F467049

General Info

Members Datasets Scaffolds Average Seq Length
591 360 491 321

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10004620|Ga0157369_100046204
Length 352
Sequence MKNTGGKPRAGAVRKGRKGPQVGSGGQGRQALEGKKPTPKAEDRPYHPAGKRKAAQERFVAAGGRSRQGRPTDADSRGSSRGTGNTGXXXTSTRRAKQADEHEIVTGRNSVVEALRARIPASALYVAARIEMDERVKEVLSIATNRGIPILEVMRPELDRLAGRDAVHQGLALKVPAYEYAHPMELLDLTISRGQKPLFVALDGITDPRNLGAIIRSTAAFGGHGVIVPQRRSVGVTASAWKTSAGAAARTPVAMAANLTQTLKSLKERGVFVLGLDGGGDVSLPGLALADRPVVIVVGSEGKGLSRLVTETCDAIVSIPISASTESLNAGIAASVTLYEVSRLRAEAAAAK

Samples

Sample ID Description Type Environment
1 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
2 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2643221549 Agromyces sp. Root1464 Isolate Unclassified
5 2643221572 Leifsonia sp. Root60 Isolate Unclassified
6 2643221616 Leifsonia sp. Root227 Isolate Unclassified
7 2643221619 Agromyces sp. Root81 Isolate Unclassified
8 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
9 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
10 2643221649 Leifsonia sp. Root4 Isolate Unclassified
11 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
12 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
13 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
14 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
15 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
16 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
17 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
18 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
19 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
20 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
21 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
22 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
23 2808606372 Agromyces sp. 23-23 Isolate Unclassified
24 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
25 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
26 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
27 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
28 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
29 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
30 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
31 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
32 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
33 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
34 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
35 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
36 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
37 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
38 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
39 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
40 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
41 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
42 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
43 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
44 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
45 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
46 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
47 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
48 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
49 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
50 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
51 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
52 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
53 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
54 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
55 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
56 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
57 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
58 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
59 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
60 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
61 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
62 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
63 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
64 2920879853 Kocuria salina CV6 Isolate Unclassified
65 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
66 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
67 2928153084 Leifsonia sp. 563 Isolate Unclassified
68 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
69 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
70 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
71 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
72 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
73 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
74 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
75 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
76 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
77 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
78 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
79 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
80 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
81 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
82 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
83 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
84 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
85 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
86 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
87 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
88 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
89 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
90 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
91 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
92 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
93 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
94 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
95 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
96 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
97 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
98 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
99 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
100 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
101 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
102 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
103 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
104 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
105 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
106 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
107 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
108 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
109 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
110 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
111 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
116 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
120 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
121 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
122 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
123 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
128 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
144 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
231 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
232 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
233 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
241 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
242 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
243 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
244 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
245 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
248 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
335 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
336 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
339 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
342 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
343 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
346 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
352 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
353 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
354 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
355 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
356 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
357 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
358 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
359 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
360 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.71
Metatranscriptomes 2.37
Isolates 16.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 9.64
Nodule 0
Rhizoplane 5.25
Rhizosphere 70.9
Stem 0
Stem Tuber 0.34
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000796 3300000549 Bacteria 4976
2 JGI24735J21928_10000648 3300002067 Bacteria 12289
3 JGI25164J39214_1000221 3300002772 Bacteria 45392
4 JGI25152J39213_1000335 3300002773 Bacteria 29846
5 JGI25165J46597_1000332 3300003214 Bacteria 56112
6 rootL2_10051125 3300003322 Bacteria 7716
7 Ga0006562J51391_1008124 3300003578 Bacteria 25634
8 Ga0006562J51391_1008125 3300003578 Bacteria 24266
9 Ga0055539_1000005 3300003752 Bacteria 609598
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000290 3300003759 Bacteria 45300
12 Ga0055527_1000017 3300003760 Bacteria 242362
13 Ga0055542_1000510 3300003762 Bacteria 35439
14 Ga0055542_1007225 3300003762 Bacteria 2281
15 Ga0055529_1000093 3300003763 Bacteria 137160
16 Ga0065714_10110058 3300005288 Bacteria 1491
17 Ga0070658_10000283 3300005327 Bacteria 44628
18 Ga0070658_10273566 3300005327 Bacteria 1437
19 Ga0070676_10022103 3300005328 Bacteria 3565
20 Ga0070683_100349988 3300005329 Bacteria 1407
21 Ga0070666_10049641 3300005335 Bacteria 2820
22 Ga0070682_100028082 3300005337 Bacteria 3382
23 Ga0070682_100111772 3300005337 Bacteria 1822
24 Ga0068868_100315512 3300005338 Bacteria 1331
25 Ga0070668_100130262 3300005347 Bacteria 2018
26 Ga0070675_100012252 3300005354 Bacteria 6721
27 Ga0070671_100046897 3300005355 Bacteria 3594
28 Ga0070671_100055550 3300005355 Bacteria 3294
29 Ga0070671_100130497 3300005355 Bacteria 2116
30 Ga0070674_100125182 3300005356 Bacteria 1908
31 Ga0070673_100015553 3300005364 Bacteria 5349
32 Ga0070659_100051233 3300005366 Bacteria 3245
33 Ga0070667_100054997 3300005367 Bacteria 3361
34 Ga0070710_10175799 3300005437 Bacteria 1337
35 Ga0070678_100004891 3300005456 Bacteria 7661
36 Ga0068853_100210310 3300005539 Bacteria 1773
37 Ga0068853_100323530 3300005539 Bacteria 1430
38 Ga0070672_100009208 3300005543 Bacteria 6798
39 Ga0068855_100001410 3300005563 Bacteria 29846
40 Ga0068855_100203990 3300005563 Bacteria 2225
41 Ga0068855_100225444 3300005563 Bacteria 2100
42 Ga0068857_100011165 3300005577 Bacteria 7811
43 Ga0068854_100113662 3300005578 Bacteria 2045
44 Ga0068852_100000569 3300005616 Bacteria 24306
45 Ga0068859_100326196 3300005617 Bacteria 1629
46 Ga0068851_10000015 3300005834 Bacteria 145191
47 Ga0068863_100095689 3300005841 Bacteria 2819
48 Ga0068863_100114452 3300005841 Bacteria 2570
49 Ga0068858_100000392 3300005842 Bacteria 45884
50 Ga0081455_10015297 3300005937 Bacteria 7461
51 Ga0075364_10005640 3300006051 Bacteria 7298
52 Ga0075432_10008426 3300006058 Bacteria 3517
53 Ga0097620_100326243 3300006931 Bacteria 1629
54 Ga0105251_10027771 3300009011 Bacteria 2864
55 Ga0105244_10005040 3300009036 Bacteria 8883
56 Ga0105244_10017673 3300009036 Bacteria 4025
57 Ga0105244_10106465 3300009036 Bacteria 1368
58 Ga0105240_10004148 3300009093 Bacteria 22199
59 Ga0105240_10299334 3300009093 Bacteria 1840
60 Ga0105245_10011431 3300009098 Bacteria 7731
61 Ga0105247_10132403 3300009101 Bacteria 1626
62 Ga0105243_10004454 3300009148 Bacteria 11077
63 Ga0105241_10005173 3300009174 Bacteria 9626
64 Ga0105248_10000424 3300009177 Bacteria 48349
65 Ga0105248_10022304 3300009177 Bacteria 7020
66 Ga0105237_10001195 3300009545 Bacteria 34741
67 Ga0105238_10000985 3300009551 Bacteria 29112
68 Ga0105239_10409232 3300010375 Bacteria 1536
69 Ga0105246_10001732 3300011119 Bacteria 13032
70 Ga0105246_10068200 3300011119 Bacteria 2494
71 Ga0157371_10071438 3300013102 Bacteria 2457
72 Ga0157370_10026950 3300013104 Bacteria 5668
73 Ga0157369_10004620 3300013105 Bacteria 16184
74 Ga0157369_10008207 3300013105 Bacteria 11976
75 Ga0157369_10022764 3300013105 Bacteria 6987
76 Ga0157369_10071925 3300013105 Bacteria 3712
77 Ga0163162_10118225 3300013306 Bacteria 2752
78 Ga0163162_10182330 3300013306 Bacteria 2226
79 Ga0157372_10075462 3300013307 Bacteria 3804
80 Ga0163163_10005307 3300014325 Bacteria 11125
81 Ga0157380_10009914 3300014326 Bacteria 6838
82 Ga0157379_10016284 3300014968 Bacteria 6540
83 Ga0163161_10233078 3300017792 Bacteria 1429
84 Ga0197907_10356313 3300020069 Bacteria 1633
85 Ga0206354_10256430 3300020081 Bacteria 4456
86 Ga0206354_11615369 3300020081 Bacteria 1278
87 Ga0206353_10052524 3300020082 Bacteria 1824
88 Ga0209566_100053 3300025225 Bacteria 224436
89 Ga0209674_100001 3300025226 Bacteria 4013750
90 Ga0209672_100039 3300025228 Bacteria 283064
91 Ga0209147_101088 3300025229 Bacteria 11393
92 Ga0209563_100001 3300025230 Bacteria 4013775
93 Ga0207427_100042 3300025231 Bacteria 254170
94 Ga0209437_100497 3300025233 Bacteria 28633
95 Ga0209258_101225 3300025242 Bacteria 9932
96 Ga0207425_1002975 3300025245 Bacteria 5663
97 Ga0209677_100001 3300025253 Bacteria 4013787
98 Ga0209677_100378 3300025253 Bacteria 27274
99 Ga0209148_1000004 3300025254 Bacteria 1844481
100 Ga0209148_1000804 3300025254 Bacteria 22935
101 Ga0209148_1003104 3300025254 Bacteria 4853
102 Ga0209129_1000112 3300025258 Bacteria 148742
103 Ga0209233_1000001 3300025261 Bacteria 2992747
104 Ga0209455_1000117 3300025272 Bacteria 176940
105 Ga0209455_1002209 3300025272 Bacteria 7700
106 Ga0209025_1000250 3300025294 Bacteria 126596
107 Ga0209051_1002132 3300025303 Bacteria 14737
108 Ga0207697_10005852 3300025315 Bacteria 5650
109 Ga0207656_10000001 3300025321 Bacteria 1323684
110 Ga0207655_1019811 3300025728 Bacteria 3494
111 Ga0207655_1024777 3300025728 Bacteria 2931
112 Ga0207713_1013121 3300025735 Bacteria 4387
113 Ga0207682_10037854 3300025893 Bacteria 1955
114 Ga0207688_10090412 3300025901 Bacteria 1757
115 Ga0207645_10011658 3300025907 Bacteria 5994
116 Ga0207643_10171373 3300025908 Bacteria 1310
117 Ga0207705_10000001 3300025909 Bacteria 2061880
118 Ga0207654_10000001 3300025911 Bacteria 1816198
119 Ga0207695_10000921 3300025913 Bacteria 52654
120 Ga0207671_10000001 3300025914 Bacteria 1318881
121 Ga0207657_10019751 3300025919 Bacteria 6387
122 Ga0207649_10037544 3300025920 Bacteria 2926
123 Ga0207681_10022932 3300025923 Bacteria 3986
124 Ga0207694_10000052 3300025924 Bacteria 157700
125 Ga0207659_10026524 3300025926 Bacteria 3910
126 Ga0207644_10030560 3300025931 Bacteria 3748
127 Ga0207686_10277309 3300025934 Bacteria 1236
128 Ga0207709_10005069 3300025935 Bacteria 7521
129 Ga0207709_10026373 3300025935 Bacteria 3338
130 Ga0207709_10061581 3300025935 Bacteria 2345
131 Ga0207669_10029807 3300025937 Bacteria 3023
132 Ga0207691_10005671 3300025940 Bacteria 12067
133 Ga0207711_10000299 3300025941 Bacteria 53150
134 Ga0207711_10201804 3300025941 Bacteria 1815
135 Ga0207667_10004099 3300025949 Bacteria 17907
136 Ga0207667_10007302 3300025949 Bacteria 13314
137 Ga0207668_10145451 3300025972 Bacteria 1828
138 Ga0207658_10036312 3300025986 Bacteria 3532
139 Ga0207658_10043056 3300025986 Bacteria 3280
140 Ga0207658_10059438 3300025986 Bacteria 2848
141 Ga0207703_10000137 3300026035 Bacteria 89265
142 Ga0207639_10164154 3300026041 Bacteria 1875
143 Ga0207639_10259184 3300026041 Bacteria 1520
144 Ga0207641_10052205 3300026088 Bacteria 3462
145 Ga0207641_10135848 3300026088 Bacteria 2213
146 Ga0207674_10073798 3300026116 Bacteria 3424
147 Ga0207683_10002078 3300026121 Bacteria 17678
148 Ga0207698_10000369 3300026142 Bacteria 26377
149 Ga0207428_10004666 3300027907 Bacteria 12982
150 Ga0268265_10209701 3300028380 Bacteria 1697
151 Ga0307515_10098427 3300028794 Bacteria 3562
152 Ga0307515_10155072 3300028794 Bacteria 2369
153 Ga0307512_10033013 3300030522 Bacteria 4459
154 Ga0307408_100005164 3300031548 Bacteria 8756
155 Ga0307408_100006339 3300031548 Bacteria 7853
156 Ga0307408_100008194 3300031548 Bacteria 6904
157 Ga0307408_100013010 3300031548 Bacteria 5518
158 Ga0307408_100015414 3300031548 Bacteria 5087
159 Ga0307408_100021433 3300031548 Bacteria 4372
160 Ga0307408_100049705 3300031548 Bacteria 3012
161 Ga0307408_100191377 3300031548 Bacteria 1648
162 Ga0307514_10006539 3300031649 Bacteria 10138
163 Ga0307405_10003873 3300031731 Bacteria 6976
164 Ga0307405_10008520 3300031731 Bacteria 5205
165 Ga0307405_10019879 3300031731 Bacteria 3742
166 Ga0307405_10025568 3300031731 Bacteria 3392
167 Ga0307405_10038492 3300031731 Bacteria 2883
168 Ga0307405_10110347 3300031731 Bacteria 1862
169 Ga0307405_10437608 3300031731 Bacteria 1033
170 Ga0307413_10005820 3300031824 Bacteria 5554
171 Ga0307413_10036821 3300031824 Bacteria 2821
172 Ga0307413_10062375 3300031824 Bacteria 2305
173 Ga0307413_10073679 3300031824 Bacteria 2159
174 Ga0307413_10094300 3300031824 Bacteria 1959
175 Ga0307413_10146734 3300031824 Bacteria 1638
176 Ga0307413_10154114 3300031824 Bacteria 1605
177 Ga0307413_10356356 3300031824 Bacteria 1131
178 Ga0307518_10000548 3300031838 Bacteria 28610
179 Ga0307518_10072732 3300031838 Bacteria 2489
180 Ga0307410_10002324 3300031852 Bacteria 9141
181 Ga0307410_10004164 3300031852 Bacteria 7418
182 Ga0307410_10005494 3300031852 Bacteria 6717
183 Ga0307410_10005769 3300031852 Bacteria 6599
184 Ga0307410_10008661 3300031852 Bacteria 5655
185 Ga0307410_10096735 3300031852 Bacteria 2108
186 Ga0307410_10224862 3300031852 Bacteria 1446
187 Ga0307410_10335522 3300031852 Bacteria 1203
188 Ga0307406_10011980 3300031901 Bacteria 4933
189 Ga0307406_10014855 3300031901 Bacteria 4489
190 Ga0307406_10025003 3300031901 Bacteria 3571
191 Ga0307406_10036213 3300031901 Bacteria 3039
192 Ga0307406_10037301 3300031901 Bacteria 3001
193 Ga0307406_10111538 3300031901 Bacteria 1884
194 Ga0307406_10149228 3300031901 Bacteria 1666
195 Ga0307406_10171096 3300031901 Bacteria 1572
196 Ga0307407_10008930 3300031903 Bacteria 4634
197 Ga0307407_10017239 3300031903 Bacteria 3617
198 Ga0307407_10032382 3300031903 Bacteria 2842
199 Ga0307407_10034683 3300031903 Bacteria 2765
200 Ga0307407_10078973 3300031903 Bacteria 1984
201 Ga0307407_10107121 3300031903 Bacteria 1747
202 Ga0307407_10176603 3300031903 Bacteria 1412
203 Ga0307407_10213114 3300031903 Bacteria 1301
204 Ga0307407_10237400 3300031903 Bacteria 1242
205 Ga0307412_10001075 3300031911 Bacteria 15643
206 Ga0307412_10014928 3300031911 Bacteria 4592
207 Ga0307412_10018573 3300031911 Bacteria 4188
208 Ga0307412_10036714 3300031911 Bacteria 3142
209 Ga0307412_10039308 3300031911 Bacteria 3053
210 Ga0307412_10080797 3300031911 Bacteria 2246
211 Ga0307412_10152193 3300031911 Bacteria 1708
212 Ga0307412_10165243 3300031911 Bacteria 1649
213 Ga0307409_100002974 3300031995 Bacteria 9032
214 Ga0307409_100037668 3300031995 Bacteria 3567
215 Ga0307409_100075255 3300031995 Bacteria 2702
216 Ga0307409_100139782 3300031995 Bacteria 2084
217 Ga0307409_100221257 3300031995 Bacteria 1709
218 Ga0307409_100261017 3300031995 Bacteria 1590
219 Ga0307416_100005303 3300032002 Bacteria 7902
220 Ga0307416_100006566 3300032002 Bacteria 7295
221 Ga0307416_100032831 3300032002 Bacteria 3928
222 Ga0307416_100035860 3300032002 Bacteria 3794
223 Ga0307416_100055172 3300032002 Bacteria 3198
224 Ga0307416_100055465 3300032002 Bacteria 3192
225 Ga0307416_100181051 3300032002 Bacteria 1975
226 Ga0307416_100216480 3300032002 Bacteria 1832
227 Ga0307416_100268768 3300032002 Bacteria 1672
228 Ga0307416_100525075 3300032002 Bacteria 1253
229 Ga0307414_10026209 3300032004 Bacteria 3749
230 Ga0307414_10382894 3300032004 Bacteria 1217
231 Ga0307411_10040361 3300032005 Bacteria 2960
232 Ga0307507_10014578 3300033179 Bacteria 9352
233 Ga0395899_0001710 3300037312 Bacteria 18277
234 Ga0395899_0105350 3300037312 Bacteria 2031
235 Ga0395900_0003644 3300037418 Bacteria 16559
236 Ga0395900_0090086 3300037418 Bacteria 3153
237 Ga0395900_0267174 3300037418 Bacteria 1706
238 Ga0395898_0000256 3300037466 Bacteria 130878
239 Ga0395898_0044522 3300037466 Bacteria 4368
240 Ga0395898_0048110 3300037466 Bacteria 4183
241 Ga0395901_0088798 3300038443 Bacteria 3233
242 Ga0395901_0118107 3300038443 Bacteria 2786
243 Ga0395901_0138915 3300038443 Bacteria 2554
244 Ga0395901_0246317 3300038443 Bacteria 1863
245 Ga0395901_0331061 3300038443 Bacteria 1574
246 Ga0436365_0286524 3300039437 Bacteria 3322
247 Ga0439438_001276 3300041405 Bacteria 11137
248 Ga0439438_010891 3300041405 Bacteria 2856
249 Ga0439466_0004168 3300041411 Bacteria 5581
250 Ga0439466_0015204 3300041411 Bacteria 2796
251 Ga0439465_0068919 3300041413 Bacteria 1183
252 Ga0451793_1032801 3300041452 Bacteria 2155
253 Ga0451797_0041912 3300041453 Bacteria 2616
254 Ga0439431_0033614 3300041997 Bacteria 1283
255 Ga0439433_0002503 3300041999 Bacteria 3901
256 Ga0439433_0004844 3300041999 Bacteria 2890
257 Ga0439433_0017148 3300041999 Bacteria 1606
258 Ga0439433_0023429 3300041999 Bacteria 1389
259 Ga0439442_000041 3300042002 Bacteria 29264
260 Ga0439442_000092 3300042002 Bacteria 21656
261 Ga0439442_000188 3300042002 Bacteria 15709
262 Ga0439442_001387 3300042002 Bacteria 4799
263 Ga0439432_000386 3300042006 Bacteria 16309
264 Ga0439449_0007826 3300042007 Bacteria 4057
265 Ga0439449_0017884 3300042007 Bacteria 2661
266 Ga0439452_004173 3300042010 Bacteria 4898
267 Ga0439457_005369 3300042014 Bacteria 3232
268 Ga0439457_015347 3300042014 Bacteria 1711
269 Ga0450920_000186 3300042122 Bacteria 8980
270 Ga0450920_002175 3300042122 Bacteria 3313
271 Ga0450907_001589 3300042146 Bacteria 4818
272 Ga0439446_0004957 3300042156 Bacteria 3404
273 Ga0450909_000621 3300042185 Bacteria 4693
274 Ga0439434_0000105 3300042435 Bacteria 21658
275 Ga0439434_0000679 3300042435 Bacteria 9825
276 Ga0450918_001880 3300042531 Bacteria 4065
277 Ga0450918_004147 3300042531 Bacteria 2656
278 Ga0466972_0002787 3300044658 Bacteria 8665
279 Ga0466972_0018966 3300044658 Bacteria 3438
280 Ga0466965_0000006 3300044683 Bacteria 158069
281 Ga0466965_0053458 3300044683 Bacteria 2007
282 Ga0466965_0069315 3300044683 Bacteria 1772
283 Ga0466965_0070672 3300044683 Bacteria 1755
284 Ga0466965_0116433 3300044683 Bacteria 1377
285 Ga0466966_0033556 3300044684 Bacteria 3323
286 Ga0466966_0099457 3300044684 Bacteria 1800
287 Ga0466961_0049866 3300044693 Bacteria 2675
288 Ga0466970_0004291 3300044765 Bacteria 7015
289 Ga0466970_0085690 3300044765 Bacteria 1707
290 Ga0466970_0112172 3300044765 Bacteria 1489
291 Ga0466957_0024638 3300044842 Bacteria 3562
292 Ga0466957_0149830 3300044842 Bacteria 1508
293 Ga0466959_0019039 3300045049 Bacteria 5046
294 Ga0466967_0580056 3300045976 Bacteria 1105
295 Ga0495590_0000119 3300046457 Bacteria 47435
296 Ga0495653_0006896 3300046463 Bacteria 9337
297 Ga0495650_0000847 3300046471 Bacteria 36764
298 Ga0495580_0044984 3300046472 Bacteria 3137
299 Ga0495582_0105160 3300046473 Bacteria 1582
300 Ga0495639_0038773 3300046475 Bacteria 2140
301 Ga0495662_0036627 3300046476 Bacteria 2367
302 Ga0495664_0007474 3300046477 Bacteria 6069
303 Ga0495594_0122965 3300046499 Bacteria 1467
304 Ga0495630_0037067 3300046517 Bacteria 3645
305 Ga0495665_0012197 3300046531 Bacteria 4651
306 Ga0495645_0093580 3300046543 Bacteria 2144
307 Ga0495667_0000893 3300046559 Bacteria 19286
308 Ga0495625_0120705 3300046660 Bacteria 1784
309 Ga0495623_0163666 3300046679 Bacteria 1305
310 Ga0495613_0257056 3300046689 Bacteria 1218
311 Ga0495670_0004877 3300046691 Bacteria 6588
312 Ga0495649_0094328 3300046694 Bacteria 1593
313 Ga0495600_0073585 3300046809 Bacteria 2231
314 Ga0495600_0081196 3300046809 Bacteria 2116
315 Ga0495581_0032451 3300047315 Bacteria 3023
316 Ga0495604_0167584 3300047317 Bacteria 1548
317 Ga0495672_0003803 3300047320 Bacteria 12709
318 Ga0495680_0011873 3300047322 Bacteria 7687
319 Ga0495675_0054725 3300047444 Bacteria 2531
320 Ga0495686_0159372 3300047472 Bacteria 1319
321 Ga0495686_0239509 3300047472 Bacteria 1024
322 Ga0495593_0032340 3300047673 Bacteria 2853
323 Ga0496100_0168889 3300048903 Bacteria 1573
324 Ga0496101_0015223 3300048904 Bacteria 5177
325 Ga0496101_0104779 3300048904 Bacteria 2121
326 Ga0496101_0310651 3300048904 Bacteria 1236
327 Ga0496102_0018590 3300048905 Bacteria 6111
328 Ga0496102_0032002 3300048905 Bacteria 4723
329 Ga0496102_0166420 3300048905 Bacteria 2074
330 Ga0496102_0314186 3300048905 Bacteria 1476
331 Ga0496103_0029975 3300048906 Bacteria 3308
332 Ga0496103_0059846 3300048906 Bacteria 2366
333 Ga0496104_0046486 3300048907 Bacteria 4088
334 Ga0496104_0059857 3300048907 Bacteria 3606
335 Ga0496105_0013576 3300048908 Bacteria 6470
336 Ga0496105_0030992 3300048908 Bacteria 4384
337 Ga0496105_0042984 3300048908 Bacteria 3726
338 Ga0496105_0054820 3300048908 Bacteria 3291
339 Ga0496107_0068842 3300048910 Bacteria 2568
340 Ga0496107_0089205 3300048910 Bacteria 2251
341 Ga0496108_0015841 3300048911 Bacteria 6145
342 Ga0496109_0116877 3300048912 Bacteria 2482
343 Ga0496110_0290322 3300048913 Bacteria 1489
344 Ga0496111_0026515 3300048914 Bacteria 4093
345 Ga0496112_0016783 3300048915 Bacteria 6867
346 Ga0496112_0017680 3300048915 Bacteria 6707
347 Ga0496113_0057470 3300048916 Bacteria 2924
348 Ga0496113_0069192 3300048916 Bacteria 2680
349 Ga0496114_0034861 3300048917 Bacteria 4154
350 Ga0496114_0058892 3300048917 Bacteria 3207
351 Ga0496115_0039861 3300048918 Bacteria 3732
352 Ga0496117_0000187 3300048920 Bacteria 127214
353 Ga0496117_0012357 3300048920 Bacteria 7536
354 Ga0496117_0020730 3300048920 Bacteria 5349
355 Ga0496117_0021010 3300048920 Bacteria 5304
356 Ga0496117_0116475 3300048920 Bacteria 1651
357 Ga0496118_0012907 3300048921 Bacteria 7957
358 Ga0496118_0018032 3300048921 Bacteria 6392
359 Ga0496118_0044419 3300048921 Bacteria 3480
360 Ga0496119_0000877 3300048922 Bacteria 39454
361 Ga0496119_0004357 3300048922 Bacteria 14119
362 Ga0496119_0046878 3300048922 Bacteria 2694
363 Ga0496119_0073465 3300048922 Bacteria 1994
364 Ga0496119_0081999 3300048922 Bacteria 1855
365 Ga0496120_0000251 3300048923 Bacteria 90074
366 Ga0496120_0005655 3300048923 Bacteria 9888
367 Ga0496120_0024417 3300048923 Bacteria 3770
368 Ga0496120_0103075 3300048923 Bacteria 1504
369 Ga0496121_0000015 3300048924 Bacteria 571958
370 Ga0496121_0030377 3300048924 Bacteria 4963
371 Ga0496121_0095517 3300048924 Bacteria 2310
372 Ga0496122_0001338 3300048925 Bacteria 40252
373 Ga0496122_0031190 3300048925 Bacteria 4443
374 Ga0496122_0204236 3300048925 Bacteria 1152
375 Ga0496123_0013226 3300048926 Bacteria 6954
376 Ga0496123_0014936 3300048926 Bacteria 6401
377 Ga0496124_0000198 3300048927 Bacteria 119277
378 Ga0496124_0020400 3300048927 Bacteria 6124
379 Ga0496124_0057504 3300048927 Bacteria 3276
380 Ga0496124_0091662 3300048927 Bacteria 2476
381 Ga0496124_0158540 3300048927 Bacteria 1767
382 Ga0496126_0002020 3300048929 Bacteria 28690
383 Ga0501315_002313 3300049531 Bacteria 1773
384 Ga0501317_005051 3300049533 Bacteria 1399
385 Ga0501317_010282 3300049533 Bacteria 1116
386 Ga0501318_005181 3300049534 Bacteria 1281
387 Ga0501319_003672 3300049535 Bacteria 1037
388 Ga0501320_001605 3300049536 Bacteria 1695
389 Ga0501324_005116 3300049540 Bacteria 1067
390 Ga0501032_0002596 3300049569 Bacteria 14140
391 Ga0501032_0004442 3300049569 Bacteria 10572
392 Ga0501032_0005806 3300049569 Bacteria 9133
393 Ga0501033_0001694 3300049570 Bacteria 19289
394 Ga0501033_0006711 3300049570 Bacteria 8991
395 Ga0501033_0047265 3300049570 Bacteria 3200
396 Ga0501033_0052555 3300049570 Bacteria 3019
397 Ga0501033_0065948 3300049570 Bacteria 2662
398 Ga0501033_0080110 3300049570 Bacteria 2396
399 Ga0501033_0220341 3300049570 Bacteria 1351
400 Ga0501034_0001978 3300049571 Bacteria 25960
401 Ga0501034_0003478 3300049571 Bacteria 17894
402 Ga0501034_0010368 3300049571 Bacteria 9711
403 Ga0501034_0011006 3300049571 Bacteria 9390
404 Ga0501034_0035949 3300049571 Bacteria 5022
405 Ga0501034_0036919 3300049571 Bacteria 4947
406 Ga0501034_0066323 3300049571 Bacteria 3622
407 Ga0501034_0100381 3300049571 Bacteria 2888
408 Ga0501034_0291620 3300049571 Bacteria 1569
409 Ga0501036_0024746 3300049572 Bacteria 5062
410 Ga0501036_0025359 3300049572 Bacteria 5001
411 Ga0501037_0016701 3300049573 Bacteria 5401
412 Ga0501037_0029637 3300049573 Bacteria 4043
413 Ga0501037_0032780 3300049573 Bacteria 3838
414 Ga0501037_0098723 3300049573 Bacteria 2109
415 Ga0501037_0142221 3300049573 Bacteria 1716
416 Ga0501037_0184407 3300049573 Bacteria 1480
417 Ga0501038_0006806 3300049574 Bacteria 10559
418 Ga0501038_0027374 3300049574 Bacteria 5072
419 Ga0501038_0088324 3300049574 Bacteria 2602
420 Ga0501039_0054375 3300049575 Bacteria 3099
421 Ga0501042_0000137 3300049578 Bacteria 31861
422 Ga0501042_0005701 3300049578 Bacteria 8038
423 Ga0501043_0002820 3300049579 Bacteria 14535
424 Ga0501043_0162139 3300049579 Bacteria 1747
425 Ga0501043_0217242 3300049579 Bacteria 1480
426 Ga0501043_0228058 3300049579 Bacteria 1439
427 Ga0501046_0021321 3300049580 Bacteria 5347
428 Ga0501046_0051891 3300049580 Bacteria 3234
429 Ga0501047_0003343 3300049581 Bacteria 15195
430 Ga0501047_0006201 3300049581 Bacteria 11241
431 Ga0501047_0046784 3300049581 Bacteria 4181
432 Ga0501047_0053048 3300049581 Bacteria 3919
433 Ga0501048_0002568 3300049582 Bacteria 13908
434 Ga0501070_0000472 3300049586 Bacteria 36579
435 Ga0501070_0000654 3300049586 Bacteria 31914
436 Ga0501070_0011793 3300049586 Bacteria 7382
437 Ga0501070_0060189 3300049586 Bacteria 3148
438 Ga0501070_0144427 3300049586 Bacteria 1964
439 Ga0501071_0000023 3300049587 Bacteria 51151
440 Ga0501072_0217599 3300049588 Bacteria 1522
441 Ga0501073_0008840 3300049589 Bacteria 7449
442 Ga0501073_0014990 3300049589 Bacteria 5623
443 Ga0501073_0081729 3300049589 Bacteria 2248
444 Ga0501074_0033847 3300049590 Bacteria 3705
445 Ga0501080_0000189 3300049742 Bacteria 44995
446 Ga0501080_0058875 3300049742 Bacteria 3575
447 Ga0501080_0263351 3300049742 Bacteria 1570
448 Ga0501083_0000119 3300049744 Bacteria 53723
449 Ga0501083_0005965 3300049744 Bacteria 8624
450 Ga0501035_0001199 3300049822 Bacteria 27008
451 Ga0501035_0010610 3300049822 Bacteria 8531
452 Ga0501035_0021302 3300049822 Bacteria 5960
453 Ga0501035_0027399 3300049822 Bacteria 5208
454 Ga0501044_0000954 3300049823 Bacteria 34722
455 Ga0501044_0011207 3300049823 Bacteria 9722
456 Ga0501044_0061441 3300049823 Bacteria 3843
457 Ga0501044_0076284 3300049823 Bacteria 3402
458 Ga0501044_0095729 3300049823 Bacteria 2991
459 Ga0501044_0295522 3300049823 Bacteria 1550
460 Ga0501045_0067691 3300049824 Bacteria 2623
461 Ga0500635_0000037 3300053080 Bacteria 93959
462 Ga0495655_0002907 3300053083 Bacteria 2767
463 Ga0500643_000224 3300053087 Bacteria 52829
464 Ga0500651_0000667 3300053093 Bacteria 17073
465 Ga0500650_0003001 3300053098 Bacteria 5744
466 Ga0500556_0000100 3300053104 Bacteria 78417
467 Ga0500556_0000608 3300053104 Bacteria 22924
468 Ga0500562_001618 3300053108 Bacteria 5601
469 Ga0500593_001439 3300053117 Bacteria 8558
470 Ga0500655_002445 3300053133 Bacteria 3384
471 Ga0500559_0001102 3300053136 Bacteria 16296
472 Ga0500559_0001612 3300053136 Bacteria 12562
473 Ga0500559_0002027 3300053136 Bacteria 10840
474 Ga0500559_0009199 3300053136 Bacteria 4288
475 Ga0500568_0000100 3300053139 Bacteria 78717
476 Ga0500568_0000130 3300053139 Bacteria 67991
477 Ga0500568_0008583 3300053139 Bacteria 4911
478 Ga0500568_0018143 3300053139 Bacteria 3087
479 Ga0500573_0000014 3300053140 Bacteria 193353
480 Ga0500573_0000757 3300053140 Bacteria 14484
481 Ga0500573_0018463 3300053140 Bacteria 3974
482 Ga0500573_0043337 3300053140 Bacteria 2596
483 Ga0500590_001506 3300053148 Bacteria 9648
484 Ga0500616_0000027 3300053153 Bacteria 441053
485 Ga0500616_0000089 3300053153 Bacteria 191075
486 Ga0500616_0000115 3300053153 Bacteria 147212
487 Ga0500620_000071 3300053155 Bacteria 19379
488 Ga0501084_0013043 3300054114 Bacteria 6878
489 Ga0501084_0271722 3300054114 Bacteria 1431
490 Ga0587090_007087 3300059510 Bacteria 1462
491 Ga0466962_0091015 3300061719 Bacteria 1461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0085690 Ga0466970_0085690_72_1016 272
2 3300005329 Ga0070683_100349988 Ga0070683_1003499882 280
3 3300013105 Ga0157369_10008207 Ga0157369_100082073 282
4 3300038443 Ga0395901_0246317 Ga0395901_0246317_876_1847 283
5 3300048927 Ga0496124_0158540 Ga0496124_0158540_722_1726 283
6 3300017792 Ga0163161_10233078 Ga0163161_102330782 285
7 3300009036 Ga0105244_10017673 Ga0105244_100176732 286
8 3300053080 Ga0500635_0000037 Ga0500635_0000037_18399_19439 286
9 3300025935 Ga0207709_10061581 Ga0207709_100615812 287
10 3300044683 Ga0466965_0000006 Ga0466965_0000006_12248_13228 287
11 3300049575 Ga0501039_0054375 Ga0501039_0054375_240_1232 288
12 3300005937 Ga0081455_10015297 Ga0081455_100152977 289
13 3300044684 Ga0466966_0033556 Ga0466966_0033556_952_1971 289
14 3300044842 Ga0466957_0024638 Ga0466957_0024638_2045_3064 289
15 3300061719 Ga0466962_0091015 Ga0466962_0091015_270_1289 289
16 3300044683 Ga0466965_0070672 Ga0466965_0070672_627_1640 290
17 3300044658 Ga0466972_0018966 Ga0466972_0018966_838_1848 291
18 3300044684 Ga0466966_0099457 Ga0466966_0099457_28_1038 291
19 3300044765 Ga0466970_0004291 Ga0466970_0004291_4432_5442 291
20 3300045049 Ga0466959_0019039 Ga0466959_0019039_2166_3176 291
21 3300045976 Ga0466967_0580056 Ga0466967_0580056_50_991 291
22 3300048924 Ga0496121_0030377 Ga0496121_0030377_816_1820 291
23 3300049569 Ga0501032_0002596 Ga0501032_0002596_11938_12933 291
24 3300049570 Ga0501033_0047265 Ga0501033_0047265_1933_2925 291
25 3300049570 Ga0501033_0220341 Ga0501033_0220341_243_1238 291
26 3300049571 Ga0501034_0003478 Ga0501034_0003478_16374_17369 291
27 3300049572 Ga0501036_0024746 Ga0501036_0024746_2510_3505 291
28 3300049573 Ga0501037_0032780 Ga0501037_0032780_2248_3243 291
29 3300049574 Ga0501038_0006806 Ga0501038_0006806_2278_3273 291
30 3300049579 Ga0501043_0228058 Ga0501043_0228058_39_1034 291
31 3300049580 Ga0501046_0021321 Ga0501046_0021321_3680_4675 291
32 3300049581 Ga0501047_0053048 Ga0501047_0053048_1041_2036 291
33 3300049744 Ga0501083_0005965 Ga0501083_0005965_1181_2176 291
34 3300049822 Ga0501035_0010610 Ga0501035_0010610_406_1401 291
35 3300049823 Ga0501044_0011207 Ga0501044_0011207_1641_2636 291
36 3300005337 Ga0070682_100028082 Ga0070682_1000280823 292
37 3300013105 Ga0157369_10022764 Ga0157369_100227647 292
38 3300013307 Ga0157372_10075462 Ga0157372_100754623 292
39 3300020069 Ga0197907_10356313 Ga0197907_103563131 292
40 3300020081 Ga0206354_10256430 Ga0206354_102564303 292
41 3300025253 Ga0209677_100378 Ga0209677_1003784 292
42 3300037312 Ga0395899_0001710 Ga0395899_0001710_16507_17532 292
43 3300037418 Ga0395900_0090086 Ga0395900_0090086_350_1375 292
44 3300044683 Ga0466965_0053458 Ga0466965_0053458_353_1375 292
45 3300044693 Ga0466961_0049866 Ga0466961_0049866_1548_2570 292
46 3300044765 Ga0466970_0112172 Ga0466970_0112172_126_1148 292
47 3300048905 Ga0496102_0018590 Ga0496102_0018590_3842_4855 292
48 3300048905 Ga0496102_0032002 Ga0496102_0032002_2789_3811 292
49 3300048906 Ga0496103_0029975 Ga0496103_0029975_1798_2820 292
50 3300048907 Ga0496104_0046486 Ga0496104_0046486_661_1683 292
51 3300048908 Ga0496105_0054820 Ga0496105_0054820_2011_3033 292
52 3300048921 Ga0496118_0012907 Ga0496118_0012907_5727_6740 292
53 3300048924 Ga0496121_0095517 Ga0496121_0095517_221_1243 292
54 3300005367 Ga0070667_100054997 Ga0070667_1000549972 293
55 3300005834 Ga0068851_10000015 Ga0068851_1000001586 293
56 3300009551 Ga0105238_10000985 Ga0105238_1000098521 293
57 3300010375 Ga0105239_10409232 Ga0105239_104092322 293
58 3300025321 Ga0207656_10000001 Ga0207656_10000001798 293
59 3300025914 Ga0207671_10000001 Ga0207671_10000001797 293
60 3300025924 Ga0207694_10000052 Ga0207694_1000005272 293
61 3300025986 Ga0207658_10036312 Ga0207658_100363122 293
62 3300031903 Ga0307407_10176603 Ga0307407_101766032 293
63 3300039437 Ga0436365_0286524 Ga0436365_0286524_2195_3142 293
64 3300041452 Ga0451793_1032801 Ga0451793_1032801_261_1223 293
65 3300048922 Ga0496119_0000877 Ga0496119_0000877_4056_5099 293
66 3300048923 Ga0496120_0000251 Ga0496120_0000251_8237_9280 293
67 3300049570 Ga0501033_0065948 Ga0501033_0065948_1614_2615 293
68 3300049571 Ga0501034_0100381 Ga0501034_0100381_965_1966 293
69 3300049572 Ga0501036_0025359 Ga0501036_0025359_642_1643 293
70 3300049578 Ga0501042_0005701 Ga0501042_0005701_4341_5342 293
71 3300049580 Ga0501046_0051891 Ga0501046_0051891_301_1302 293
72 3300049582 Ga0501048_0002568 Ga0501048_0002568_8698_9699 293
73 3300049586 Ga0501070_0060189 Ga0501070_0060189_826_1827 293
74 3300049589 Ga0501073_0014990 Ga0501073_0014990_2958_3959 293
75 3300049590 Ga0501074_0033847 Ga0501074_0033847_1775_2776 293
76 3300049742 Ga0501080_0058875 Ga0501080_0058875_1797_2798 293
77 3300049823 Ga0501044_0095729 Ga0501044_0095729_933_1934 293
78 3300005577 Ga0068857_100011165 Ga0068857_1000111655 294
79 3300009545 Ga0105237_10001195 Ga0105237_1000119524 294
80 3300026116 Ga0207674_10073798 Ga0207674_100737982 294
81 3300049573 Ga0501037_0029637 Ga0501037_0029637_1440_2450 294
82 3300049581 Ga0501047_0006201 Ga0501047_0006201_4525_5535 294
83 3300049744 Ga0501083_0000119 Ga0501083_0000119_36200_37183 294
84 3300049822 Ga0501035_0001199 Ga0501035_0001199_2383_3393 294
85 3300049823 Ga0501044_0000954 Ga0501044_0000954_3062_4072 294
86 3300025272 Ga0209455_1002209 Ga0209455_10022094 295
87 3300049570 Ga0501033_0052555 Ga0501033_0052555_48_1049 295
88 3300049822 Ga0501035_0021302 Ga0501035_0021302_3361_4380 295
89 3300002772 JGI25164J39214_1000221 JGI25164J39214_100022129 296
90 3300003214 JGI25165J46597_1000332 JGI25165J46597_100033222 296
91 3300005616 Ga0068852_100000569 Ga0068852_1000005694 296
92 3300025231 Ga0207427_100042 Ga0207427_100042219 296
93 3300025233 Ga0209437_100497 Ga0209437_10049710 296
94 3300025261 Ga0209233_1000001 Ga0209233_10000011305 296
95 3300026142 Ga0207698_10000369 Ga0207698_1000036919 296
96 3300031548 Ga0307408_100008194 Ga0307408_1000081942 296
97 3300031731 Ga0307405_10019879 Ga0307405_100198792 296
98 3300031852 Ga0307410_10005769 Ga0307410_100057692 296
99 3300031901 Ga0307406_10014855 Ga0307406_100148552 296
100 3300031995 Ga0307409_100002974 Ga0307409_1000029746 296
101 3300032002 Ga0307416_100006566 Ga0307416_1000065661 296
102 3300048922 Ga0496119_0081999 Ga0496119_0081999_110_1129 296
103 3300048923 Ga0496120_0005655 Ga0496120_0005655_6371_7390 296
104 3300049586 Ga0501070_0144427 Ga0501070_0144427_131_1129 296
105 3300049823 Ga0501044_0061441 Ga0501044_0061441_1053_2051 296
106 3300049824 Ga0501045_0067691 Ga0501045_0067691_261_1262 296
107 3300053140 Ga0500573_0043337 Ga0500573_0043337_93_1091 296
108 3300053153 Ga0500616_0000115 Ga0500616_0000115_54225_55259 296
109 3300005539 Ga0068853_100210310 Ga0068853_1002103101 297
110 3300005842 Ga0068858_100000392 Ga0068858_1000003922 297
111 3300026035 Ga0207703_10000137 Ga0207703_1000013792 297
112 3300026041 Ga0207639_10164154 Ga0207639_101641541 297
113 3300028794 Ga0307515_10155072 Ga0307515_101550721 297
114 3300044683 Ga0466965_0069315 Ga0466965_0069315_502_1530 297
115 3300054114 Ga0501084_0271722 Ga0501084_0271722_279_1304 297
116 3300020082 Ga0206353_10052524 Ga0206353_100525242 298
117 3300031824 Ga0307413_10356356 Ga0307413_103563561 298
118 3300031852 Ga0307410_10224862 Ga0307410_102248622 298
119 3300031901 Ga0307406_10111538 Ga0307406_101115382 298
120 3300041413 Ga0439465_0068919 Ga0439465_0068919_63_1103 298
121 3300048920 Ga0496117_0020730 Ga0496117_0020730_2810_3820 298
122 3300048921 Ga0496118_0018032 Ga0496118_0018032_3889_4899 298
123 3300048923 Ga0496120_0103075 Ga0496120_0103075_25_1035 298
124 3300048925 Ga0496122_0031190 Ga0496122_0031190_2810_3820 298
125 3300048927 Ga0496124_0000198 Ga0496124_0000198_3901_4911 298
126 3300049578 Ga0501042_0000137 Ga0501042_0000137_21540_22532 298
127 3300053140 Ga0500573_0018463 Ga0500573_0018463_367_1395 298
128 3300031649 Ga0307514_10006539 Ga0307514_100065397 299
129 3300044842 Ga0466957_0149830 Ga0466957_0149830_430_1392 299
130 3300047472 Ga0495686_0239509 Ga0495686_0239509_28_990 299
131 3300005543 Ga0070672_100009208 Ga0070672_1000092087 300
132 3300014326 Ga0157380_10009914 Ga0157380_100099142 300
133 3300031995 Ga0307409_100261017 Ga0307409_1002610172 300
134 3300048908 Ga0496105_0030992 Ga0496105_0030992_706_1695 300
135 3300048916 Ga0496113_0057470 Ga0496113_0057470_1025_2050 300
136 3300048918 Ga0496115_0039861 Ga0496115_0039861_2603_3592 300
137 iso_pu_bacteria 2585427649 2586065054 300
138 iso_pu_bacteria 2808606522 2809593462 300
139 iso_pu_bacteria 2899359706 2899366129 300
140 iso_pu_bacteria 2899370129 2899374716 300
141 iso_pu_bacteria 2915768154 2915769390 300
142 iso_pu_bacteria 2917736166 2917739037 300
143 iso_pu_bacteria 8003314358 8003319879 300
144 3300005327 Ga0070658_10273566 Ga0070658_102735662 301
145 3300005563 Ga0068855_100225444 Ga0068855_1002254442 301
146 3300005578 Ga0068854_100113662 Ga0068854_1001136622 301
147 3300005617 Ga0068859_100326196 Ga0068859_1003261962 301
148 3300006931 Ga0097620_100326243 Ga0097620_1003262432 301
149 3300009093 Ga0105240_10004148 Ga0105240_1000414814 301
150 3300009093 Ga0105240_10299334 Ga0105240_102993342 301
151 3300009098 Ga0105245_10011431 Ga0105245_100114315 301
152 3300014968 Ga0157379_10016284 Ga0157379_100162845 301
153 3300025913 Ga0207695_10000921 Ga0207695_1000092146 301
154 3300025919 Ga0207657_10019751 Ga0207657_100197512 301
155 3300025920 Ga0207649_10037544 Ga0207649_100375442 301
156 3300025949 Ga0207667_10007302 Ga0207667_100073026 301
157 3300025986 Ga0207658_10059438 Ga0207658_100594382 301
158 3300048920 Ga0496117_0021010 Ga0496117_0021010_113_1126 301
159 3300049570 Ga0501033_0006711 Ga0501033_0006711_2052_3050 301
160 3300049581 Ga0501047_0046784 Ga0501047_0046784_1125_2123 301
161 3300049823 Ga0501044_0295522 Ga0501044_0295522_225_1223 301
162 3300053155 Ga0500620_000071 Ga0500620_000071_18103_19119 301
163 3300048922 Ga0496119_0004357 Ga0496119_0004357_5163_6176 302
164 3300048925 Ga0496122_0204236 Ga0496122_0204236_79_1095 302
165 3300048927 Ga0496124_0020400 Ga0496124_0020400_3156_4166 302
166 iso_pu_bacteria 8047710418 8047714094 302
167 3300005338 Ga0068868_100315512 Ga0068868_1003155122 303
168 3300005355 Ga0070671_100046897 Ga0070671_1000468973 303
169 3300005437 Ga0070710_10175799 Ga0070710_101757992 303
170 3300026088 Ga0207641_10052205 Ga0207641_100522053 303
171 3300030522 Ga0307512_10033013 Ga0307512_100330134 303
172 3300031838 Ga0307518_10000548 Ga0307518_1000054820 303
173 3300033179 Ga0307507_10014578 Ga0307507_100145785 303
174 3300044658 Ga0466972_0002787 Ga0466972_0002787_950_1906 303
175 3300048925 Ga0496122_0001338 Ga0496122_0001338_3808_4866 303
176 3300048926 Ga0496123_0013226 Ga0496123_0013226_4300_5358 303
177 3300049586 Ga0501070_0000472 Ga0501070_0000472_11415_12434 303
178 3300053098 Ga0500650_0003001 Ga0500650_0003001_660_1688 303
179 iso_pu_bacteria 2643221619 2644111833 303
180 iso_pu_bacteria 2675903058 2676477531 303
181 iso_pu_bacteria 2721755702 2723641318 303
182 iso_pu_bacteria 2827628540 2827634789 303
183 iso_pu_bacteria 2852677369 2852678730 303
184 iso_pu_bacteria 2919443155 2919445717 303
185 iso_pu_bacteria 2935409751 2935410731 303
186 iso_pu_bacteria 8055034563 8055037096 303
187 iso_pu_bacteria 8055037949 8055039321 303
188 3300005355 Ga0070671_100130497 Ga0070671_1001304971 304
189 3300005841 Ga0068863_100114452 Ga0068863_1001144522 304
190 3300009174 Ga0105241_10005173 Ga0105241_100051733 304
191 3300014325 Ga0163163_10005307 Ga0163163_100053073 304
192 3300025254 Ga0209148_1000804 Ga0209148_100080422 304
193 3300025911 Ga0207654_10000001 Ga0207654_1000000184 304
194 3300026088 Ga0207641_10135848 Ga0207641_101358482 304
195 3300048921 Ga0496118_0044419 Ga0496118_0044419_473_1486 304
196 3300048922 Ga0496119_0046878 Ga0496119_0046878_950_1951 304
197 3300048923 Ga0496120_0024417 Ga0496120_0024417_1503_2504 304
198 3300048924 Ga0496121_0000015 Ga0496121_0000015_110596_111624 304
199 3300048929 Ga0496126_0002020 Ga0496126_0002020_14301_15317 304
200 3300049569 Ga0501032_0005806 Ga0501032_0005806_4250_5242 304
201 3300049570 Ga0501033_0080110 Ga0501033_0080110_809_1801 304
202 3300049571 Ga0501034_0291620 Ga0501034_0291620_407_1399 304
203 3300049573 Ga0501037_0016701 Ga0501037_0016701_1107_2099 304
204 3300053093 Ga0500651_0000667 Ga0500651_0000667_13509_14525 304
205 3300053148 Ga0500590_001506 Ga0500590_001506_4159_5175 304
206 iso_pu_bacteria 2643221549 2643768455 304
207 iso_pu_bacteria 2643221635 2644197197 304
208 iso_pu_bacteria 2643221649 2644278623 304
209 iso_pu_bacteria 2857729791 2857730523 304
210 iso_pu_bacteria 2928121344 2928123771 304
211 iso_pu_bacteria 2964326757 2964328595 304
212 iso_pu_bacteria 2966921586 2966922073 304
213 iso_pu_bacteria 2995726249 2995726792 304
214 iso_pu_bacteria 8002811521 8002814262 304
215 iso_pu_bacteria 8057345674 8057347551 304
216 3300003760 Ga0055527_1000017 Ga0055527_1000017227 305
217 3300003762 Ga0055542_1000510 Ga0055542_100051013 305
218 3300003763 Ga0055529_1000093 Ga0055529_100009324 305
219 3300005841 Ga0068863_100095689 Ga0068863_1000956892 305
220 3300009177 Ga0105248_10000424 Ga0105248_1000042423 305
221 3300025228 Ga0209672_100039 Ga0209672_100039230 305
222 3300025229 Ga0209147_101088 Ga0209147_1010886 305
223 3300025242 Ga0209258_101225 Ga0209258_1012258 305
224 3300025254 Ga0209148_1000004 Ga0209148_1000004230 305
225 3300025272 Ga0209455_1000117 Ga0209455_10001173 305
226 3300025941 Ga0207711_10000299 Ga0207711_1000029945 305
227 3300031838 Ga0307518_10072732 Ga0307518_100727322 305
228 3300032002 Ga0307416_100525075 Ga0307416_1005250752 305
229 3300049571 Ga0501034_0036919 Ga0501034_0036919_3822_4823 305
230 3300049742 Ga0501080_0263351 Ga0501080_0263351_528_1529 305
231 3300049822 Ga0501035_0027399 Ga0501035_0027399_49_1050 305
232 3300049823 Ga0501044_0076284 Ga0501044_0076284_196_1197 305
233 3300053153 Ga0500616_0000089 Ga0500616_0000089_74799_75809 305
234 iso_pu_bacteria 2554235227 2555231898 305
235 iso_pu_bacteria 2585428094 2587864053 305
236 iso_pu_bacteria 2643221572 2643876285 305
237 iso_pu_bacteria 2643221616 2644096583 305
238 iso_pu_bacteria 2643221632 2644182553 305
239 iso_pu_bacteria 2643221669 2644383340 305
240 iso_pu_bacteria 2654587600 2655031375 305
241 iso_pu_bacteria 2751185788 2753303524 305
242 iso_pu_bacteria 2808606372 2808901211 305
243 iso_pu_bacteria 2844841374 2844843196 305
244 iso_pu_bacteria 2844852863 2844854466 305
245 iso_pu_bacteria 2852643534 2852644553 305
246 iso_pu_bacteria 2857733635 2857734333 305
247 iso_pu_bacteria 2870622029 2870622350 305
248 iso_pu_bacteria 2884763398 2884766213 305
249 iso_pu_bacteria 2895660088 2895660465 305
250 iso_pu_bacteria 2897561785 2897562565 305
251 iso_pu_bacteria 2904430863 2904432562 305
252 iso_pu_bacteria 2904501621 2904501654 305
253 iso_pu_bacteria 2908674828 2908676292 305
254 iso_pu_bacteria 2909074476 2909077176 305
255 iso_pu_bacteria 2919039151 2919041852 305
256 iso_pu_bacteria 2919042368 2919043368 305
257 iso_pu_bacteria 2919055335 2919058684 305
258 iso_pu_bacteria 2919523602 2919525268 305
259 iso_pu_bacteria 2928104781 2928105637 305
260 iso_pu_bacteria 2928153084 2928153331 305
261 iso_pu_bacteria 2928500415 2928500774 305
262 iso_pu_bacteria 2939657138 2939659272 305
263 iso_pu_bacteria 2984551494 2984551815 305
264 iso_pu_bacteria 8046352972 8046353633 305
265 iso_pu_bacteria 8056037122 8056039240 305
266 3300003752 Ga0055539_1000005 Ga0055539_1000005463 306
267 3300003756 Ga0055533_1000001 Ga0055533_10000011532 306
268 3300003759 Ga0055525_1000290 Ga0055525_100029047 306
269 3300025225 Ga0209566_100053 Ga0209566_100053118 306
270 3300025226 Ga0209674_100001 Ga0209674_1000011533 306
271 3300025230 Ga0209563_100001 Ga0209563_1000011533 306
272 3300025253 Ga0209677_100001 Ga0209677_1000011533 306
273 3300028380 Ga0268265_10209701 Ga0268265_102097012 306
274 3300049570 Ga0501033_0001694 Ga0501033_0001694_17452_18444 306
275 3300049574 Ga0501038_0088324 Ga0501038_0088324_1359_2351 306
276 3300053108 Ga0500562_001618 Ga0500562_001618_3680_4678 306
277 3300053139 Ga0500568_0000130 Ga0500568_0000130_64253_65245 306
278 3300053139 Ga0500568_0008583 Ga0500568_0008583_3736_4719 306
279 iso_pu_bacteria 2862993130 2862993477 306
280 iso_pu_bacteria 2939660829 2939662884 306
281 iso_pu_bacteria 2966924647 2966927030 306
282 3300005563 Ga0068855_100001410 Ga0068855_10000141015 307
283 3300005563 Ga0068855_100203990 Ga0068855_1002039902 307
284 3300006051 Ga0075364_10005640 Ga0075364_100056404 307
285 3300009177 Ga0105248_10022304 Ga0105248_100223044 307
286 3300025941 Ga0207711_10201804 Ga0207711_102018042 307
287 3300025949 Ga0207667_10004099 Ga0207667_1000409917 307
288 3300028794 Ga0307515_10098427 Ga0307515_100984273 307
289 3300037418 Ga0395900_0003644 Ga0395900_0003644_6582_7604 307
290 3300037466 Ga0395898_0000256 Ga0395898_0000256_78567_79589 307
291 3300041405 Ga0439438_001276 Ga0439438_001276_4127_5125 307
292 3300041411 Ga0439466_0015204 Ga0439466_0015204_94_1092 307
293 3300041999 Ga0439433_0004844 Ga0439433_0004844_552_1550 307
294 3300042002 Ga0439442_001387 Ga0439442_001387_3073_4071 307
295 3300042006 Ga0439432_000386 Ga0439432_000386_4574_5572 307
296 3300042010 Ga0439452_004173 Ga0439452_004173_1715_2713 307
297 3300042014 Ga0439457_005369 Ga0439457_005369_1506_2504 307
298 3300042122 Ga0450920_002175 Ga0450920_002175_2200_3198 307
299 3300042156 Ga0439446_0004957 Ga0439446_0004957_577_1575 307
300 3300042185 Ga0450909_000621 Ga0450909_000621_3685_4683 307
301 3300042435 Ga0439434_0000679 Ga0439434_0000679_7497_8495 307
302 3300042531 Ga0450918_004147 Ga0450918_004147_389_1387 307
303 3300046471 Ga0495650_0000847 Ga0495650_0000847_31894_32916 307
304 3300047320 Ga0495672_0003803 Ga0495672_0003803_6614_7633 307
305 3300053087 Ga0500643_000224 Ga0500643_000224_25841_26860 307
306 3300053104 Ga0500556_0000608 Ga0500556_0000608_877_1881 307
307 3300053117 Ga0500593_001439 Ga0500593_001439_3707_4711 307
308 3300053133 Ga0500655_002445 Ga0500655_002445_672_1676 307
309 3300053136 Ga0500559_0002027 Ga0500559_0002027_9161_10165 307
310 3300005327 Ga0070658_10000283 Ga0070658_1000028319 308
311 3300005337 Ga0070682_100111772 Ga0070682_1001117721 308
312 3300005366 Ga0070659_100051233 Ga0070659_1000512332 308
313 3300005539 Ga0068853_100323530 Ga0068853_1003235301 308
314 3300013104 Ga0157370_10026950 Ga0157370_100269502 308
315 3300025909 Ga0207705_10000001 Ga0207705_10000001454 308
316 3300026041 Ga0207639_10259184 Ga0207639_102591842 308
317 3300046457 Ga0495590_0000119 Ga0495590_0000119_29925_30941 308
318 3300046660 Ga0495625_0120705 Ga0495625_0120705_148_1164 308
319 3300048904 Ga0496101_0310651 Ga0496101_0310651_74_1084 308
320 3300048905 Ga0496102_0314186 Ga0496102_0314186_347_1357 308
321 3300048920 Ga0496117_0000187 Ga0496117_0000187_47577_48614 308
322 3300048926 Ga0496123_0014936 Ga0496123_0014936_1520_2557 308
323 3300048927 Ga0496124_0057504 Ga0496124_0057504_849_1859 308
324 3300049571 Ga0501034_0010368 Ga0501034_0010368_134_1123 308
325 3300049574 Ga0501038_0027374 Ga0501038_0027374_2691_3686 308
326 3300049579 Ga0501043_0002820 Ga0501043_0002820_2547_3536 308
327 3300049581 Ga0501047_0003343 Ga0501047_0003343_4104_5093 308
328 3300049586 Ga0501070_0000654 Ga0501070_0000654_3023_4012 308
329 3300049589 Ga0501073_0008840 Ga0501073_0008840_4619_5608 308
330 3300049742 Ga0501080_0000189 Ga0501080_0000189_25743_26732 308
331 3300053104 Ga0500556_0000100 Ga0500556_0000100_22840_23838 308
332 3300053139 Ga0500568_0000100 Ga0500568_0000100_54873_55871 308
333 3300053139 Ga0500568_0018143 Ga0500568_0018143_309_1325 308
334 3300054114 Ga0501084_0013043 Ga0501084_0013043_3244_4233 308
335 3300059510 Ga0587090_007087 Ga0587090_007087_171_1166 308
336 3300002067 JGI24735J21928_10000648 JGI24735J21928_100006489 309
337 3300003578 Ga0006562J51391_1008124 Ga0006562J51391_10081244 309
338 3300003578 Ga0006562J51391_1008125 Ga0006562J51391_100812522 309
339 3300003762 Ga0055542_1007225 Ga0055542_10072251 309
340 3300005288 Ga0065714_10110058 Ga0065714_101100581 309
341 3300013105 Ga0157369_10004620 Ga0157369_100046204 309
342 3300013306 Ga0163162_10182330 Ga0163162_101823302 309
343 3300025254 Ga0209148_1003104 Ga0209148_10031042 309
344 3300031731 Ga0307405_10437608 Ga0307405_104376081 309
345 3300031852 Ga0307410_10096735 Ga0307410_100967351 309
346 3300031903 Ga0307407_10008930 Ga0307407_100089303 309
347 3300031911 Ga0307412_10014928 Ga0307412_100149282 309
348 3300031995 Ga0307409_100221257 Ga0307409_1002212571 309
349 3300032002 Ga0307416_100055172 Ga0307416_1000551721 309
350 3300037312 Ga0395899_0105350 Ga0395899_0105350_974_1963 309
351 3300037466 Ga0395898_0044522 Ga0395898_0044522_14_1003 309
352 3300037466 Ga0395898_0048110 Ga0395898_0048110_161_1150 309
353 3300038443 Ga0395901_0331061 Ga0395901_0331061_289_1278 309
354 3300046694 Ga0495649_0094328 Ga0495649_0094328_498_1550 309
355 3300047472 Ga0495686_0159372 Ga0495686_0159372_279_1301 309
356 3300048908 Ga0496105_0013576 Ga0496105_0013576_5095_6117 309
357 3300048915 Ga0496112_0016783 Ga0496112_0016783_5716_6705 309
358 3300048917 Ga0496114_0034861 Ga0496114_0034861_857_1879 309
359 3300048920 Ga0496117_0012357 Ga0496117_0012357_1158_2174 309
360 3300048920 Ga0496117_0116475 Ga0496117_0116475_14_1030 309
361 3300049569 Ga0501032_0004442 Ga0501032_0004442_5274_6263 309
362 3300049571 Ga0501034_0001978 Ga0501034_0001978_7734_8726 309
363 3300049571 Ga0501034_0011006 Ga0501034_0011006_8147_9136 309
364 3300049571 Ga0501034_0035949 Ga0501034_0035949_790_1815 309
365 3300049571 Ga0501034_0066323 Ga0501034_0066323_942_1934 309
366 3300049573 Ga0501037_0142221 Ga0501037_0142221_644_1633 309
367 3300049573 Ga0501037_0184407 Ga0501037_0184407_96_1088 309
368 3300049579 Ga0501043_0162139 Ga0501043_0162139_678_1706 309
369 3300049586 Ga0501070_0011793 Ga0501070_0011793_1649_2674 309
370 3300049587 Ga0501071_0000023 Ga0501071_0000023_42063_43088 309
371 3300049588 Ga0501072_0217599 Ga0501072_0217599_314_1303 309
372 3300049589 Ga0501073_0081729 Ga0501073_0081729_946_1935 309
373 3300053136 Ga0500559_0001102 Ga0500559_0001102_131_1156 309
374 3300053136 Ga0500559_0001612 Ga0500559_0001612_9047_10081 309
375 3300053136 Ga0500559_0009199 Ga0500559_0009199_131_1156 309
376 3300053140 Ga0500573_0000014 Ga0500573_0000014_154368_155393 309
377 3300053140 Ga0500573_0000757 Ga0500573_0000757_10548_11576 309
378 3300053153 Ga0500616_0000027 Ga0500616_0000027_71561_72598 309
379 iso_pu_bacteria 2893684298 2893686222 309
380 3300013105 Ga0157369_10071925 Ga0157369_100719254 310
381 3300031548 Ga0307408_100049705 Ga0307408_1000497052 310
382 3300031731 Ga0307405_10003873 Ga0307405_100038733 310
383 3300031824 Ga0307413_10146734 Ga0307413_101467342 310
384 3300031911 Ga0307412_10001075 Ga0307412_100010752 310
385 3300032002 Ga0307416_100268768 Ga0307416_1002687681 310
386 3300042007 Ga0439449_0007826 Ga0439449_0007826_1888_2880 310
387 3300046475 Ga0495639_0038773 Ga0495639_0038773_492_1493 310
388 3300046809 Ga0495600_0081196 Ga0495600_0081196_170_1171 310
389 3300047315 Ga0495581_0032451 Ga0495581_0032451_1374_2375 310
390 3300047673 Ga0495593_0032340 Ga0495593_0032340_249_1250 310
391 3300049579 Ga0501043_0217242 Ga0501043_0217242_311_1306 310
392 3300027907 Ga0207428_10004666 Ga0207428_100046661 311
393 3300031824 Ga0307413_10036821 Ga0307413_100368212 311
394 3300032002 Ga0307416_100055465 Ga0307416_1000554652 311
395 3300032004 Ga0307414_10026209 Ga0307414_100262092 311
396 3300042002 Ga0439442_000041 Ga0439442_000041_12556_13545 311
397 3300031824 Ga0307413_10154114 Ga0307413_101541141 312
398 3300031852 Ga0307410_10004164 Ga0307410_100041644 312
399 3300031903 Ga0307407_10034683 Ga0307407_100346832 312
400 3300031911 Ga0307412_10018573 Ga0307412_100185734 312
401 3300031911 Ga0307412_10165243 Ga0307412_101652432 312
402 3300041997 Ga0439431_0033614 Ga0439431_0033614_105_1094 312
403 3300041999 Ga0439433_0002503 Ga0439433_0002503_26_1015 312
404 3300041999 Ga0439433_0017148 Ga0439433_0017148_326_1315 312
405 3300042002 Ga0439442_000092 Ga0439442_000092_13366_14355 312
406 3300042014 Ga0439457_015347 Ga0439457_015347_574_1563 312
407 3300042122 Ga0450920_000186 Ga0450920_000186_1440_2429 312
408 3300042146 Ga0450907_001589 Ga0450907_001589_3534_4523 312
409 3300042435 Ga0439434_0000105 Ga0439434_0000105_7304_8293 312
410 3300042531 Ga0450918_001880 Ga0450918_001880_669_1658 312
411 3300049531 Ga0501315_002313 Ga0501315_002313_23_1012 312
412 3300032002 Ga0307416_100181051 Ga0307416_1001810512 313
413 iso_pu_bacteria 2808606700 2810365843 313
414 iso_pu_bacteria 2857740372 2857741620 313
415 iso_pu_bacteria 2905926851 2905930829 313
416 iso_pu_bacteria 2919059106 2919063151 313
417 iso_pu_bacteria 2933418574 2933420095 313
418 iso_pu_bacteria 2939647034 2939647041 313
419 iso_pu_bacteria 2946003308 2946006970 313
420 3300020081 Ga0206354_11615369 Ga0206354_116153691 314
421 3300031548 Ga0307408_100015414 Ga0307408_1000154142 314
422 3300031548 Ga0307408_100021433 Ga0307408_1000214333 314
423 3300031731 Ga0307405_10038492 Ga0307405_100384922 314
424 3300031731 Ga0307405_10110347 Ga0307405_101103472 314
425 3300031824 Ga0307413_10005820 Ga0307413_100058206 314
426 3300031824 Ga0307413_10073679 Ga0307413_100736792 314
427 3300031852 Ga0307410_10002324 Ga0307410_100023247 314
428 3300031852 Ga0307410_10008661 Ga0307410_100086615 314
429 3300031901 Ga0307406_10025003 Ga0307406_100250032 314
430 3300031901 Ga0307406_10036213 Ga0307406_100362132 314
431 3300031901 Ga0307406_10037301 Ga0307406_100373011 314
432 3300031901 Ga0307406_10171096 Ga0307406_101710962 314
433 3300031903 Ga0307407_10017239 Ga0307407_100172391 314
434 3300031903 Ga0307407_10032382 Ga0307407_100323821 314
435 3300031903 Ga0307407_10107121 Ga0307407_101071212 314
436 3300031995 Ga0307409_100037668 Ga0307409_1000376681 314
437 3300031995 Ga0307409_100139782 Ga0307409_1001397822 314
438 3300032002 Ga0307416_100216480 Ga0307416_1002164802 314
439 3300032005 Ga0307411_10040361 Ga0307411_100403611 314
440 3300042002 Ga0439442_000188 Ga0439442_000188_1173_2162 314
441 3300049533 Ga0501317_005051 Ga0501317_005051_141_1130 314
442 3300049533 Ga0501317_010282 Ga0501317_010282_117_1106 314
443 3300049534 Ga0501318_005181 Ga0501318_005181_114_1103 314
444 3300049535 Ga0501319_003672 Ga0501319_003672_37_1026 314
445 3300049536 Ga0501320_001605 Ga0501320_001605_95_1084 314
446 3300049540 Ga0501324_005116 Ga0501324_005116_23_1012 314
447 iso_pu_bacteria 2690315906 2691512714 314
448 iso_pu_bacteria 2775506735 2775658636 314
449 iso_pu_bacteria 2808606357 2808829985 314
450 iso_pu_bacteria 2808606360 2808851160 314
451 iso_pu_bacteria 2808606366 2808876313 314
452 iso_pu_bacteria 2808606370 2808894247 314
453 iso_pu_bacteria 2808606371 2808897851 314
454 iso_pu_bacteria 2811994871 2812318240 314
455 iso_pu_bacteria 2844849076 2844851643 314
456 iso_pu_bacteria 2904497146 2904497918 314
457 iso_pu_bacteria 2904776348 2904778938 314
458 iso_pu_bacteria 2910809715 2910813007 314
459 iso_pu_bacteria 2919034639 2919037963 314
460 iso_pu_bacteria 2919051321 2919054744 314
461 iso_pu_bacteria 2919391150 2919391635 314
462 iso_pu_bacteria 2919538618 2919539387 314
463 iso_pu_bacteria 2920879853 2920883037 314
464 iso_pu_bacteria 2932426870 2932430384 314
465 iso_pu_bacteria 2939598168 2939600618 314
466 iso_pu_bacteria 2939674588 2939678720 314
467 iso_pu_bacteria 2945916053 2945916063 314
468 iso_pu_bacteria 2945920336 2945923806 314
469 iso_pu_bacteria 2945941187 2945944544 314
470 iso_pu_bacteria 2945956166 2945957266 314
471 iso_pu_bacteria 2946024296 2946024705 314
472 iso_pu_bacteria 2946037020 2946040453 314
473 iso_pu_bacteria 2946059875 2946059884 314
474 iso_pu_bacteria 2953998280 2954001715 314
475 iso_pu_bacteria 2974302888 2974303891 314
476 iso_pu_bacteria 8054107350 8054110145 314
477 3300031903 Ga0307407_10237400 Ga0307407_102374001 315
478 3300049573 Ga0501037_0098723 Ga0501037_0098723_574_1563 315
479 3300005364 Ga0070673_100015553 Ga0070673_1000155531 316
480 3300009036 Ga0105244_10106465 Ga0105244_101064651 317
481 3300025901 Ga0207688_10090412 Ga0207688_100904121 317
482 3300031548 Ga0307408_100005164 Ga0307408_10000516410 317
483 3300031903 Ga0307407_10078973 Ga0307407_100789731 317
484 3300031911 Ga0307412_10036714 Ga0307412_100367141 317
485 3300031911 Ga0307412_10152193 Ga0307412_101521932 317
486 3300032002 Ga0307416_100032831 Ga0307416_1000328311 317
487 3300044683 Ga0466965_0116433 Ga0466965_0116433_157_1137 317
488 3300053083 Ga0495655_0002907 Ga0495655_0002907_1239_2219 317
489 3300000549 LJQas_1000796 LJQas_10007962 318
490 3300002773 JGI25152J39213_1000335 JGI25152J39213_100033516 318
491 3300003322 rootL2_10051125 rootL2_100511252 318
492 3300005328 Ga0070676_10022103 Ga0070676_100221032 318
493 3300005335 Ga0070666_10049641 Ga0070666_100496412 318
494 3300005347 Ga0070668_100130262 Ga0070668_1001302622 318
495 3300005354 Ga0070675_100012252 Ga0070675_1000122522 318
496 3300005355 Ga0070671_100055550 Ga0070671_1000555503 318
497 3300005356 Ga0070674_100125182 Ga0070674_1001251822 318
498 3300005456 Ga0070678_100004891 Ga0070678_1000048912 318
499 3300006058 Ga0075432_10008426 Ga0075432_100084262 318
500 3300009011 Ga0105251_10027771 Ga0105251_100277712 318
501 3300009036 Ga0105244_10005040 Ga0105244_100050406 318
502 3300009101 Ga0105247_10132403 Ga0105247_101324032 318
503 3300009148 Ga0105243_10004454 Ga0105243_100044542 318
504 3300011119 Ga0105246_10001732 Ga0105246_100017322 318
505 3300011119 Ga0105246_10068200 Ga0105246_100682002 318
506 3300013102 Ga0157371_10071438 Ga0157371_100714382 318
507 3300013306 Ga0163162_10118225 Ga0163162_101182252 318
508 3300025245 Ga0207425_1002975 Ga0207425_10029752 318
509 3300025258 Ga0209129_1000112 Ga0209129_10001129 318
510 3300025294 Ga0209025_1000250 Ga0209025_1000250105 318
511 3300025303 Ga0209051_1002132 Ga0209051_10021323 318
512 3300025315 Ga0207697_10005852 Ga0207697_100058522 318
513 3300025728 Ga0207655_1019811 Ga0207655_10198111 318
514 3300025728 Ga0207655_1024777 Ga0207655_10247771 318
515 3300025735 Ga0207713_1013121 Ga0207713_10131215 318
516 3300025893 Ga0207682_10037854 Ga0207682_100378542 318
517 3300025907 Ga0207645_10011658 Ga0207645_100116582 318
518 3300025908 Ga0207643_10171373 Ga0207643_101713731 318
519 3300025923 Ga0207681_10022932 Ga0207681_100229324 318
520 3300025926 Ga0207659_10026524 Ga0207659_100265244 318
521 3300025931 Ga0207644_10030560 Ga0207644_100305602 318
522 3300025934 Ga0207686_10277309 Ga0207686_102773091 318
523 3300025935 Ga0207709_10005069 Ga0207709_100050694 318
524 3300025935 Ga0207709_10026373 Ga0207709_100263732 318
525 3300025937 Ga0207669_10029807 Ga0207669_100298072 318
526 3300025940 Ga0207691_10005671 Ga0207691_100056711 318
527 3300025972 Ga0207668_10145451 Ga0207668_101454511 318
528 3300025986 Ga0207658_10043056 Ga0207658_100430562 318
529 3300026121 Ga0207683_10002078 Ga0207683_100020783 318
530 3300031548 Ga0307408_100006339 Ga0307408_1000063396 318
531 3300031548 Ga0307408_100013010 Ga0307408_1000130106 318
532 3300031548 Ga0307408_100191377 Ga0307408_1001913771 318
533 3300031731 Ga0307405_10008520 Ga0307405_100085206 318
534 3300031731 Ga0307405_10025568 Ga0307405_100255684 318
535 3300031824 Ga0307413_10062375 Ga0307413_100623752 318
536 3300031824 Ga0307413_10094300 Ga0307413_100943002 318
537 3300031852 Ga0307410_10005494 Ga0307410_100054942 318
538 3300031852 Ga0307410_10335522 Ga0307410_103355221 318
539 3300031901 Ga0307406_10011980 Ga0307406_100119802 318
540 3300031901 Ga0307406_10149228 Ga0307406_101492282 318
541 3300031903 Ga0307407_10213114 Ga0307407_102131141 318
542 3300031911 Ga0307412_10039308 Ga0307412_100393081 318
543 3300031911 Ga0307412_10080797 Ga0307412_100807971 318
544 3300031995 Ga0307409_100075255 Ga0307409_1000752552 318
545 3300032002 Ga0307416_100005303 Ga0307416_1000053032 318
546 3300032002 Ga0307416_100035860 Ga0307416_1000358603 318
547 3300032004 Ga0307414_10382894 Ga0307414_103828941 318
548 3300037418 Ga0395900_0267174 Ga0395900_0267174_416_1420 318
549 3300038443 Ga0395901_0088798 Ga0395901_0088798_188_1192 318
550 3300038443 Ga0395901_0118107 Ga0395901_0118107_223_1215 318
551 3300038443 Ga0395901_0138915 Ga0395901_0138915_475_1461 318
552 3300041405 Ga0439438_010891 Ga0439438_010891_292_1278 318
553 3300041411 Ga0439466_0004168 Ga0439466_0004168_885_1871 318
554 3300041453 Ga0451797_0041912 Ga0451797_0041912_516_1499 318
555 3300041999 Ga0439433_0023429 Ga0439433_0023429_351_1343 318
556 3300042007 Ga0439449_0017884 Ga0439449_0017884_382_1374 318
557 3300046463 Ga0495653_0006896 Ga0495653_0006896_321_1322 318
558 3300046472 Ga0495580_0044984 Ga0495580_0044984_2055_3050 318
559 3300046473 Ga0495582_0105160 Ga0495582_0105160_450_1451 318
560 3300046476 Ga0495662_0036627 Ga0495662_0036627_47_1048 318
561 3300046477 Ga0495664_0007474 Ga0495664_0007474_2709_3710 318
562 3300046499 Ga0495594_0122965 Ga0495594_0122965_453_1454 318
563 3300046517 Ga0495630_0037067 Ga0495630_0037067_487_1488 318
564 3300046531 Ga0495665_0012197 Ga0495665_0012197_3621_4622 318
565 3300046543 Ga0495645_0093580 Ga0495645_0093580_607_1608 318
566 3300046559 Ga0495667_0000893 Ga0495667_0000893_7983_8984 318
567 3300046679 Ga0495623_0163666 Ga0495623_0163666_210_1211 318
568 3300046689 Ga0495613_0257056 Ga0495613_0257056_48_1049 318
569 3300046691 Ga0495670_0004877 Ga0495670_0004877_195_1196 318
570 3300046809 Ga0495600_0073585 Ga0495600_0073585_665_1666 318
571 3300047317 Ga0495604_0167584 Ga0495604_0167584_447_1448 318
572 3300047322 Ga0495680_0011873 Ga0495680_0011873_2077_3078 318
573 3300047444 Ga0495675_0054725 Ga0495675_0054725_322_1323 318
574 3300048903 Ga0496100_0168889 Ga0496100_0168889_524_1525 318
575 3300048904 Ga0496101_0015223 Ga0496101_0015223_4004_5005 318
576 3300048904 Ga0496101_0104779 Ga0496101_0104779_475_1476 318
577 3300048905 Ga0496102_0166420 Ga0496102_0166420_891_1892 318
578 3300048906 Ga0496103_0059846 Ga0496103_0059846_413_1414 318
579 3300048907 Ga0496104_0059857 Ga0496104_0059857_416_1417 318
580 3300048908 Ga0496105_0042984 Ga0496105_0042984_13_1014 318
581 3300048910 Ga0496107_0068842 Ga0496107_0068842_710_1711 318
582 3300048910 Ga0496107_0089205 Ga0496107_0089205_173_1174 318
583 3300048911 Ga0496108_0015841 Ga0496108_0015841_4078_5079 318
584 3300048912 Ga0496109_0116877 Ga0496109_0116877_1442_2443 318
585 3300048913 Ga0496110_0290322 Ga0496110_0290322_43_1044 318
586 3300048914 Ga0496111_0026515 Ga0496111_0026515_380_1381 318
587 3300048915 Ga0496112_0017680 Ga0496112_0017680_571_1572 318
588 3300048916 Ga0496113_0069192 Ga0496113_0069192_825_1826 318
589 3300048917 Ga0496114_0058892 Ga0496114_0058892_419_1420 318
590 3300048922 Ga0496119_0073465 Ga0496119_0073465_858_1859 318
591 3300048927 Ga0496124_0091662 Ga0496124_0091662_835_1836 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

104

181

0.98

PF00588

SpoU_methylase

SpoU rRNA Methylase family

197

339

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9002 142 315
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8903 142 315
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.8818 168 317
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8578 166 318
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.8547 168 317
ID Description Score Start End Superfamily
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9814 149 315 3.40.1280.10
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9442 139 315 3.40.1280.10
af_D3ZK81_42_122_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9381 67 138 3.30.1330.30
af_Q2G2M3_1_72_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9355 69 137 3.30.1330.30
1gz0F02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9345 142 315 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A1F9D5I0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9836 169 317 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A0B0HM12-F1-model_v4 deleted 0.9781 186 315
AF-A0A2E2V2K6-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9766 163 317 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A350US94-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9745 175 317 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7J4P228-F1-model_v4 RNA methyltransferase 0.9717 169 318 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Feature Viewer

pLDDT pTM Quality
84.68 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map