | 4595 |
| 272 | Ga0207684_10046004 | 3300025910 | Bacteria | 3702 |
| 273 | Ga0207684_10097705 | 3300025910 | Bacteria | 2507 |
| 274 | Ga0207654_10026058 | 3300025911 | Bacteria | 3162 |
| 275 | Ga0207695_10009082 | 3300025913 | Bacteria | 12344 |
| 276 | Ga0207695_10037041 | 3300025913 | Bacteria | 5265 |
| 277 | Ga0207695_10064803 | 3300025913 | Bacteria | 3760 |
| 278 | Ga0207695_10268787 | 3300025913 | Bacteria | 1601 |
| 279 | Ga0207671_10000062 | 3300025914 | Bacteria | 172081 |
| 280 | Ga0207693_10031088 | 3300025915 | Bacteria | 4218 |
| 281 | Ga0207693_10074929 | 3300025915 | Bacteria | 2650 |
| 282 | Ga0207693_10086792 | 3300025915 | Bacteria | 2452 |
| 283 | Ga0207693_10089518 | 3300025915 | Bacteria | 2412 |
| 284 | Ga0207693_10203420 | 3300025915 | Bacteria | 1557 |
| 285 | Ga0207663_10001971 | 3300025916 | Bacteria | 9723 |
| 286 | Ga0207663_10159959 | 3300025916 | Bacteria | 1589 |
| 287 | Ga0207660_10019365 | 3300025917 | Bacteria | 4549 |
| 288 | Ga0207662_10000549 | 3300025918 | Bacteria | 16650 |
| 289 | Ga0207657_10036185 | 3300025919 | Bacteria | 4420 |
| 290 | Ga0207657_10077022 | 3300025919 | Bacteria | 2812 |
| 291 | Ga0207649_10279134 | 3300025920 | Bacteria | 1214 |
| 292 | Ga0207646_10002700 | 3300025922 | Bacteria | 20809 |
| 293 | Ga0207646_10013903 | 3300025922 | Bacteria | 7675 |
| 294 | Ga0207646_10042422 | 3300025922 | Bacteria | 4086 |
| 295 | Ga0207646_10116530 | 3300025922 | Bacteria | 2399 |
| 296 | Ga0207646_10118443 | 3300025922 | Bacteria | 2379 |
| 297 | Ga0207646_10130058 | 3300025922 | Bacteria | 2265 |
| 298 | Ga0207646_10193529 | 3300025922 | Bacteria | 1837 |
| 299 | Ga0207646_10304766 | 3300025922 | Bacteria | 1439 |
| 300 | Ga0207681_10008323 | 3300025923 | Bacteria | 6342 |
| 301 | Ga0207681_10017696 | 3300025923 | Bacteria | 4479 |
| 302 | Ga0207681_10067452 | 3300025923 | Bacteria | 2481 |
| 303 | Ga0207681_10131930 | 3300025923 | Bacteria | 1848 |
| 304 | Ga0207694_10033093 | 3300025924 | Bacteria | 3960 |
| 305 | Ga0207650_10060275 | 3300025925 | Bacteria | 2832 |
| 306 | Ga0207659_10004844 | 3300025926 | Bacteria | 8155 |
| 307 | Ga0207659_10027836 | 3300025926 | Bacteria | 3832 |
| 308 | Ga0207659_10062433 | 3300025926 | Bacteria | 2689 |
| 309 | Ga0207659_10100943 | 3300025926 | Bacteria | 2175 |
| 310 | Ga0207687_10415263 | 3300025927 | Bacteria | 1109 |
| 311 | Ga0207700_10002713 | 3300025928 | Bacteria | 10206 |
| 312 | Ga0207700_10003156 | 3300025928 | Bacteria | 9513 |
| 313 | Ga0207700_10134569 | 3300025928 | Bacteria | 2023 |
| 314 | Ga0207700_10318956 | 3300025928 | Bacteria | 1346 |
| 315 | Ga0207664_10288501 | 3300025929 | Unclassified | 1441 |
| 316 | Ga0207644_10271754 | 3300025931 | Bacteria | 1358 |
| 317 | Ga0207690_10042928 | 3300025932 | Bacteria | 2973 |
| 318 | Ga0207690_10044918 | 3300025932 | Bacteria | 2915 |
| 319 | Ga0207706_10001787 | 3300025933 | Bacteria | 21123 |
| 320 | Ga0207706_10016964 | 3300025933 | Bacteria | 6569 |
| 321 | Ga0207706_10018565 | 3300025933 | Bacteria | 6258 |
| 322 | Ga0207706_10042612 | 3300025933 | Bacteria | 4023 |
| 323 | Ga0207686_10235540 | 3300025934 | Bacteria | 1330 |
| 324 | Ga0207709_10123818 | 3300025935 | Bacteria | 1750 |
| 325 | Ga0207670_10005486 | 3300025936 | Bacteria | 6968 |
| 326 | Ga0207670_10011447 | 3300025936 | Bacteria | 5152 |
| 327 | Ga0207670_10065279 | 3300025936 | Bacteria | 2497 |
| 328 | Ga0207669_10043953 | 3300025937 | Bacteria | 2620 |
| 329 | Ga0207669_10074439 | 3300025937 | Bacteria | 2147 |
| 330 | Ga0207669_10119200 | 3300025937 | Bacteria | 1787 |
| 331 | Ga0207704_10028118 | 3300025938 | Bacteria | 3115 |
| 332 | Ga0207704_10167283 | 3300025938 | Unclassified | 1572 |
| 333 | Ga0207665_10005229 | 3300025939 | Bacteria | 8669 |
| 334 | Ga0207665_10005429 | 3300025939 | Bacteria | 8510 |
| 335 | Ga0207665_10306060 | 3300025939 | Unclassified | 1189 |
| 336 | Ga0207691_10001303 | 3300025940 | Bacteria | 24901 |
| 337 | Ga0207689_10002826 | 3300025942 | Bacteria | 16029 |
| 338 | Ga0207689_10021207 | 3300025942 | Bacteria | 5462 |
| 339 | Ga0207661_10039508 | 3300025944 | Bacteria | 3703 |
| 340 | Ga0207679_10021619 | 3300025945 | Bacteria | 4366 |
| 341 | Ga0207679_10170781 | 3300025945 | Bacteria | 1790 |
| 342 | Ga0207651_10109956 | 3300025960 | Bacteria | 2066 |
| 343 | Ga0207712_10035457 | 3300025961 | Bacteria | 3390 |
| 344 | Ga0207712_10385136 | 3300025961 | Bacteria | 1175 |
| 345 | Ga0207668_10016132 | 3300025972 | Bacteria | 4656 |
| 346 | Ga0207668_10020650 | 3300025972 | Bacteria | 4189 |
| 347 | Ga0207668_10053426 | 3300025972 | Bacteria | 2800 |
| 348 | Ga0207658_10010445 | 3300025986 | Bacteria | 6306 |
| 349 | Ga0207658_10096481 | 3300025986 | Bacteria | 2306 |
| 350 | Ga0207658_10156236 | 3300025986 | Bacteria | 1864 |
| 351 | Ga0207677_10009851 | 3300026023 | Bacteria | 5387 |
| 352 | Ga0207677_10207344 | 3300026023 | Bacteria | 1562 |
| 353 | Ga0207703_10007514 | 3300026035 | Bacteria | 8650 |
| 354 | Ga0207703_10192433 | 3300026035 | Unclassified | 1807 |
| 355 | Ga0207678_10005675 | 3300026067 | Bacteria | 11151 |
| 356 | Ga0207678_10143482 | 3300026067 | Bacteria | 2038 |
| 357 | Ga0207708_10025496 | 3300026075 | Bacteria | 4473 |
| 358 | Ga0207702_10001092 | 3300026078 | Bacteria | 27756 |
| 359 | Ga0207702_10021652 | 3300026078 | Bacteria | 5323 |
| 360 | Ga0207641_10035705 | 3300026088 | Bacteria | 4144 |
| 361 | Ga0207648_10149035 | 3300026089 | Bacteria | 2064 |
| 362 | Ga0207676_10018908 | 3300026095 | Bacteria | 5017 |
| 363 | Ga0207675_100016560 | 3300026118 | Bacteria | 6884 |
| 364 | Ga0207675_100031844 | 3300026118 | Bacteria | 4912 |
| 365 | Ga0207683_10022659 | 3300026121 | Bacteria | 5394 |
| 366 | Ga0207683_10201312 | 3300026121 | Bacteria | 1810 |
| 367 | Ga0207698_10116862 | 3300026142 | Bacteria | 2249 |
| 368 | Ga0207698_10123477 | 3300026142 | Bacteria | 2197 |
| 369 | Ga0207698_10227532 | 3300026142 | Bacteria | 1690 |
| 370 | Ga0207428_10012852 | 3300027907 | Bacteria | 7339 |
| 371 | Ga0268266_10019532 | 3300028379 | Bacteria | 5775 |
| 372 | Ga0268266_10127746 | 3300028379 | Bacteria | 2270 |
| 373 | Ga0268266_10168157 | 3300028379 | Bacteria | 1988 |
| 374 | Ga0268266_10305348 | 3300028379 | Bacteria | 1486 |
| 375 | Ga0268264_10011548 | 3300028381 | Bacteria | 7296 |
| 376 | Ga0268264_10291254 | 3300028381 | Bacteria | 1533 |
| 377 | Ga0265337_1000553 | 3300028556 | Bacteria | 19769 |
| 378 | Ga0265326_10006663 | 3300028558 | Unclassified | 3572 |
| 379 | Ga0265319_1000004 | 3300028563 | Bacteria | 305085 |
| 380 | Ga0265319_1000080 | 3300028563 | Bacteria | 75462 |
| 381 | Ga0265319_1016514 | 3300028563 | Bacteria | 2830 |
| 382 | Ga0265319_1047688 | 3300028563 | Bacteria | 1424 |
| 383 | Ga0265334_10001707 | 3300028573 | Bacteria | 10492 |
| 384 | Ga0265318_10054599 | 3300028577 | Bacteria | 1496 |
| 385 | Ga0265323_10000587 | 3300028653 | Bacteria | 20017 |
| 386 | Ga0265323_10001529 | 3300028653 | Bacteria | 11231 |
| 387 | Ga0265323_10002916 | 3300028653 | Bacteria | 7655 |
| 388 | Ga0265323_10012908 | 3300028653 | Bacteria | 3340 |
| 389 | Ga0265323_10013672 | 3300028653 | Bacteria | 3230 |
| 390 | Ga0265323_10020765 | 3300028653 | Bacteria | 2524 |
| 391 | Ga0265323_10032891 | 3300028653 | Bacteria | 1923 |
| 392 | Ga0265322_10000722 | 3300028654 | Bacteria | 12084 |
| 393 | Ga0265322_10001433 | 3300028654 | Bacteria | 7846 |
| 394 | Ga0265336_10000513 | 3300028666 | Bacteria | 22444 |
| 395 | Ga0265336_10015766 | 3300028666 | Bacteria | 2480 |
| 396 | Ga0265338_10000009 | 3300028800 | Bacteria | 448611 |
| 397 | Ga0265338_10000016 | 3300028800 | Bacteria | 347424 |
| 398 | Ga0265338_10000305 | 3300028800 | Bacteria | 88659 |
| 399 | Ga0265338_10000382 | 3300028800 | Bacteria | 79298 |
| 400 | Ga0265338_10003154 | 3300028800 | Bacteria | 23528 |
| 401 | Ga0265338_10007112 | 3300028800 | Bacteria | 14017 |
| 402 | Ga0265338_10008854 | 3300028800 | Bacteria | 12136 |
| 403 | Ga0265338_10011655 | 3300028800 | Bacteria | 10126 |
| 404 | Ga0265338_10017673 | 3300028800 | Bacteria | 7671 |
| 405 | Ga0265338_10020306 | 3300028800 | Bacteria | 6999 |
| 406 | Ga0265338_10025374 | 3300028800 | Bacteria | 6016 |
| 407 | Ga0265338_10039916 | 3300028800 | Bacteria | 4417 |
| 408 | Ga0265338_10041374 | 3300028800 | Bacteria | 4310 |
| 409 | Ga0265338_10057616 | 3300028800 | Bacteria | 3435 |
| 410 | Ga0265338_10059968 | 3300028800 | Bacteria | 3348 |
| 411 | Ga0265338_10093520 | 3300028800 | Bacteria | 2477 |
| 412 | Ga0265338_10167311 | 3300028800 | Bacteria | 1691 |
| 413 | Ga0265338_10182992 | 3300028800 | Bacteria | 1595 |
| 414 | Ga0265338_10225015 | 3300028800 | Bacteria | 1399 |
| 415 | Ga0265324_10000470 | 3300029957 | Bacteria | 28358 |
| 416 | Ga0265324_10008996 | 3300029957 | Bacteria | 3925 |
| 417 | Ga0265324_10026380 | 3300029957 | Bacteria | 2057 |
| 418 | Ga0265324_10048159 | 3300029957 | Bacteria | 1466 |
| 419 | Ga0265330_10001245 | 3300031235 | Bacteria | 14912 |
| 420 | Ga0265330_10024640 | 3300031235 | Bacteria | 2729 |
| 421 | Ga0265330_10046423 | 3300031235 | Bacteria | 1914 |
| 422 | Ga0265332_10050831 | 3300031238 | Bacteria | 1781 |
| 423 | Ga0265320_10000823 | 3300031240 | Bacteria | 23388 |
| 424 | Ga0265320_10003116 | 3300031240 | Bacteria | 11256 |
| 425 | Ga0265320_10007793 | 3300031240 | Bacteria | 6614 |
| 426 | Ga0265320_10011010 | 3300031240 | Bacteria | 5346 |
| 427 | Ga0265320_10020278 | 3300031240 | Bacteria | 3607 |
| 428 | Ga0265320_10021739 | 3300031240 | Unclassified | 3445 |
| 429 | Ga0265320_10033975 | 3300031240 | Bacteria | 2599 |
| 430 | Ga0265320_10096045 | 3300031240 | Bacteria | 1369 |
| 431 | Ga0265325_10004610 | 3300031241 | Bacteria | 8656 |
| 432 | Ga0265340_10001439 | 3300031247 | Bacteria | 13655 |
| 433 | Ga0265339_10018464 | 3300031249 | Bacteria | 4109 |
| 434 | Ga0265327_10000029 | 3300031251 | Bacteria | 352607 |
| 435 | Ga0265327_10000709 | 3300031251 | Bacteria | 52606 |
| 436 | Ga0265316_10012560 | 3300031344 | Bacteria | 7585 |
| 437 | Ga0265316_10018306 | 3300031344 | Bacteria | 6022 |
| 438 | Ga0265316_10025719 | 3300031344 | Bacteria | 4908 |
| 439 | Ga0265316_10026612 | 3300031344 | Bacteria | 4807 |
| 440 | Ga0265316_10044070 | 3300031344 | Bacteria | 3550 |
| 441 | Ga0265316_10066114 | 3300031344 | Bacteria | 2799 |
| 442 | Ga0265313_10000385 | 3300031595 | Bacteria | 47503 |
| 443 | Ga0265313_10005257 | 3300031595 | Bacteria | 9585 |
| 444 | Ga0265313_10015567 | 3300031595 | Bacteria | 4419 |
| 445 | Ga0265313_10031656 | 3300031595 | Bacteria | 2709 |
| 446 | Ga0265313_10035342 | 3300031595 | Bacteria | 2517 |
| 447 | Ga0265313_10092410 | 3300031595 | Bacteria | 1356 |
| 448 | Ga0265314_10023363 | 3300031711 | Bacteria | 4715 |
| 449 | Ga0265314_10026658 | 3300031711 | Bacteria | 4338 |
| 450 | Ga0265314_10132046 | 3300031711 | Bacteria | 1556 |
| 451 | Ga0265342_10073766 | 3300031712 | Bacteria | 1984 |
| 452 | Ga0307410_10107412 | 3300031852 | Bacteria | 2013 |
| 453 | Ga0373940_0022985 | 3300035088 | Bacteria | 1606 |
| 454 | Ga0373923_0046800 | 3300035111 | Bacteria | 1801 |
| 455 | Ga0373957_0078976 | 3300035120 | Bacteria | 1297 |
| 456 | Ga0373946_0076622 | 3300035171 | Bacteria | 1456 |
| 457 | Ga0373931_0098230 | 3300035691 | Bacteria | 1643 |
| 458 | Ga0373935_0004881 | 3300035692 | Bacteria | 7882 |
| 459 | Ga0373927_0200670 | 3300035695 | Bacteria | 1310 |
| 460 | Ga0373933_0353585 | 3300035724 | Bacteria | 955 |
| 461 | Ga0373947_0166343 | 3300035725 | Unclassified | 1429 |
| 462 | Ga0373947_0176939 | 3300035725 | Bacteria | 1387 |
| 463 | Ga0373937_0117781 | 3300036401 | Unclassified | 2474 |
| 464 | Ga0373937_0179878 | 3300036401 | Unclassified | 1986 |
| 465 | Ga0373937_0368727 | 3300036401 | Bacteria | 1361 |
| 466 | Ga0373937_0390149 | 3300036401 | Bacteria | 1321 |
| 467 | Ga0395899_0131825 | 3300037312 | Bacteria | 1784 |
| 468 | Ga0395900_0022806 | 3300037418 | Bacteria | 6405 |
| 469 | Ga0395900_0032121 | 3300037418 | Bacteria | 5397 |
| 470 | Ga0395898_0059428 | 3300037466 | Bacteria | 3719 |
| 471 | Ga0395898_0060691 | 3300037466 | Bacteria | 3674 |
| 472 | Ga0395898_0602556 | 3300037466 | Bacteria | 1041 |
| 473 | Ga0436364_0565274 | 3300037853 | Bacteria | 1538 |
| 474 | Ga0395901_0001234 | 3300038443 | Bacteria | 27294 |
| 475 | Ga0395901_0005808 | 3300038443 | Bacteria | 12501 |
| 476 | Ga0436365_0088627 | 3300039437 | Bacteria | 5125 |
| 477 | Ga0436365_0428430 | 3300039437 | Bacteria | 9841 |
| 478 | Ga0439455_0004416 | 3300042012 | Bacteria | 2785 |
| 479 | Ga0451577_0513404 | 3300042876 | Bacteria | 1088 |
| 480 | Ga0453683_0011603 | 3300044673 | Bacteria | 5804 |
| 481 | Ga0451576_0001932 | 3300045051 | Bacteria | 33128 |
| 482 | Ga0451576_0065872 | 3300045051 | Bacteria | 3771 |
| 483 | Ga0451576_0084753 | 3300045051 | Bacteria | 3297 |
| 484 | Ga0451576_0096490 | 3300045051 | Bacteria | 3075 |
| 485 | Ga0451576_0212502 | 3300045051 | Bacteria | 2020 |
| 486 | Ga0451576_0270247 | 3300045051 | Bacteria | 1777 |
| 487 | Ga0451576_0516443 | 3300045051 | Bacteria | 1255 |
| 488 | Ga0466967_0233987 | 3300045976 | Unclassified | 1750 |
| 489 | Ga0495592_0066630 | 3300046454 | Bacteria | 2634 |
| 490 | Ga0495641_0060442 | 3300046461 | Bacteria | 1712 |
| 491 | Ga0495582_0021898 | 3300046473 | Bacteria | 3497 |
| 492 | Ga0495639_0194142 | 3300046475 | Bacteria | 992 |
| 493 | Ga0495628_0093711 | 3300046516 | Bacteria | 2322 |
| 494 | Ga0495630_0000041 | 3300046517 | Bacteria | 104947 |
| 495 | Ga0495630_0031492 | 3300046517 | Bacteria | 3949 |
| 496 | Ga0495630_0047276 | 3300046517 | Bacteria | 3218 |
| 497 | Ga0495630_0383603 | 3300046517 | Bacteria | 1076 |
| 498 | Ga0495666_0041901 | 3300046526 | Bacteria | 2215 |
| 499 | Ga0495640_0081674 | 3300046533 | Bacteria | 2148 |
| 500 | Ga0495586_0000001 | 3300046535 | Bacteria | 231314 |
| 501 | Ga0495586_0001421 | 3300046535 | Bacteria | 13244 |
| 502 | Ga0495598_0003894 | 3300046537 | Bacteria | 3199 |
| 503 | Ga0495645_0092789 | 3300046543 | Bacteria | 2155 |
| 504 | Ga0495667_0014300 | 3300046559 | Bacteria | 5361 |
| 505 | Ga0495667_0087804 | 3300046559 | Bacteria | 2016 |
| 506 | Ga0495667_0131042 | 3300046559 | Bacteria | 1617 |
| 507 | Ga0495634_0022051 | 3300046642 | Bacteria | 4489 |
| 508 | Ga0495599_0039722 | 3300046678 | Bacteria | 2956 |
| 509 | Ga0495623_0072989 | 3300046679 | Bacteria | 2133 |
| 510 | Ga0495647_0030754 | 3300046681 | Bacteria | 1994 |
| 511 | Ga0495658_0221270 | 3300046683 | Bacteria | 1185 |
| 512 | Ga0495613_0000924 | 3300046689 | Bacteria | 22535 |
| 513 | Ga0495613_0048230 | 3300046689 | Bacteria | 3145 |
| 514 | Ga0495581_0209430 | 3300047315 | Bacteria | 1140 |
| 515 | Ga0495604_0092622 | 3300047317 | Bacteria | 2238 |
| 516 | Ga0495674_0005088 | 3300047319 | Bacteria | 12631 |
| 517 | Ga0495676_0017861 | 3300047321 | Bacteria | 6262 |
| 518 | Ga0495680_0157999 | 3300047322 | Bacteria | 1648 |
| 519 | Ga0495680_0358536 | 3300047322 | Bacteria | 1014 |
| 520 | Ga0495602_0255991 | 3300048088 | Bacteria | 1301 |
| 521 | Ga0496100_0028170 | 3300048903 | Bacteria | 3463 |
| 522 | Ga0496100_0072360 | 3300048903 | Bacteria | 2304 |
| 523 | Ga0496101_0166252 | 3300048904 | Bacteria | 1694 |
| 524 | Ga0496101_0195275 | 3300048904 | Bacteria | 1563 |
| 525 | Ga0496102_0044485 | 3300048905 | Bacteria | 4030 |
| 526 | Ga0496102_0150582 | 3300048905 | Bacteria | 2186 |
| 527 | Ga0496103_0076315 | 3300048906 | Bacteria | 2103 |
| 528 | Ga0496103_0099684 | 3300048906 | Bacteria | 1838 |
| 529 | Ga0496104_0180378 | 3300048907 | Bacteria | 2022 |
| 530 | Ga0496104_0254731 | 3300048907 | Bacteria | 1668 |
| 531 | Ga0496106_0051439 | 3300048909 | Bacteria | 3106 |
| 532 | Ga0496108_0364780 | 3300048911 | Bacteria | 1261 |
| 533 | Ga0496110_0159754 | 3300048913 | Bacteria | 2043 |
| 534 | Ga0496112_0031005 | 3300048915 | Bacteria | 5181 |
| 535 | Ga0496112_0041724 | 3300048915 | Bacteria | 4490 |
| 536 | Ga0496112_0109452 | 3300048915 | Bacteria | 2733 |
| 537 | Ga0496112_0180624 | 3300048915 | Bacteria | 2074 |
| 538 | Ga0496112_0569330 | 3300048915 | Bacteria | 1066 |
| 539 | Ga0496113_0029349 | 3300048916 | Bacteria | 3970 |
| 540 | Ga0496113_0099631 | 3300048916 | Bacteria | 2251 |
| 541 | Ga0496113_0137166 | 3300048916 | Bacteria | 1923 |
| 542 | Ga0496115_0002359 | 3300048918 | Bacteria | 13546 |
| 543 | Ga0496115_0003943 | 3300048918 | Bacteria | 10697 |
| 544 | Ga0496115_0017508 | 3300048918 | Bacteria | 5481 |
| 545 | Ga0496115_0031446 | 3300048918 | Bacteria | 4184 |
| 546 | Ga0496115_0083338 | 3300048918 | Bacteria | 2606 |
| 547 | Ga0501031_0000004 | 3300049568 | Bacteria | 202781 |
| 548 | Ga0501031_0052526 | 3300049568 | Bacteria | 2655 |
| 549 | Ga0501032_0001747 | 3300049569 | Bacteria | 17137 |
| 550 | Ga0501033_0000212 | 3300049570 | Bacteria | 55695 |
| 551 | Ga0501033_0020520 | 3300049570 | Bacteria | 4992 |
| 552 | Ga0501034_0153609 | 3300049571 | Bacteria | 2277 |
| 553 | Ga0501034_0179178 | 3300049571 | Bacteria | 2084 |
| 554 | Ga0501036_0077706 | 3300049572 | Bacteria | 2808 |
| 555 | Ga0501036_0097402 | 3300049572 | Bacteria | 2486 |
| 556 | Ga0501038_0001965 | 3300049574 | Bacteria | 18969 |
| 557 | Ga0501039_0013681 | 3300049575 | Bacteria | 6205 |
| 558 | Ga0501042_0004559 | 3300049578 | Bacteria | 8840 |
| 559 | Ga0501043_0080320 | 3300049579 | Bacteria | 2562 |
| 560 | Ga0501043_0186667 | 3300049579 | Bacteria | 1614 |
| 561 | Ga0501046_0010345 | 3300049580 | Bacteria | 8018 |
| 562 | Ga0501047_0001901 | 3300049581 | Bacteria | 20079 |
| 563 | Ga0501047_0017386 | 3300049581 | Bacteria | 6886 |
| 564 | Ga0501047_0446848 | 3300049581 | Bacteria | 1122 |
| 565 | Ga0501070_0081888 | 3300049586 | Bacteria | 2671 |
| 566 | Ga0501080_0110769 | 3300049742 | Bacteria | 2544 |
| 567 | Ga0501080_0116706 | 3300049742 | Bacteria | 2474 |
| 568 | Ga0501083_0003937 | 3300049744 | Bacteria | 10435 |
| 569 | Ga0501083_0012768 | 3300049744 | Bacteria | 5875 |
| 570 | Ga0501035_0000780 | 3300049822 | Bacteria | 34053 |
| 571 | Ga0501035_0005405 | 3300049822 | Bacteria | 12074 |
| 572 | Ga0501035_0039230 | 3300049822 | Unclassified | 4286 |
| 573 | Ga0501035_0098327 | 3300049822 | Bacteria | 2569 |
| 574 | Ga0501044_0000226 | 3300049823 | Bacteria | 71150 |
| 575 | Ga0501044_0001072 | 3300049823 | Bacteria | 32802 |
| 576 | Ga0501044_0013063 | 3300049823 | Bacteria | 8986 |
| 577 | Ga0501044_0019081 | 3300049823 | Bacteria | 7341 |
| 578 | nmdc:mga05p37_2252_c1 | 3300050507 | Bacteria | 12666 |
| 579 | nmdc:mga09592_136355_c1 | 3300050508 | Bacteria | 2114 |
| 580 | nmdc:mga08y16_124908_c1 | 3300050511 | Bacteria | 2677 |
| 581 | nmdc:mga08y16_142519_c1 | 3300050511 | Bacteria | 2491 |
| 582 | nmdc:mga08y16_88040_c1 | 3300050511 | Bacteria | 3236 |
| 583 | nmdc:mga0rr50_93603_c1 | 3300050513 | Bacteria | 2345 |
| 584 | nmdc:mga08x19_203823_c1 | 3300050514 | Bacteria | 1356 |
| 585 | nmdc:mga0a205_3519_c1 | 3300050515 | Bacteria | 13993 |
| 586 | Ga0495601_0088048 | 3300053077 | Bacteria | 1996 |
| 587 | Ga0495595_0053308 | 3300053084 | Bacteria | 1879 |
| 588 | Ga0500592_007184 | 3300053116 | Bacteria | 1773 |
| 589 | Ga0501082_0071871 | 3300060353 | Bacteria | 2980 |
| 590 | Ga0501082_0201450 | 3300060353 | Bacteria | 1732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005356 | Ga0070674_100032634 | Ga0070674_1000326343 | 273 |
| 2 | 3300025937 | Ga0207669_10043953 | Ga0207669_100439532 | 273 |
| 3 | 3300037466 | Ga0395898_0060691 | Ga0395898_0060691_24_902 | 276 |
| 4 | 3300038443 | Ga0395901_0001234 | Ga0395901_0001234_3808_4686 | 276 |
| 5 | 3300048918 | Ga0496115_0083338 | Ga0496115_0083338_1715_2593 | 276 |
| 6 | 3300050511 | nmdc:mga08y16_142519_c1 | nmdc:mga08y16_142519_c1_1094_1972 | 277 |
| 7 | 3300028800 | Ga0265338_10057616 | Ga0265338_100576163 | 278 |
| 8 | 3300031241 | Ga0265325_10004610 | Ga0265325_100046108 | 278 |
| 9 | 3300031249 | Ga0265339_10018464 | Ga0265339_100184642 | 278 |
| 10 | 3300031344 | Ga0265316_10018306 | Ga0265316_100183063 | 278 |
| 11 | 3300031711 | Ga0265314_10132046 | Ga0265314_101320462 | 278 |
| 12 | 3300028653 | Ga0265323_10032891 | Ga0265323_100328912 | 280 |
| 13 | 3300046537 | Ga0495598_0003894 | Ga0495598_0003894_1834_2724 | 281 |
| 14 | 3300028556 | Ga0265337_1000553 | Ga0265337_100055320 | 282 |
| 15 | 3300028666 | Ga0265336_10000513 | Ga0265336_1000051321 | 282 |
| 16 | 3300028800 | Ga0265338_10003154 | Ga0265338_100031544 | 282 |
| 17 | 3300045051 | Ga0451576_0270247 | Ga0451576_0270247_21_875 | 284 |
| 18 | 3300031240 | Ga0265320_10096045 | Ga0265320_100960452 | 286 |
| 19 | 3300036401 | Ga0373937_0390149 | Ga0373937_0390149_49_921 | 290 |
| 20 | 3300005563 | Ga0068855_100015366 | Ga0068855_1000153663 | 291 |
| 21 | 3300035724 | Ga0373933_0353585 | Ga0373933_0353585_53_928 | 291 |
| 22 | 3300046475 | Ga0495639_0194142 | Ga0495639_0194142_95_970 | 291 |
| 23 | 3300047315 | Ga0495581_0209430 | Ga0495581_0209430_11_886 | 291 |
| 24 | 3300005353 | Ga0070669_100004046 | Ga0070669_1000040465 | 292 |
| 25 | 3300005354 | Ga0070675_100005748 | Ga0070675_1000057485 | 292 |
| 26 | 3300005457 | Ga0070662_100017224 | Ga0070662_1000172244 | 292 |
| 27 | 3300005535 | Ga0070684_100011106 | Ga0070684_1000111068 | 292 |
| 28 | 3300025933 | Ga0207706_10018565 | Ga0207706_100185655 | 292 |
| 29 | 3300031711 | Ga0265314_10023363 | Ga0265314_100233633 | 292 |
| 30 | 3300046559 | Ga0495667_0087804 | Ga0495667_0087804_1119_1997 | 292 |
| 31 | 3300046678 | Ga0495599_0039722 | Ga0495599_0039722_40_918 | 292 |
| 32 | 3300046683 | Ga0495658_0221270 | Ga0495658_0221270_286_1164 | 292 |
| 33 | 3300048906 | Ga0496103_0099684 | Ga0496103_0099684_41_919 | 292 |
| 34 | 3300048918 | Ga0496115_0031446 | Ga0496115_0031446_14_892 | 292 |
| 35 | 3300053077 | Ga0495601_0088048 | Ga0495601_0088048_1079_1957 | 292 |
| 36 | 3300005530 | Ga0070679_100151360 | Ga0070679_1001513602 | 293 |
| 37 | 3300025922 | Ga0207646_10118443 | Ga0207646_101184432 | 293 |
| 38 | 3300048913 | Ga0496110_0159754 | Ga0496110_0159754_57_1040 | 293 |
| 39 | 3300048916 | Ga0496113_0099631 | Ga0496113_0099631_564_1547 | 293 |
| 40 | 3300005445 | Ga0070708_100441319 | Ga0070708_1004413191 | 294 |
| 41 | 3300005614 | Ga0068856_100000067 | Ga0068856_10000006722 | 295 |
| 42 | 3300026078 | Ga0207702_10001092 | Ga0207702_1000109222 | 295 |
| 43 | 3300028800 | Ga0265338_10041374 | Ga0265338_100413745 | 295 |
| 44 | 3300045051 | Ga0451576_0212502 | Ga0451576_0212502_548_1513 | 295 |
| 45 | 3300005468 | Ga0070707_100233875 | Ga0070707_1002338751 | 296 |
| 46 | 3300005563 | Ga0068855_100030442 | Ga0068855_1000304429 | 296 |
| 47 | 3300025922 | Ga0207646_10130058 | Ga0207646_101300583 | 296 |
| 48 | 3300005439 | Ga0070711_100074335 | Ga0070711_1000743353 | 297 |
| 49 | 3300005440 | Ga0070705_100028900 | Ga0070705_1000289002 | 297 |
| 50 | 3300005467 | Ga0070706_100031117 | Ga0070706_1000311174 | 297 |
| 51 | 3300049568 | Ga0501031_0052526 | Ga0501031_0052526_1368_2309 | 297 |
| 52 | 3300049569 | Ga0501032_0001747 | Ga0501032_0001747_15959_16900 | 297 |
| 53 | 3300049570 | Ga0501033_0020520 | Ga0501033_0020520_3684_4625 | 297 |
| 54 | 3300049571 | Ga0501034_0179178 | Ga0501034_0179178_776_1717 | 297 |
| 55 | 3300049572 | Ga0501036_0077706 | Ga0501036_0077706_1521_2462 | 297 |
| 56 | 3300049574 | Ga0501038_0001965 | Ga0501038_0001965_753_1694 | 297 |
| 57 | 3300049575 | Ga0501039_0013681 | Ga0501039_0013681_2846_3787 | 297 |
| 58 | 3300049578 | Ga0501042_0004559 | Ga0501042_0004559_588_1529 | 297 |
| 59 | 3300049581 | Ga0501047_0017386 | Ga0501047_0017386_5578_6519 | 297 |
| 60 | 3300049586 | Ga0501070_0081888 | Ga0501070_0081888_514_1455 | 297 |
| 61 | 3300049742 | Ga0501080_0116706 | Ga0501080_0116706_495_1436 | 297 |
| 62 | 3300049822 | Ga0501035_0005405 | Ga0501035_0005405_7759_8700 | 297 |
| 63 | 3300049823 | Ga0501044_0019081 | Ga0501044_0019081_6033_6974 | 297 |
| 64 | 3300060353 | Ga0501082_0071871 | Ga0501082_0071871_249_1190 | 297 |
| 65 | 3300005328 | Ga0070676_10005125 | Ga0070676_100051255 | 298 |
| 66 | 3300005330 | Ga0070690_100012793 | Ga0070690_1000127932 | 298 |
| 67 | 3300005338 | Ga0068868_100017480 | Ga0068868_1000174801 | 298 |
| 68 | 3300005340 | Ga0070689_100021708 | Ga0070689_1000217084 | 298 |
| 69 | 3300005347 | Ga0070668_100012876 | Ga0070668_1000128763 | 298 |
| 70 | 3300005457 | Ga0070662_100012551 | Ga0070662_1000125513 | 298 |
| 71 | 3300005467 | Ga0070706_100001327 | Ga0070706_10000132713 | 298 |
| 72 | 3300005843 | Ga0068860_100122620 | Ga0068860_1001226202 | 298 |
| 73 | 3300025271 | Ga0207666_1004174 | Ga0207666_10041741 | 298 |
| 74 | 3300025910 | Ga0207684_10001353 | Ga0207684_1000135314 | 298 |
| 75 | 3300025926 | Ga0207659_10027836 | Ga0207659_100278365 | 298 |
| 76 | 3300025933 | Ga0207706_10001787 | Ga0207706_1000178720 | 298 |
| 77 | 3300025936 | Ga0207670_10011447 | Ga0207670_100114473 | 298 |
| 78 | 3300025972 | Ga0207668_10020650 | Ga0207668_100206502 | 298 |
| 79 | 3300025986 | Ga0207658_10010445 | Ga0207658_100104452 | 298 |
| 80 | 3300026023 | Ga0207677_10009851 | Ga0207677_100098515 | 298 |
| 81 | 3300026035 | Ga0207703_10192433 | Ga0207703_101924332 | 298 |
| 82 | 3300042876 | Ga0451577_0513404 | Ga0451577_0513404_66_998 | 298 |
| 83 | 3300044673 | Ga0453683_0011603 | Ga0453683_0011603_294_1193 | 298 |
| 84 | 3300045051 | Ga0451576_0001932 | Ga0451576_0001932_18890_19822 | 298 |
| 85 | 3300060353 | Ga0501082_0201450 | Ga0501082_0201450_741_1676 | 298 |
| 86 | 3300006844 | Ga0075428_100217448 | Ga0075428_1002174482 | 299 |
| 87 | 3300006871 | Ga0075434_100141318 | Ga0075434_1001413182 | 299 |
| 88 | 3300028800 | Ga0265338_10000009 | Ga0265338_10000009155 | 299 |
| 89 | 3300005328 | Ga0070676_10061401 | Ga0070676_100614012 | 300 |
| 90 | 3300005330 | Ga0070690_100184554 | Ga0070690_1001845542 | 300 |
| 91 | 3300005335 | Ga0070666_10017358 | Ga0070666_100173582 | 300 |
| 92 | 3300005338 | Ga0068868_100022079 | Ga0068868_1000220793 | 300 |
| 93 | 3300005343 | Ga0070687_100018808 | Ga0070687_1000188083 | 300 |
| 94 | 3300005344 | Ga0070661_100181896 | Ga0070661_1001818962 | 300 |
| 95 | 3300005353 | Ga0070669_100015181 | Ga0070669_1000151812 | 300 |
| 96 | 3300005353 | Ga0070669_100214248 | Ga0070669_1002142482 | 300 |
| 97 | 3300005355 | Ga0070671_100186576 | Ga0070671_1001865762 | 300 |
| 98 | 3300005355 | Ga0070671_100189558 | Ga0070671_1001895582 | 300 |
| 99 | 3300005356 | Ga0070674_100018632 | Ga0070674_1000186322 | 300 |
| 100 | 3300005356 | Ga0070674_100150950 | Ga0070674_1001509501 | 300 |
| 101 | 3300005365 | Ga0070688_100021608 | Ga0070688_1000216082 | 300 |
| 102 | 3300005366 | Ga0070659_100058634 | Ga0070659_1000586343 | 300 |
| 103 | 3300005438 | Ga0070701_10036622 | Ga0070701_100366223 | 300 |
| 104 | 3300005444 | Ga0070694_100174695 | Ga0070694_1001746952 | 300 |
| 105 | 3300005456 | Ga0070678_100012839 | Ga0070678_1000128392 | 300 |
| 106 | 3300005457 | Ga0070662_100036429 | Ga0070662_1000364293 | 300 |
| 107 | 3300005466 | Ga0070685_10022603 | Ga0070685_100226033 | 300 |
| 108 | 3300005544 | Ga0070686_100026204 | Ga0070686_1000262042 | 300 |
| 109 | 3300005564 | Ga0070664_100004288 | Ga0070664_1000042888 | 300 |
| 110 | 3300005577 | Ga0068857_100080005 | Ga0068857_1000800052 | 300 |
| 111 | 3300005616 | Ga0068852_100080149 | Ga0068852_1000801492 | 300 |
| 112 | 3300005617 | Ga0068859_100001429 | Ga0068859_10000142912 | 300 |
| 113 | 3300005617 | Ga0068859_100168674 | Ga0068859_1001686742 | 300 |
| 114 | 3300005618 | Ga0068864_100105311 | Ga0068864_1001053112 | 300 |
| 115 | 3300005840 | Ga0068870_10000669 | Ga0068870_100006696 | 300 |
| 116 | 3300005843 | Ga0068860_100133189 | Ga0068860_1001331892 | 300 |
| 117 | 3300005844 | Ga0068862_100017802 | Ga0068862_1000178024 | 300 |
| 118 | 3300006358 | Ga0068871_100233205 | Ga0068871_1002332052 | 300 |
| 119 | 3300006852 | Ga0075433_10071106 | Ga0075433_100711063 | 300 |
| 120 | 3300006871 | Ga0075434_100003234 | Ga0075434_10000323414 | 300 |
| 121 | 3300006880 | Ga0075429_100157479 | Ga0075429_1001574793 | 300 |
| 122 | 3300006931 | Ga0097620_100001429 | Ga0097620_10000142912 | 300 |
| 123 | 3300006931 | Ga0097620_100168667 | Ga0097620_1001686673 | 300 |
| 124 | 3300007076 | Ga0075435_100025147 | Ga0075435_1000251476 | 300 |
| 125 | 3300009094 | Ga0111539_10013426 | Ga0111539_100134262 | 300 |
| 126 | 3300009094 | Ga0111539_10096732 | Ga0111539_100967323 | 300 |
| 127 | 3300009553 | Ga0105249_10026632 | Ga0105249_100266322 | 300 |
| 128 | 3300013306 | Ga0163162_10078748 | Ga0163162_100787482 | 300 |
| 129 | 3300014326 | Ga0157380_10008103 | Ga0157380_100081039 | 300 |
| 130 | 3300014326 | Ga0157380_10092815 | Ga0157380_100928152 | 300 |
| 131 | 3300014745 | Ga0157377_10070182 | Ga0157377_100701822 | 300 |
| 132 | 3300014968 | Ga0157379_10158765 | Ga0157379_101587652 | 300 |
| 133 | 3300017792 | Ga0163161_10018478 | Ga0163161_100184783 | 300 |
| 134 | 3300025315 | Ga0207697_10003386 | Ga0207697_100033866 | 300 |
| 135 | 3300025893 | Ga0207682_10009256 | Ga0207682_100092562 | 300 |
| 136 | 3300025901 | Ga0207688_10005226 | Ga0207688_100052265 | 300 |
| 137 | 3300025907 | Ga0207645_10004600 | Ga0207645_100046004 | 300 |
| 138 | 3300025907 | Ga0207645_10033189 | Ga0207645_100331893 | 300 |
| 139 | 3300025908 | Ga0207643_10009182 | Ga0207643_100091826 | 300 |
| 140 | 3300025918 | Ga0207662_10000549 | Ga0207662_100005493 | 300 |
| 141 | 3300025920 | Ga0207649_10279134 | Ga0207649_102791342 | 300 |
| 142 | 3300025923 | Ga0207681_10017696 | Ga0207681_100176964 | 300 |
| 143 | 3300025923 | Ga0207681_10131930 | Ga0207681_101319302 | 300 |
| 144 | 3300025926 | Ga0207659_10004844 | Ga0207659_100048443 | 300 |
| 145 | 3300025926 | Ga0207659_10062433 | Ga0207659_100624333 | 300 |
| 146 | 3300025931 | Ga0207644_10271754 | Ga0207644_102717542 | 300 |
| 147 | 3300025932 | Ga0207690_10042928 | Ga0207690_100429283 | 300 |
| 148 | 3300025933 | Ga0207706_10042612 | Ga0207706_100426123 | 300 |
| 149 | 3300025936 | Ga0207670_10065279 | Ga0207670_100652792 | 300 |
| 150 | 3300025937 | Ga0207669_10074439 | Ga0207669_100744392 | 300 |
| 151 | 3300025937 | Ga0207669_10119200 | Ga0207669_101192002 | 300 |
| 152 | 3300025940 | Ga0207691_10001303 | Ga0207691_1000130313 | 300 |
| 153 | 3300025942 | Ga0207689_10002826 | Ga0207689_1000282614 | 300 |
| 154 | 3300025945 | Ga0207679_10021619 | Ga0207679_100216192 | 300 |
| 155 | 3300025960 | Ga0207651_10109956 | Ga0207651_101099562 | 300 |
| 156 | 3300025961 | Ga0207712_10385136 | Ga0207712_103851362 | 300 |
| 157 | 3300025986 | Ga0207658_10156236 | Ga0207658_101562362 | 300 |
| 158 | 3300026089 | Ga0207648_10149035 | Ga0207648_101490352 | 300 |
| 159 | 3300026118 | Ga0207675_100031844 | Ga0207675_1000318442 | 300 |
| 160 | 3300026121 | Ga0207683_10201312 | Ga0207683_102013122 | 300 |
| 161 | 3300026142 | Ga0207698_10227532 | Ga0207698_102275322 | 300 |
| 162 | 3300027907 | Ga0207428_10012852 | Ga0207428_100128525 | 300 |
| 163 | 3300028381 | Ga0268264_10011548 | Ga0268264_100115489 | 300 |
| 164 | 3300035088 | Ga0373940_0022985 | Ga0373940_0022985_469_1428 | 300 |
| 165 | 3300048915 | Ga0496112_0569330 | Ga0496112_0569330_14_982 | 300 |
| 166 | 3300050508 | nmdc:mga09592_136355_c1 | nmdc:mga09592_136355_c1_193_1152 | 300 |
| 167 | 3300050511 | nmdc:mga08y16_124908_c1 | nmdc:mga08y16_124908_c1_1155_2111 | 300 |
| 168 | 3300050511 | nmdc:mga08y16_88040_c1 | nmdc:mga08y16_88040_c1_1082_2041 | 300 |
| 169 | 3300050513 | nmdc:mga0rr50_93603_c1 | nmdc:mga0rr50_93603_c1_908_1867 | 300 |
| 170 | 3300050515 | nmdc:mga0a205_3519_c1 | nmdc:mga0a205_3519_c1_2096_3055 | 300 |
| 171 | 3300053116 | Ga0500592_007184 | Ga0500592_007184_62_1024 | 300 |
| 172 | 3300028563 | Ga0265319_1016514 | Ga0265319_10165142 | 302 |
| 173 | 3300031595 | Ga0265313_10005257 | Ga0265313_100052573 | 302 |
| 174 | 3300005290 | Ga0065712_10025814 | Ga0065712_100258141 | 303 |
| 175 | 3300025928 | Ga0207700_10002713 | Ga0207700_100027133 | 303 |
| 176 | 3300031240 | Ga0265320_10007793 | Ga0265320_100077935 | 303 |
| 177 | 3300005471 | Ga0070698_100013758 | Ga0070698_1000137585 | 304 |
| 178 | 3300009545 | Ga0105237_10076553 | Ga0105237_100765534 | 304 |
| 179 | 3300031595 | Ga0265313_10015567 | Ga0265313_100155674 | 304 |
| 180 | 3300035725 | Ga0373947_0166343 | Ga0373947_0166343_322_1305 | 304 |
| 181 | 3300005834 | Ga0068851_10031501 | Ga0068851_100315012 | 305 |
| 182 | 3300028800 | Ga0265338_10000016 | Ga0265338_10000016214 | 305 |
| 183 | 3300037418 | Ga0395900_0022806 | Ga0395900_0022806_2814_3782 | 305 |
| 184 | 3300005335 | Ga0070666_10021350 | Ga0070666_100213503 | 306 |
| 185 | 3300005459 | Ga0068867_100166489 | Ga0068867_1001664892 | 306 |
| 186 | 3300005544 | Ga0070686_100054255 | Ga0070686_1000542552 | 306 |
| 187 | 3300013308 | Ga0157375_10000535 | Ga0157375_1000053518 | 306 |
| 188 | 3300025903 | Ga0207680_10019778 | Ga0207680_100197782 | 306 |
| 189 | 3300037466 | Ga0395898_0602556 | Ga0395898_0602556_12_1004 | 306 |
| 190 | 3300049568 | Ga0501031_0000004 | Ga0501031_0000004_162375_163331 | 306 |
| 191 | 3300049570 | Ga0501033_0000212 | Ga0501033_0000212_10837_11793 | 306 |
| 192 | 3300049579 | Ga0501043_0186667 | Ga0501043_0186667_307_1263 | 306 |
| 193 | 3300049822 | Ga0501035_0098327 | Ga0501035_0098327_1579_2535 | 306 |
| 194 | 3300049823 | Ga0501044_0001072 | Ga0501044_0001072_28512_29468 | 306 |
| 195 | 3300005437 | Ga0070710_10094786 | Ga0070710_100947862 | 307 |
| 196 | 3300005439 | Ga0070711_100000950 | Ga0070711_10000095011 | 307 |
| 197 | 3300005445 | Ga0070708_100210046 | Ga0070708_1002100462 | 307 |
| 198 | 3300005445 | Ga0070708_100216441 | Ga0070708_1002164412 | 307 |
| 199 | 3300005518 | Ga0070699_100078744 | Ga0070699_1000787443 | 307 |
| 200 | 3300005614 | Ga0068856_100015211 | Ga0068856_1000152118 | 307 |
| 201 | 3300006028 | Ga0070717_10292978 | Ga0070717_102929782 | 307 |
| 202 | 3300006175 | Ga0070712_100060515 | Ga0070712_1000605152 | 307 |
| 203 | 3300025915 | Ga0207693_10031088 | Ga0207693_100310882 | 307 |
| 204 | 3300025916 | Ga0207663_10001971 | Ga0207663_100019713 | 307 |
| 205 | 3300025916 | Ga0207663_10159959 | Ga0207663_101599591 | 307 |
| 206 | 3300025922 | Ga0207646_10304766 | Ga0207646_103047662 | 307 |
| 207 | 3300028653 | Ga0265323_10020765 | Ga0265323_100207652 | 307 |
| 208 | 3300028800 | Ga0265338_10011655 | Ga0265338_100116556 | 307 |
| 209 | 3300028800 | Ga0265338_10025374 | Ga0265338_100253748 | 307 |
| 210 | 3300028800 | Ga0265338_10039916 | Ga0265338_100399163 | 307 |
| 211 | 3300028800 | Ga0265338_10225015 | Ga0265338_102250152 | 307 |
| 212 | 3300029957 | Ga0265324_10048159 | Ga0265324_100481592 | 307 |
| 213 | 3300031344 | Ga0265316_10025719 | Ga0265316_100257191 | 307 |
| 214 | 3300035171 | Ga0373946_0076622 | Ga0373946_0076622_74_1057 | 307 |
| 215 | 3300035692 | Ga0373935_0004881 | Ga0373935_0004881_3250_4233 | 307 |
| 216 | 3300035725 | Ga0373947_0176939 | Ga0373947_0176939_291_1262 | 307 |
| 217 | 3300045051 | Ga0451576_0516443 | Ga0451576_0516443_216_1154 | 307 |
| 218 | 3300046517 | Ga0495630_0047276 | Ga0495630_0047276_476_1408 | 307 |
| 219 | 3300046559 | Ga0495667_0014300 | Ga0495667_0014300_3376_4308 | 307 |
| 220 | 3300049822 | Ga0501035_0039230 | Ga0501035_0039230_203_1159 | 307 |
| 221 | 3300049823 | Ga0501044_0013063 | Ga0501044_0013063_7472_8428 | 307 |
| 222 | 3300028653 | Ga0265323_10000587 | Ga0265323_100005872 | 308 |
| 223 | 3300028653 | Ga0265323_10013672 | Ga0265323_100136724 | 308 |
| 224 | 3300028800 | Ga0265338_10000382 | Ga0265338_1000038227 | 308 |
| 225 | 3300028800 | Ga0265338_10017673 | Ga0265338_100176733 | 308 |
| 226 | 3300028800 | Ga0265338_10093520 | Ga0265338_100935202 | 308 |
| 227 | 3300031595 | Ga0265313_10035342 | Ga0265313_100353422 | 308 |
| 228 | 3300036401 | Ga0373937_0117781 | Ga0373937_0117781_1058_2032 | 308 |
| 229 | 3300045051 | Ga0451576_0084753 | Ga0451576_0084753_1222_2157 | 308 |
| 230 | 3300049742 | Ga0501080_0110769 | Ga0501080_0110769_44_985 | 308 |
| 231 | 3300005293 | Ga0065715_10089596 | Ga0065715_100895969 | 309 |
| 232 | 3300005983 | Ga0081540_1000119 | Ga0081540_100011933 | 309 |
| 233 | 3300009147 | Ga0114129_10037392 | Ga0114129_100373924 | 309 |
| 234 | 3300025905 | Ga0207685_10031272 | Ga0207685_100312722 | 309 |
| 235 | 3300028558 | Ga0265326_10006663 | Ga0265326_100066633 | 309 |
| 236 | 3300028563 | Ga0265319_1000004 | Ga0265319_1000004291 | 309 |
| 237 | 3300031595 | Ga0265313_10000385 | Ga0265313_100003857 | 309 |
| 238 | 3300050507 | nmdc:mga05p37_2252_c1 | nmdc:mga05p37_2252_c1_9549_10553 | 309 |
| 239 | 3300003203 | JGI25406J46586_10002390 | JGI25406J46586_100023903 | 310 |
| 240 | 3300003320 | rootH2_10018718 | rootH2_100187184 | 310 |
| 241 | 3300005329 | Ga0070683_100008160 | Ga0070683_10000816010 | 310 |
| 242 | 3300005340 | Ga0070689_100437384 | Ga0070689_1004373841 | 310 |
| 243 | 3300005344 | Ga0070661_100388183 | Ga0070661_1003881832 | 310 |
| 244 | 3300005347 | Ga0070668_100028413 | Ga0070668_1000284134 | 310 |
| 245 | 3300005354 | Ga0070675_100125420 | Ga0070675_1001254202 | 310 |
| 246 | 3300005455 | Ga0070663_100007062 | Ga0070663_1000070625 | 310 |
| 247 | 3300005471 | Ga0070698_100027521 | Ga0070698_1000275212 | 310 |
| 248 | 3300006175 | Ga0070712_100067405 | Ga0070712_1000674053 | 310 |
| 249 | 3300006175 | Ga0070712_100462665 | Ga0070712_1004626651 | 310 |
| 250 | 3300009093 | Ga0105240_10002189 | Ga0105240_1000218924 | 310 |
| 251 | 3300009545 | Ga0105237_10655807 | Ga0105237_106558071 | 310 |
| 252 | 3300021384 | Ga0213876_10034313 | Ga0213876_100343132 | 310 |
| 253 | 3300025290 | Ga0207673_1000151 | Ga0207673_10001518 | 310 |
| 254 | 3300025315 | Ga0207697_10001324 | Ga0207697_1000132410 | 310 |
| 255 | 3300025913 | Ga0207695_10037041 | Ga0207695_100370415 | 310 |
| 256 | 3300025915 | Ga0207693_10203420 | Ga0207693_102034202 | 310 |
| 257 | 3300026121 | Ga0207683_10022659 | Ga0207683_100226594 | 310 |
| 258 | 3300029957 | Ga0265324_10008996 | Ga0265324_100089963 | 310 |
| 259 | 3300031251 | Ga0265327_10000709 | Ga0265327_100007096 | 310 |
| 260 | 3300037853 | Ga0436364_0565274 | Ga0436364_0565274_120_1052 | 310 |
| 261 | 3300039437 | Ga0436365_0428430 | Ga0436365_0428430_2863_3795 | 310 |
| 262 | 3300048915 | Ga0496112_0109452 | Ga0496112_0109452_432_1364 | 310 |
| 263 | iso_pu_bacteria | 2786546940 | 2788435189 | 310 |
| 264 | 3300005436 | Ga0070713_100140544 | Ga0070713_1001405441 | 311 |
| 265 | 3300006028 | Ga0070717_10099374 | Ga0070717_100993742 | 311 |
| 266 | 3300013296 | Ga0157374_10008015 | Ga0157374_100080155 | 311 |
| 267 | 3300025907 | Ga0207645_10000666 | Ga0207645_1000066613 | 311 |
| 268 | 3300025923 | Ga0207681_10008323 | Ga0207681_100083233 | 311 |
| 269 | 3300028666 | Ga0265336_10015766 | Ga0265336_100157662 | 311 |
| 270 | 3300028800 | Ga0265338_10007112 | Ga0265338_100071127 | 311 |
| 271 | 3300028800 | Ga0265338_10008854 | Ga0265338_100088543 | 311 |
| 272 | 3300028800 | Ga0265338_10167311 | Ga0265338_101673112 | 311 |
| 273 | 3300031238 | Ga0265332_10050831 | Ga0265332_100508312 | 311 |
| 274 | 3300031240 | Ga0265320_10021739 | Ga0265320_100217392 | 311 |
| 275 | 3300031240 | Ga0265320_10033975 | Ga0265320_100339752 | 311 |
| 276 | 3300031247 | Ga0265340_10001439 | Ga0265340_100014397 | 311 |
| 277 | 3300036401 | Ga0373937_0368727 | Ga0373937_0368727_136_1089 | 311 |
| 278 | 3300045051 | Ga0451576_0065872 | Ga0451576_0065872_2080_3063 | 311 |
| 279 | 3300045051 | Ga0451576_0096490 | Ga0451576_0096490_347_1324 | 311 |
| 280 | 3300046517 | Ga0495630_0383603 | Ga0495630_0383603_101_1054 | 311 |
| 281 | 3300046535 | Ga0495586_0001421 | Ga0495586_0001421_7492_8445 | 311 |
| 282 | 3300046559 | Ga0495667_0131042 | Ga0495667_0131042_21_974 | 311 |
| 283 | 3300046642 | Ga0495634_0022051 | Ga0495634_0022051_1275_2228 | 311 |
| 284 | 3300046689 | Ga0495613_0000924 | Ga0495613_0000924_8213_9166 | 311 |
| 285 | 3300005937 | Ga0081455_10126549 | Ga0081455_101265492 | 312 |
| 286 | 3300025910 | Ga0207684_10030434 | Ga0207684_100304345 | 312 |
| 287 | 3300005577 | Ga0068857_100261923 | Ga0068857_1002619231 | 313 |
| 288 | 3300005614 | Ga0068856_100039179 | Ga0068856_1000391793 | 313 |
| 289 | 3300005614 | Ga0068856_100293362 | Ga0068856_1002933622 | 313 |
| 290 | 3300009093 | Ga0105240_10014651 | Ga0105240_100146514 | 313 |
| 291 | 3300009094 | Ga0111539_10485383 | Ga0111539_104853832 | 313 |
| 292 | 3300009174 | Ga0105241_10035636 | Ga0105241_100356363 | 313 |
| 293 | 3300009551 | Ga0105238_10015914 | Ga0105238_100159143 | 313 |
| 294 | 3300025911 | Ga0207654_10026058 | Ga0207654_100260583 | 313 |
| 295 | 3300025913 | Ga0207695_10064803 | Ga0207695_100648034 | 313 |
| 296 | 3300025913 | Ga0207695_10268787 | Ga0207695_102687871 | 313 |
| 297 | 3300025924 | Ga0207694_10033093 | Ga0207694_100330932 | 313 |
| 298 | 3300026078 | Ga0207702_10021652 | Ga0207702_100216524 | 313 |
| 299 | 3300026142 | Ga0207698_10123477 | Ga0207698_101234772 | 313 |
| 300 | 3300031235 | Ga0265330_10001245 | Ga0265330_100012455 | 313 |
| 301 | 3300031595 | Ga0265313_10031656 | Ga0265313_100316562 | 313 |
| 302 | 3300048918 | Ga0496115_0017508 | Ga0496115_0017508_3617_4597 | 313 |
| 303 | 3300005617 | Ga0068859_100427982 | Ga0068859_1004279822 | 314 |
| 304 | 3300006028 | Ga0070717_10000233 | Ga0070717_1000023315 | 314 |
| 305 | 3300006931 | Ga0097620_100427940 | Ga0097620_1004279401 | 314 |
| 306 | 3300009545 | Ga0105237_10000060 | Ga0105237_100000603 | 314 |
| 307 | 3300009551 | Ga0105238_10054640 | Ga0105238_100546403 | 314 |
| 308 | 3300025914 | Ga0207671_10000062 | Ga0207671_10000062142 | 314 |
| 309 | 3300028800 | Ga0265338_10000305 | Ga0265338_1000030572 | 314 |
| 310 | 3300028800 | Ga0265338_10020306 | Ga0265338_100203065 | 314 |
| 311 | 3300028800 | Ga0265338_10059968 | Ga0265338_100599683 | 314 |
| 312 | 3300028800 | Ga0265338_10182992 | Ga0265338_101829922 | 314 |
| 313 | 3300029957 | Ga0265324_10000470 | Ga0265324_100004708 | 314 |
| 314 | 3300031240 | Ga0265320_10020278 | Ga0265320_100202783 | 314 |
| 315 | 3300037312 | Ga0395899_0131825 | Ga0395899_0131825_217_1161 | 314 |
| 316 | 3300037418 | Ga0395900_0032121 | Ga0395900_0032121_2022_2966 | 314 |
| 317 | 3300037466 | Ga0395898_0059428 | Ga0395898_0059428_2452_3396 | 314 |
| 318 | 3300038443 | Ga0395901_0005808 | Ga0395901_0005808_10487_11431 | 314 |
| 319 | 3300046473 | Ga0495582_0021898 | Ga0495582_0021898_1932_2903 | 314 |
| 320 | 3300046517 | Ga0495630_0000041 | Ga0495630_0000041_103737_104708 | 314 |
| 321 | 3300046526 | Ga0495666_0041901 | Ga0495666_0041901_1175_2146 | 314 |
| 322 | 3300046533 | Ga0495640_0081674 | Ga0495640_0081674_73_1044 | 314 |
| 323 | 3300046535 | Ga0495586_0000001 | Ga0495586_0000001_192633_193604 | 314 |
| 324 | 3300046681 | Ga0495647_0030754 | Ga0495647_0030754_593_1564 | 314 |
| 325 | 3300047319 | Ga0495674_0005088 | Ga0495674_0005088_11395_12366 | 314 |
| 326 | 3300047321 | Ga0495676_0017861 | Ga0495676_0017861_2077_3048 | 314 |
| 327 | 3300049571 | Ga0501034_0153609 | Ga0501034_0153609_1028_2005 | 314 |
| 328 | 3300005436 | Ga0070713_100137793 | Ga0070713_1001377932 | 315 |
| 329 | 3300005439 | Ga0070711_100057733 | Ga0070711_1000577333 | 315 |
| 330 | 3300006175 | Ga0070712_100020461 | Ga0070712_1000204611 | 315 |
| 331 | 3300025915 | Ga0207693_10089518 | Ga0207693_100895182 | 315 |
| 332 | 3300025928 | Ga0207700_10318956 | Ga0207700_103189562 | 315 |
| 333 | 3300029957 | Ga0265324_10026380 | Ga0265324_100263803 | 315 |
| 334 | 3300031852 | Ga0307410_10107412 | Ga0307410_101074122 | 315 |
| 335 | 3300005327 | Ga0070658_10003195 | Ga0070658_1000319513 | 316 |
| 336 | 3300005339 | Ga0070660_100039606 | Ga0070660_1000396063 | 316 |
| 337 | 3300005458 | Ga0070681_10415332 | Ga0070681_104153321 | 316 |
| 338 | 3300006163 | Ga0070715_10025201 | Ga0070715_100252012 | 316 |
| 339 | 3300025919 | Ga0207657_10036185 | Ga0207657_100361853 | 316 |
| 340 | 3300031344 | Ga0265316_10044070 | Ga0265316_100440703 | 316 |
| 341 | 3300049572 | Ga0501036_0097402 | Ga0501036_0097402_918_1874 | 316 |
| 342 | 3300049579 | Ga0501043_0080320 | Ga0501043_0080320_870_1826 | 316 |
| 343 | 3300049580 | Ga0501046_0010345 | Ga0501046_0010345_2821_3777 | 316 |
| 344 | 3300049581 | Ga0501047_0001901 | Ga0501047_0001901_17975_18931 | 316 |
| 345 | 3300049822 | Ga0501035_0000780 | Ga0501035_0000780_16210_17166 | 316 |
| 346 | 3300049823 | Ga0501044_0000226 | Ga0501044_0000226_40300_41256 | 316 |
| 347 | 3300005436 | Ga0070713_100003736 | Ga0070713_1000037368 | 317 |
| 348 | 3300028563 | Ga0265319_1047688 | Ga0265319_10476882 | 317 |
| 349 | 3300028577 | Ga0265318_10054599 | Ga0265318_100545992 | 317 |
| 350 | 3300031240 | Ga0265320_10003116 | Ga0265320_100031161 | 317 |
| 351 | 3300005347 | Ga0070668_100108472 | Ga0070668_1001084722 | 318 |
| 352 | 3300005353 | Ga0070669_100237464 | Ga0070669_1002374641 | 318 |
| 353 | 3300005467 | Ga0070706_100045321 | Ga0070706_1000453212 | 318 |
| 354 | 3300005468 | Ga0070707_100255046 | Ga0070707_1002550462 | 318 |
| 355 | 3300005937 | Ga0081455_10000141 | Ga0081455_1000014176 | 318 |
| 356 | 3300005981 | Ga0081538_10102503 | Ga0081538_101025032 | 318 |
| 357 | 3300009148 | Ga0105243_10308499 | Ga0105243_103084992 | 318 |
| 358 | 3300010375 | Ga0105239_10012918 | Ga0105239_100129187 | 318 |
| 359 | 3300025910 | Ga0207684_10046004 | Ga0207684_100460043 | 318 |
| 360 | 3300025922 | Ga0207646_10193529 | Ga0207646_101935292 | 318 |
| 361 | 3300031235 | Ga0265330_10046423 | Ga0265330_100464232 | 318 |
| 362 | 3300031344 | Ga0265316_10066114 | Ga0265316_100661142 | 318 |
| 363 | 3300005334 | Ga0068869_100090048 | Ga0068869_1000900483 | 319 |
| 364 | 3300005347 | Ga0070668_100439826 | Ga0070668_1004398261 | 319 |
| 365 | 3300005444 | Ga0070694_100140964 | Ga0070694_1001409642 | 319 |
| 366 | 3300005536 | Ga0070697_100206949 | Ga0070697_1002069492 | 319 |
| 367 | 3300005536 | Ga0070697_100272323 | Ga0070697_1002723232 | 319 |
| 368 | 3300005546 | Ga0070696_100049479 | Ga0070696_1000494793 | 319 |
| 369 | 3300005549 | Ga0070704_100069712 | Ga0070704_1000697121 | 319 |
| 370 | 3300005843 | Ga0068860_100286106 | Ga0068860_1002861062 | 319 |
| 371 | 3300014326 | Ga0157380_10636363 | Ga0157380_106363631 | 319 |
| 372 | 3300025942 | Ga0207689_10021207 | Ga0207689_100212073 | 319 |
| 373 | 3300028381 | Ga0268264_10291254 | Ga0268264_102912542 | 319 |
| 374 | 3300028563 | Ga0265319_1000080 | Ga0265319_100008011 | 319 |
| 375 | 3300031240 | Ga0265320_10000823 | Ga0265320_100008239 | 319 |
| 376 | 3300031240 | Ga0265320_10011010 | Ga0265320_100110102 | 319 |
| 377 | 3300031595 | Ga0265313_10092410 | Ga0265313_100924102 | 319 |
| 378 | 3300031711 | Ga0265314_10026658 | Ga0265314_100266582 | 319 |
| 379 | 3300049744 | Ga0501083_0003937 | Ga0501083_0003937_1915_2883 | 319 |
| 380 | 3300049744 | Ga0501083_0012768 | Ga0501083_0012768_4486_5454 | 319 |
| 381 | 3300028573 | Ga0265334_10001707 | Ga0265334_100017074 | 320 |
| 382 | 3300026142 | Ga0207698_10116862 | Ga0207698_101168622 | 321 |
| 383 | 3300028653 | Ga0265323_10001529 | Ga0265323_100015296 | 321 |
| 384 | 3300031344 | Ga0265316_10026612 | Ga0265316_100266123 | 321 |
| 385 | 3300039437 | Ga0436365_0088627 | Ga0436365_0088627_833_1948 | 321 |
| 386 | 3300005329 | Ga0070683_100007398 | Ga0070683_1000073984 | 322 |
| 387 | 3300005445 | Ga0070708_100058676 | Ga0070708_1000586761 | 322 |
| 388 | 3300005467 | Ga0070706_100015914 | Ga0070706_1000159145 | 322 |
| 389 | 3300005467 | Ga0070706_100094307 | Ga0070706_1000943073 | 322 |
| 390 | 3300005471 | Ga0070698_100067488 | Ga0070698_1000674883 | 322 |
| 391 | 3300005518 | Ga0070699_100023541 | Ga0070699_1000235414 | 322 |
| 392 | 3300005536 | Ga0070697_100015613 | Ga0070697_1000156133 | 322 |
| 393 | 3300006028 | Ga0070717_10022647 | Ga0070717_100226476 | 322 |
| 394 | 3300025910 | Ga0207684_10009680 | Ga0207684_100096805 | 322 |
| 395 | 3300025910 | Ga0207684_10015018 | Ga0207684_100150184 | 322 |
| 396 | 3300025910 | Ga0207684_10097705 | Ga0207684_100977053 | 322 |
| 397 | 3300025922 | Ga0207646_10002700 | Ga0207646_100027003 | 322 |
| 398 | 3300028653 | Ga0265323_10002916 | Ga0265323_100029168 | 322 |
| 399 | 3300028653 | Ga0265323_10012908 | Ga0265323_100129083 | 322 |
| 400 | 3300028654 | Ga0265322_10000722 | Ga0265322_100007222 | 322 |
| 401 | 3300028654 | Ga0265322_10001433 | Ga0265322_100014333 | 322 |
| 402 | 3300031235 | Ga0265330_10024640 | Ga0265330_100246402 | 322 |
| 403 | 3300031251 | Ga0265327_10000029 | Ga0265327_1000002914 | 322 |
| 404 | 3300031344 | Ga0265316_10012560 | Ga0265316_100125603 | 322 |
| 405 | 3300031712 | Ga0265342_10073766 | Ga0265342_100737662 | 322 |
| 406 | 3300049581 | Ga0501047_0446848 | Ga0501047_0446848_13_987 | 322 |
| 407 | 3300003911 | JGI25405J52794_10000611 | JGI25405J52794_100006112 | 323 |
| 408 | 3300003911 | JGI25405J52794_10000691 | JGI25405J52794_100006913 | 323 |
| 409 | 3300003911 | JGI25405J52794_10008393 | JGI25405J52794_100083932 | 323 |
| 410 | 3300005347 | Ga0070668_100100172 | Ga0070668_1001001722 | 323 |
| 411 | 3300005445 | Ga0070708_100032998 | Ga0070708_1000329983 | 323 |
| 412 | 3300005445 | Ga0070708_100097212 | Ga0070708_1000972122 | 323 |
| 413 | 3300005467 | Ga0070706_100036817 | Ga0070706_1000368173 | 323 |
| 414 | 3300005467 | Ga0070706_100056804 | Ga0070706_1000568044 | 323 |
| 415 | 3300005467 | Ga0070706_100126514 | Ga0070706_1001265142 | 323 |
| 416 | 3300005468 | Ga0070707_100011295 | Ga0070707_1000112956 | 323 |
| 417 | 3300005468 | Ga0070707_100404217 | Ga0070707_1004042171 | 323 |
| 418 | 3300005536 | Ga0070697_100048691 | Ga0070697_1000486912 | 323 |
| 419 | 3300005548 | Ga0070665_100120142 | Ga0070665_1001201422 | 323 |
| 420 | 3300005937 | Ga0081455_10000442 | Ga0081455_1000044214 | 323 |
| 421 | 3300005937 | Ga0081455_10000878 | Ga0081455_100008786 | 323 |
| 422 | 3300005937 | Ga0081455_10003024 | Ga0081455_1000302415 | 323 |
| 423 | 3300025910 | Ga0207684_10029928 | Ga0207684_100299283 | 323 |
| 424 | 3300025922 | Ga0207646_10042422 | Ga0207646_100424223 | 323 |
| 425 | 3300025926 | Ga0207659_10100943 | Ga0207659_101009432 | 323 |
| 426 | 3300025939 | Ga0207665_10306060 | Ga0207665_103060601 | 323 |
| 427 | 3300025972 | Ga0207668_10053426 | Ga0207668_100534262 | 323 |
| 428 | 3300028379 | Ga0268266_10019532 | Ga0268266_100195324 | 323 |
| 429 | 3300005353 | Ga0070669_100023651 | Ga0070669_1000236512 | 324 |
| 430 | 3300005436 | Ga0070713_100058292 | Ga0070713_1000582923 | 324 |
| 431 | 3300005985 | Ga0081539_10000511 | Ga0081539_100005114 | 324 |
| 432 | 3300006237 | Ga0097621_100028114 | Ga0097621_1000281144 | 324 |
| 433 | 3300009093 | Ga0105240_10011512 | Ga0105240_100115127 | 324 |
| 434 | 3300010159 | Ga0099796_10000695 | Ga0099796_100006954 | 324 |
| 435 | 3300010375 | Ga0105239_10156193 | Ga0105239_101561931 | 324 |
| 436 | 3300013297 | Ga0157378_10032232 | Ga0157378_100322324 | 324 |
| 437 | 3300025913 | Ga0207695_10009082 | Ga0207695_100090825 | 324 |
| 438 | 3300025922 | Ga0207646_10116530 | Ga0207646_101165302 | 324 |
| 439 | 3300025923 | Ga0207681_10067452 | Ga0207681_100674522 | 324 |
| 440 | 3300025927 | Ga0207687_10415263 | Ga0207687_104152632 | 324 |
| 441 | 3300025928 | Ga0207700_10134569 | Ga0207700_101345691 | 324 |
| 442 | 3300025972 | Ga0207668_10016132 | Ga0207668_100161325 | 324 |
| 443 | 3300026023 | Ga0207677_10207344 | Ga0207677_102073442 | 324 |
| 444 | 3300048903 | Ga0496100_0028170 | Ga0496100_0028170_2451_3434 | 324 |
| 445 | 3300048915 | Ga0496112_0031005 | Ga0496112_0031005_2027_3010 | 324 |
| 446 | 3300048918 | Ga0496115_0003943 | Ga0496115_0003943_7922_8905 | 324 |
| 447 | 2162886012 | MBSR1b_contig_13531447 | MBSR1b_0201.00003990 | 325 |
| 448 | 3300002126 | JGI24035J26624_1000704 | JGI24035J26624_10007042 | 325 |
| 449 | 3300005289 | Ga0065704_10009476 | Ga0065704_100094761 | 325 |
| 450 | 3300005290 | Ga0065712_10002131 | Ga0065712_100021315 | 325 |
| 451 | 3300005290 | Ga0065712_10029097 | Ga0065712_100290972 | 325 |
| 452 | 3300005293 | Ga0065715_10108395 | Ga0065715_101083952 | 325 |
| 453 | 3300005293 | Ga0065715_10123494 | Ga0065715_101234941 | 325 |
| 454 | 3300005328 | Ga0070676_10116663 | Ga0070676_101166632 | 325 |
| 455 | 3300005329 | Ga0070683_100024861 | Ga0070683_1000248613 | 325 |
| 456 | 3300005329 | Ga0070683_100043968 | Ga0070683_1000439685 | 325 |
| 457 | 3300005334 | Ga0068869_100055530 | Ga0068869_1000555304 | 325 |
| 458 | 3300005335 | Ga0070666_10032040 | Ga0070666_100320404 | 325 |
| 459 | 3300005343 | Ga0070687_100044468 | Ga0070687_1000444683 | 325 |
| 460 | 3300005365 | Ga0070688_100014311 | Ga0070688_1000143113 | 325 |
| 461 | 3300005366 | Ga0070659_100004328 | Ga0070659_1000043288 | 325 |
| 462 | 3300005434 | Ga0070709_10024407 | Ga0070709_100244071 | 325 |
| 463 | 3300005434 | Ga0070709_10096578 | Ga0070709_100965782 | 325 |
| 464 | 3300005435 | Ga0070714_100439885 | Ga0070714_1004398851 | 325 |
| 465 | 3300005437 | Ga0070710_10031139 | Ga0070710_100311393 | 325 |
| 466 | 3300005441 | Ga0070700_100127980 | Ga0070700_1001279802 | 325 |
| 467 | 3300005444 | Ga0070694_100014482 | Ga0070694_1000144826 | 325 |
| 468 | 3300005445 | Ga0070708_100181820 | Ga0070708_1001818202 | 325 |
| 469 | 3300005457 | Ga0070662_100010223 | Ga0070662_1000102235 | 325 |
| 470 | 3300005458 | Ga0070681_10025209 | Ga0070681_100252092 | 325 |
| 471 | 3300005467 | Ga0070706_100055775 | Ga0070706_1000557753 | 325 |
| 472 | 3300005468 | Ga0070707_100036460 | Ga0070707_1000364604 | 325 |
| 473 | 3300005518 | Ga0070699_100151449 | Ga0070699_1001514492 | 325 |
| 474 | 3300005535 | Ga0070684_100000223 | Ga0070684_10000022335 | 325 |
| 475 | 3300005535 | Ga0070684_100055629 | Ga0070684_1000556292 | 325 |
| 476 | 3300005536 | Ga0070697_100054603 | Ga0070697_1000546033 | 325 |
| 477 | 3300005545 | Ga0070695_100043472 | Ga0070695_1000434723 | 325 |
| 478 | 3300005548 | Ga0070665_100047160 | Ga0070665_1000471602 | 325 |
| 479 | 3300005548 | Ga0070665_100081633 | Ga0070665_1000816334 | 325 |
| 480 | 3300005549 | Ga0070704_100017404 | Ga0070704_1000174043 | 325 |
| 481 | 3300005617 | Ga0068859_100024859 | Ga0068859_1000248595 | 325 |
| 482 | 3300005618 | Ga0068864_100076359 | Ga0068864_1000763592 | 325 |
| 483 | 3300005719 | Ga0068861_100194846 | Ga0068861_1001948462 | 325 |
| 484 | 3300005841 | Ga0068863_100109828 | Ga0068863_1001098283 | 325 |
| 485 | 3300005842 | Ga0068858_100022153 | Ga0068858_1000221534 | 325 |
| 486 | 3300005843 | Ga0068860_100004814 | Ga0068860_10000481414 | 325 |
| 487 | 3300005937 | Ga0081455_10006792 | Ga0081455_1000679212 | 325 |
| 488 | 3300005937 | Ga0081455_10022425 | Ga0081455_100224253 | 325 |
| 489 | 3300005937 | Ga0081455_10024667 | Ga0081455_100246672 | 325 |
| 490 | 3300005985 | Ga0081539_10015188 | Ga0081539_100151883 | 325 |
| 491 | 3300006028 | Ga0070717_10006543 | Ga0070717_100065435 | 325 |
| 492 | 3300006028 | Ga0070717_10039863 | Ga0070717_100398632 | 325 |
| 493 | 3300006163 | Ga0070715_10051471 | Ga0070715_100514711 | 325 |
| 494 | 3300006173 | Ga0070716_100023425 | Ga0070716_1000234254 | 325 |
| 495 | 3300006175 | Ga0070712_100155560 | Ga0070712_1001555602 | 325 |
| 496 | 3300006175 | Ga0070712_100172264 | Ga0070712_1001722642 | 325 |
| 497 | 3300006237 | Ga0097621_100074601 | Ga0097621_1000746013 | 325 |
| 498 | 3300006914 | Ga0075436_100118301 | Ga0075436_1001183011 | 325 |
| 499 | 3300006931 | Ga0097620_100024859 | Ga0097620_1000248595 | 325 |
| 500 | 3300007788 | Ga0099795_10083407 | Ga0099795_100834072 | 325 |
| 501 | 3300009098 | Ga0105245_10087814 | Ga0105245_100878142 | 325 |
| 502 | 3300009553 | Ga0105249_10004437 | Ga0105249_100044378 | 325 |
| 503 | 3300010375 | Ga0105239_10059026 | Ga0105239_100590262 | 325 |
| 504 | 3300010375 | Ga0105239_10341888 | Ga0105239_103418881 | 325 |
| 505 | 3300013296 | Ga0157374_10008725 | Ga0157374_100087255 | 325 |
| 506 | 3300013296 | Ga0157374_10048651 | Ga0157374_100486512 | 325 |
| 507 | 3300013296 | Ga0157374_10108086 | Ga0157374_101080863 | 325 |
| 508 | 3300013297 | Ga0157378_10023559 | Ga0157378_100235593 | 325 |
| 509 | 3300013297 | Ga0157378_10099957 | Ga0157378_100999572 | 325 |
| 510 | 3300013306 | Ga0163162_10098033 | Ga0163162_100980331 | 325 |
| 511 | 3300013306 | Ga0163162_10247446 | Ga0163162_102474463 | 325 |
| 512 | 3300013308 | Ga0157375_10018832 | Ga0157375_100188325 | 325 |
| 513 | 3300013308 | Ga0157375_10081930 | Ga0157375_100819303 | 325 |
| 514 | 3300013308 | Ga0157375_10517400 | Ga0157375_105174002 | 325 |
| 515 | 3300014325 | Ga0163163_10092152 | Ga0163163_100921521 | 325 |
| 516 | 3300014745 | Ga0157377_10159554 | Ga0157377_101595542 | 325 |
| 517 | 3300014968 | Ga0157379_10049697 | Ga0157379_100496972 | 325 |
| 518 | 3300014969 | Ga0157376_10137172 | Ga0157376_101371722 | 325 |
| 519 | 3300014969 | Ga0157376_10280494 | Ga0157376_102804941 | 325 |
| 520 | 3300025315 | Ga0207697_10000729 | Ga0207697_1000072914 | 325 |
| 521 | 3300025903 | Ga0207680_10258644 | Ga0207680_102586441 | 325 |
| 522 | 3300025904 | Ga0207647_10026358 | Ga0207647_100263583 | 325 |
| 523 | 3300025905 | Ga0207685_10002637 | Ga0207685_100026372 | 325 |
| 524 | 3300025906 | Ga0207699_10022909 | Ga0207699_100229094 | 325 |
| 525 | 3300025910 | Ga0207684_10002867 | Ga0207684_100028677 | 325 |
| 526 | 3300025915 | Ga0207693_10074929 | Ga0207693_100749293 | 325 |
| 527 | 3300025915 | Ga0207693_10086792 | Ga0207693_100867922 | 325 |
| 528 | 3300025917 | Ga0207660_10019365 | Ga0207660_100193654 | 325 |
| 529 | 3300025919 | Ga0207657_10077022 | Ga0207657_100770222 | 325 |
| 530 | 3300025922 | Ga0207646_10013903 | Ga0207646_100139034 | 325 |
| 531 | 3300025925 | Ga0207650_10060275 | Ga0207650_100602753 | 325 |
| 532 | 3300025928 | Ga0207700_10003156 | Ga0207700_100031566 | 325 |
| 533 | 3300025929 | Ga0207664_10288501 | Ga0207664_102885012 | 325 |
| 534 | 3300025932 | Ga0207690_10044918 | Ga0207690_100449182 | 325 |
| 535 | 3300025933 | Ga0207706_10016964 | Ga0207706_100169642 | 325 |
| 536 | 3300025934 | Ga0207686_10235540 | Ga0207686_102355402 | 325 |
| 537 | 3300025935 | Ga0207709_10123818 | Ga0207709_101238181 | 325 |
| 538 | 3300025936 | Ga0207670_10005486 | Ga0207670_100054863 | 325 |
| 539 | 3300025938 | Ga0207704_10028118 | Ga0207704_100281182 | 325 |
| 540 | 3300025938 | Ga0207704_10167283 | Ga0207704_101672832 | 325 |
| 541 | 3300025939 | Ga0207665_10005229 | Ga0207665_100052291 | 325 |
| 542 | 3300025939 | Ga0207665_10005429 | Ga0207665_1000542910 | 325 |
| 543 | 3300025944 | Ga0207661_10039508 | Ga0207661_100395083 | 325 |
| 544 | 3300025945 | Ga0207679_10170781 | Ga0207679_101707812 | 325 |
| 545 | 3300025961 | Ga0207712_10035457 | Ga0207712_100354573 | 325 |
| 546 | 3300025986 | Ga0207658_10096481 | Ga0207658_100964812 | 325 |
| 547 | 3300026035 | Ga0207703_10007514 | Ga0207703_100075142 | 325 |
| 548 | 3300026067 | Ga0207678_10005675 | Ga0207678_100056753 | 325 |
| 549 | 3300026067 | Ga0207678_10143482 | Ga0207678_101434822 | 325 |
| 550 | 3300026075 | Ga0207708_10025496 | Ga0207708_100254964 | 325 |
| 551 | 3300026088 | Ga0207641_10035705 | Ga0207641_100357054 | 325 |
| 552 | 3300026095 | Ga0207676_10018908 | Ga0207676_100189083 | 325 |
| 553 | 3300026118 | Ga0207675_100016560 | Ga0207675_1000165603 | 325 |
| 554 | 3300028379 | Ga0268266_10127746 | Ga0268266_101277462 | 325 |
| 555 | 3300028379 | Ga0268266_10168157 | Ga0268266_101681572 | 325 |
| 556 | 3300028379 | Ga0268266_10305348 | Ga0268266_103053481 | 325 |
| 557 | 3300035111 | Ga0373923_0046800 | Ga0373923_0046800_174_1160 | 325 |
| 558 | 3300035120 | Ga0373957_0078976 | Ga0373957_0078976_181_1167 | 325 |
| 559 | 3300035691 | Ga0373931_0098230 | Ga0373931_0098230_226_1212 | 325 |
| 560 | 3300035695 | Ga0373927_0200670 | Ga0373927_0200670_183_1169 | 325 |
| 561 | 3300036401 | Ga0373937_0179878 | Ga0373937_0179878_287_1273 | 325 |
| 562 | 3300042012 | Ga0439455_0004416 | Ga0439455_0004416_363_1349 | 325 |
| 563 | 3300045976 | Ga0466967_0233987 | Ga0466967_0233987_454_1440 | 325 |
| 564 | 3300046454 | Ga0495592_0066630 | Ga0495592_0066630_1077_2063 | 325 |
| 565 | 3300046461 | Ga0495641_0060442 | Ga0495641_0060442_273_1259 | 325 |
| 566 | 3300046516 | Ga0495628_0093711 | Ga0495628_0093711_1024_2010 | 325 |
| 567 | 3300046517 | Ga0495630_0031492 | Ga0495630_0031492_2660_3646 | 325 |
| 568 | 3300046543 | Ga0495645_0092789 | Ga0495645_0092789_1036_2022 | 325 |
| 569 | 3300046679 | Ga0495623_0072989 | Ga0495623_0072989_752_1738 | 325 |
| 570 | 3300046689 | Ga0495613_0048230 | Ga0495613_0048230_289_1275 | 325 |
| 571 | 3300047317 | Ga0495604_0092622 | Ga0495604_0092622_439_1425 | 325 |
| 572 | 3300047322 | Ga0495680_0157999 | Ga0495680_0157999_84_1070 | 325 |
| 573 | 3300047322 | Ga0495680_0358536 | Ga0495680_0358536_14_1000 | 325 |
| 574 | 3300048088 | Ga0495602_0255991 | Ga0495602_0255991_65_1051 | 325 |
| 575 | 3300048903 | Ga0496100_0072360 | Ga0496100_0072360_367_1353 | 325 |
| 576 | 3300048904 | Ga0496101_0166252 | Ga0496101_0166252_257_1243 | 325 |
| 577 | 3300048904 | Ga0496101_0195275 | Ga0496101_0195275_441_1427 | 325 |
| 578 | 3300048905 | Ga0496102_0044485 | Ga0496102_0044485_1437_2423 | 325 |
| 579 | 3300048905 | Ga0496102_0150582 | Ga0496102_0150582_933_1919 | 325 |
| 580 | 3300048906 | Ga0496103_0076315 | Ga0496103_0076315_809_1795 | 325 |
| 581 | 3300048907 | Ga0496104_0180378 | Ga0496104_0180378_740_1726 | 325 |
| 582 | 3300048907 | Ga0496104_0254731 | Ga0496104_0254731_123_1109 | 325 |
| 583 | 3300048909 | Ga0496106_0051439 | Ga0496106_0051439_833_1819 | 325 |
| 584 | 3300048911 | Ga0496108_0364780 | Ga0496108_0364780_175_1152 | 325 |
| 585 | 3300048915 | Ga0496112_0041724 | Ga0496112_0041724_2226_3212 | 325 |
| 586 | 3300048915 | Ga0496112_0180624 | Ga0496112_0180624_182_1168 | 325 |
| 587 | 3300048916 | Ga0496113_0029349 | Ga0496113_0029349_1942_2928 | 325 |
| 588 | 3300048916 | Ga0496113_0137166 | Ga0496113_0137166_129_1106 | 325 |
| 589 | 3300048918 | Ga0496115_0002359 | Ga0496115_0002359_5199_6185 | 325 |
| 590 | 3300050514 | nmdc:mga08x19_203823_c1 | nmdc:mga08x19_203823_c1_10_987 | 325 |
| 591 | 3300053084 | Ga0495595_0053308 | Ga0495595_0053308_184_1170 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
138
365
0.8
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7971 | 78 | 314 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.7627 | 27 | 308 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7608 | 78 | 314 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.7544 | 27 | 308 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.751 | 84 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGH8_17_311_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9693 | 26 | 313 | 1.10.3720.10 |
| af_P9WG07_21_330_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9465 | 35 | 316 | 1.10.3720.10 |
| af_P0AGH8_17_311_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9437 | 26 | 313 | 1.10.3720.10 |
| af_Q58420_16_310_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9394 | 28 | 314 | 1.10.3720.10 |
| af_Q58420_16_310_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9119 | 28 | 314 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8QVQ5-F1-model_v4 | Phosphate transport system permease protein | 0.9776 | 23 | 315 |
GO:0005315
GO:0005886 GO:0006817 |
| AF-A0A1F3V7U2-F1-model_v4 | Phosphate transport system permease protein | 0.9773 | 23 | 314 |
GO:0005315
GO:0005886 GO:0006817 |
| AF-A0A7V4KJ67-F1-model_v4 | Phosphate transport system permease protein | 0.9768 | 18 | 316 |
GO:0005315
GO:0005886 GO:0006817 |
| AF-A0A162UGF4-F1-model_v4 | Phosphate transport system permease protein | 0.9768 | 21 | 314 |
GO:0005315
GO:0005886 GO:0006817 |
| AF-A0A522PK74-F1-model_v4 | Phosphate transport system permease protein | 0.9766 | 27 | 315 |
GO:0005315
GO:0005886 GO:0006817 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar