F467044
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 591 | 302 | 591 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300006946|Ga0079104_1054502|Ga0079104_10545022 |
| Length | 79 |
| Sequence | MLSERSCRSQAKRDKRMRLIIALLLPWLTFFTIGRPMAGIICLILQVTVIGWLPAAIWAVYALSQYKTDQKIRNAMGGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 172 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 173 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 179 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 180 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 181 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 182 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 183 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 184 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 185 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 186 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 289 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 290 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 291 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 293 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 294 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 295 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 296 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 298 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 301 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 302 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 1.02 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.66 |
| Nodule | 0.51 |
| Rhizoplane | 4.91 |
| Rhizosphere | 76.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1034195 | 3300001904 | Bacteria | 785 |
| 2 | JGI24741J21665_1012780 | 3300001915 | Bacteria | 1435 |
| 3 | JGI24740J21852_10000687 | 3300001979 | Bacteria | 14679 |
| 4 | JGI24740J21852_10058749 | 3300001979 | Bacteria | 1068 |
| 5 | JGI24739J22299_10001673 | 3300001989 | Bacteria | 8429 |
| 6 | JGI24737J22298_10001659 | 3300001990 | Bacteria | 7940 |
| 7 | JGI24737J22298_10154741 | 3300001990 | Bacteria | 677 |
| 8 | JGI24735J21928_10001615 | 3300002067 | Bacteria | 7973 |
| 9 | JGI24735J21928_10006876 | 3300002067 | Bacteria | 3723 |
| 10 | JGI24738J21930_10001024 | 3300002075 | Bacteria | 7975 |
| 11 | JGI24738J21930_10004804 | 3300002075 | Bacteria | 3286 |
| 12 | JGI24744J21845_10001801 | 3300002077 | Bacteria | 4297 |
| 13 | JGI24744J21845_10030038 | 3300002077 | Bacteria | 1042 |
| 14 | JGI24742J22300_10010840 | 3300002244 | Bacteria | 1510 |
| 15 | JGI25154J39366_1001108 | 3300002738 | Bacteria | 10507 |
| 16 | JGI25151J46595_10005111 | 3300003187 | Bacteria | 6815 |
| 17 | JGI25153J46596_10000034 | 3300003215 | Bacteria | 192215 |
| 18 | rootL2_10000610 | 3300003322 | Bacteria | 20668 |
| 19 | rootL2_10110713 | 3300003322 | Bacteria | 4502 |
| 20 | rootH1_10015466 | 3300003323 | Bacteria | 4282 |
| 21 | Ga0006554J51385_1047400 | 3300003567 | Bacteria | 604 |
| 22 | Ga0055532_1000400 | 3300003758 | Bacteria | 21575 |
| 23 | Ga0055525_1000654 | 3300003759 | Bacteria | 13460 |
| 24 | Ga0055527_1000274 | 3300003760 | Bacteria | 30896 |
| 25 | Ga0055535_1000569 | 3300003761 | Bacteria | 31098 |
| 26 | Ga0055542_1000041 | 3300003762 | Bacteria | 208892 |
| 27 | Ga0055542_1009120 | 3300003762 | Bacteria | 1891 |
| 28 | Ga0055542_1012678 | 3300003762 | Bacteria | 1448 |
| 29 | Ga0055542_1022193 | 3300003762 | Bacteria | 906 |
| 30 | Ga0055529_1000040 | 3300003763 | Bacteria | 230562 |
| 31 | Ga0055529_1000970 | 3300003763 | Bacteria | 14586 |
| 32 | Ga0055529_1005735 | 3300003763 | Bacteria | 1772 |
| 33 | Ga0070658_10000136 | 3300005327 | Bacteria | 64472 |
| 34 | Ga0070658_10264846 | 3300005327 | Bacteria | 1460 |
| 35 | Ga0070658_10274731 | 3300005327 | Bacteria | 1434 |
| 36 | Ga0070676_10002760 | 3300005328 | Bacteria | 9070 |
| 37 | Ga0070676_10011676 | 3300005328 | Bacteria | 4780 |
| 38 | Ga0070677_10324233 | 3300005333 | Bacteria | 790 |
| 39 | Ga0068869_100000200 | 3300005334 | Bacteria | 31213 |
| 40 | Ga0068868_100000049 | 3300005338 | Bacteria | 67274 |
| 41 | Ga0068868_100294044 | 3300005338 | Bacteria | 1378 |
| 42 | Ga0070660_100000011 | 3300005339 | Bacteria | 133167 |
| 43 | Ga0070660_101073323 | 3300005339 | Bacteria | 681 |
| 44 | Ga0070661_100004782 | 3300005344 | Bacteria | 9323 |
| 45 | Ga0070661_100268469 | 3300005344 | Bacteria | 1321 |
| 46 | Ga0070661_101021381 | 3300005344 | Bacteria | 686 |
| 47 | Ga0070661_101179706 | 3300005344 | Bacteria | 640 |
| 48 | Ga0070675_100015819 | 3300005354 | Bacteria | 5973 |
| 49 | Ga0070675_100404195 | 3300005354 | Bacteria | 1219 |
| 50 | Ga0070675_100428834 | 3300005354 | Bacteria | 1183 |
| 51 | Ga0070671_101524155 | 3300005355 | Bacteria | 592 |
| 52 | Ga0070674_100002936 | 3300005356 | Bacteria | 9449 |
| 53 | Ga0070674_100121034 | 3300005356 | Bacteria | 1938 |
| 54 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 55 | Ga0070673_100352037 | 3300005364 | Unclassified | 1307 |
| 56 | Ga0070659_100000239 | 3300005366 | Bacteria | 42871 |
| 57 | Ga0070659_100083808 | 3300005366 | Bacteria | 2549 |
| 58 | Ga0070659_100496015 | 3300005366 | Bacteria | 1040 |
| 59 | Ga0070713_101290888 | 3300005436 | Bacteria | 707 |
| 60 | Ga0070663_100000291 | 3300005455 | Bacteria | 25597 |
| 61 | Ga0070663_100036404 | 3300005455 | Bacteria | 3420 |
| 62 | Ga0070663_100226817 | 3300005455 | Bacteria | 1469 |
| 63 | Ga0070678_100241504 | 3300005456 | Bacteria | 1510 |
| 64 | Ga0070662_100000574 | 3300005457 | Bacteria | 22427 |
| 65 | Ga0070662_101539744 | 3300005457 | Bacteria | 574 |
| 66 | Ga0070662_101879111 | 3300005457 | Bacteria | 517 |
| 67 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 68 | Ga0068867_100601287 | 3300005459 | Bacteria | 959 |
| 69 | Ga0070679_101051982 | 3300005530 | Bacteria | 758 |
| 70 | Ga0070684_102301579 | 3300005535 | Bacteria | 508 |
| 71 | Ga0068853_100000475 | 3300005539 | Bacteria | 27392 |
| 72 | Ga0068853_100006265 | 3300005539 | Bacteria | 9430 |
| 73 | Ga0068853_100249883 | 3300005539 | Bacteria | 1627 |
| 74 | Ga0068853_100911220 | 3300005539 | Bacteria | 845 |
| 75 | Ga0070672_100324522 | 3300005543 | Bacteria | 1309 |
| 76 | Ga0070672_100846330 | 3300005543 | Bacteria | 806 |
| 77 | Ga0070665_100369185 | 3300005548 | Bacteria | 1442 |
| 78 | Ga0070665_100424242 | 3300005548 | Bacteria | 1339 |
| 79 | Ga0070665_102213378 | 3300005548 | Unclassified | 553 |
| 80 | Ga0068855_100001542 | 3300005563 | Bacteria | 28971 |
| 81 | Ga0068855_100002263 | 3300005563 | Bacteria | 23756 |
| 82 | Ga0068855_100045914 | 3300005563 | Bacteria | 5164 |
| 83 | Ga0068855_100711736 | 3300005563 | Bacteria | 1074 |
| 84 | Ga0068855_101188741 | 3300005563 | Bacteria | 793 |
| 85 | Ga0068855_101848150 | 3300005563 | Bacteria | 613 |
| 86 | Ga0068855_102330115 | 3300005563 | Bacteria | 535 |
| 87 | Ga0070664_100008244 | 3300005564 | Bacteria | 8425 |
| 88 | Ga0070664_100121199 | 3300005564 | Bacteria | 2290 |
| 89 | Ga0070664_101487728 | 3300005564 | Bacteria | 641 |
| 90 | Ga0068857_100000670 | 3300005577 | Bacteria | 25389 |
| 91 | Ga0068857_100510743 | 3300005577 | Bacteria | 1129 |
| 92 | Ga0068857_101261950 | 3300005577 | Bacteria | 716 |
| 93 | Ga0068854_100000036 | 3300005578 | Bacteria | 102170 |
| 94 | Ga0068854_100002610 | 3300005578 | Bacteria | 11173 |
| 95 | Ga0068854_100003389 | 3300005578 | Bacteria | 9929 |
| 96 | Ga0068856_100083806 | 3300005614 | Bacteria | 3167 |
| 97 | Ga0068856_100490594 | 3300005614 | Bacteria | 1249 |
| 98 | Ga0068856_100979879 | 3300005614 | Bacteria | 864 |
| 99 | Ga0068852_100000450 | 3300005616 | Bacteria | 27149 |
| 100 | Ga0068852_100076454 | 3300005616 | Bacteria | 2956 |
| 101 | Ga0068852_100124182 | 3300005616 | Bacteria | 2368 |
| 102 | Ga0068852_101282124 | 3300005616 | Bacteria | 754 |
| 103 | Ga0068852_102267076 | 3300005616 | Bacteria | 564 |
| 104 | Ga0068859_101950709 | 3300005617 | Bacteria | 648 |
| 105 | Ga0068861_101006640 | 3300005719 | Bacteria | 796 |
| 106 | Ga0068851_10001264 | 3300005834 | Bacteria | 11009 |
| 107 | Ga0068851_10024314 | 3300005834 | Bacteria | 2966 |
| 108 | Ga0068858_100080012 | 3300005842 | Bacteria | 3036 |
| 109 | Ga0075364_10010430 | 3300006051 | Bacteria | 5611 |
| 110 | Ga0075362_10081612 | 3300006177 | Bacteria | 1491 |
| 111 | Ga0075369_10558191 | 3300006186 | Bacteria | 547 |
| 112 | Ga0075366_10146656 | 3300006195 | Bacteria | 1428 |
| 113 | Ga0075366_10944336 | 3300006195 | Bacteria | 538 |
| 114 | Ga0097621_100001076 | 3300006237 | Bacteria | 19102 |
| 115 | Ga0097621_100017596 | 3300006237 | Bacteria | 5432 |
| 116 | Ga0075370_10232116 | 3300006353 | Bacteria | 1092 |
| 117 | Ga0068871_100004490 | 3300006358 | Bacteria | 9718 |
| 118 | Ga0068871_100133788 | 3300006358 | Bacteria | 2104 |
| 119 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 120 | Ga0097620_101950618 | 3300006931 | Bacteria | 648 |
| 121 | Ga0079104_1054502 | 3300006946 | Bacteria | 879 |
| 122 | Ga0105244_10000513 | 3300009036 | Bacteria | 34566 |
| 123 | Ga0105244_10004237 | 3300009036 | Bacteria | 9954 |
| 124 | Ga0105250_10008145 | 3300009092 | Bacteria | 4463 |
| 125 | Ga0105240_10036197 | 3300009093 | Bacteria | 6351 |
| 126 | Ga0105240_10091518 | 3300009093 | Bacteria | 3715 |
| 127 | Ga0105240_10619704 | 3300009093 | Bacteria | 1189 |
| 128 | Ga0105240_10910164 | 3300009093 | Bacteria | 946 |
| 129 | Ga0105240_10918266 | 3300009093 | Bacteria | 941 |
| 130 | Ga0105240_11232756 | 3300009093 | Bacteria | 791 |
| 131 | Ga0105240_11401393 | 3300009093 | Bacteria | 735 |
| 132 | Ga0105240_12415232 | 3300009093 | Bacteria | 544 |
| 133 | Ga0105240_12687615 | 3300009093 | Bacteria | 514 |
| 134 | Ga0105245_10000113 | 3300009098 | Bacteria | 78545 |
| 135 | Ga0105243_10000373 | 3300009148 | Bacteria | 48115 |
| 136 | Ga0105243_10002803 | 3300009148 | Bacteria | 14476 |
| 137 | Ga0105241_10113361 | 3300009174 | Bacteria | 2173 |
| 138 | Ga0105242_10000165 | 3300009176 | Bacteria | 49974 |
| 139 | Ga0105248_10011752 | 3300009177 | Bacteria | 9657 |
| 140 | Ga0105248_10616256 | 3300009177 | Bacteria | 1224 |
| 141 | Ga0105248_10731518 | 3300009177 | Bacteria | 1116 |
| 142 | Ga0105237_10132938 | 3300009545 | Bacteria | 2483 |
| 143 | Ga0105237_10142332 | 3300009545 | Bacteria | 2393 |
| 144 | Ga0105237_10296548 | 3300009545 | Bacteria | 1620 |
| 145 | Ga0105237_10311286 | 3300009545 | Bacteria | 1578 |
| 146 | Ga0105237_10994367 | 3300009545 | Bacteria | 846 |
| 147 | Ga0105238_10001089 | 3300009551 | Bacteria | 27423 |
| 148 | Ga0105238_10058421 | 3300009551 | Bacteria | 3866 |
| 149 | Ga0105238_10388094 | 3300009551 | Bacteria | 1388 |
| 150 | Ga0105249_10014083 | 3300009553 | Bacteria | 7069 |
| 151 | Ga0105249_10023929 | 3300009553 | Bacteria | 5487 |
| 152 | Ga0105239_10175331 | 3300010375 | Bacteria | 2398 |
| 153 | Ga0105239_10311482 | 3300010375 | Bacteria | 1774 |
| 154 | Ga0105239_11402277 | 3300010375 | Bacteria | 807 |
| 155 | Ga0105239_13047297 | 3300010375 | Bacteria | 546 |
| 156 | Ga0105246_10044455 | 3300011119 | Bacteria | 3019 |
| 157 | Ga0105246_10191210 | 3300011119 | Bacteria | 1584 |
| 158 | Ga0157373_10000025 | 3300013100 | Bacteria | 146728 |
| 159 | Ga0157373_10005064 | 3300013100 | Bacteria | 9903 |
| 160 | Ga0157373_10024803 | 3300013100 | Bacteria | 4341 |
| 161 | Ga0157373_10849107 | 3300013100 | Bacteria | 675 |
| 162 | Ga0157373_11143501 | 3300013100 | Bacteria | 585 |
| 163 | Ga0157371_10001141 | 3300013102 | Bacteria | 28613 |
| 164 | Ga0157371_10160624 | 3300013102 | Bacteria | 1605 |
| 165 | Ga0157371_11437065 | 3300013102 | Bacteria | 536 |
| 166 | Ga0157370_10000017 | 3300013104 | Bacteria | 169971 |
| 167 | Ga0157370_10000027 | 3300013104 | Bacteria | 146729 |
| 168 | Ga0157370_10003021 | 3300013104 | Bacteria | 19971 |
| 169 | Ga0157370_10005061 | 3300013104 | Bacteria | 14880 |
| 170 | Ga0157370_10062642 | 3300013104 | Bacteria | 3526 |
| 171 | Ga0157370_10239905 | 3300013104 | Bacteria | 1677 |
| 172 | Ga0157370_10268427 | 3300013104 | Bacteria | 1577 |
| 173 | Ga0157370_11607996 | 3300013104 | Bacteria | 584 |
| 174 | Ga0157369_10001890 | 3300013105 | Bacteria | 25252 |
| 175 | Ga0157369_10091327 | 3300013105 | Bacteria | 3251 |
| 176 | Ga0157369_10178619 | 3300013105 | Bacteria | 2234 |
| 177 | Ga0157369_10188586 | 3300013105 | Bacteria | 2167 |
| 178 | Ga0157369_10546708 | 3300013105 | Bacteria | 1197 |
| 179 | Ga0157369_11129362 | 3300013105 | Bacteria | 801 |
| 180 | Ga0157374_10002557 | 3300013296 | Bacteria | 15350 |
| 181 | Ga0157374_10437431 | 3300013296 | Bacteria | 1308 |
| 182 | Ga0157374_10846121 | 3300013296 | Bacteria | 931 |
| 183 | Ga0157378_13106981 | 3300013297 | Bacteria | 515 |
| 184 | Ga0157378_13112564 | 3300013297 | Bacteria | 515 |
| 185 | Ga0157372_10003306 | 3300013307 | Bacteria | 17412 |
| 186 | Ga0157372_10004582 | 3300013307 | Bacteria | 14700 |
| 187 | Ga0157372_10236954 | 3300013307 | Bacteria | 2117 |
| 188 | Ga0157372_10994519 | 3300013307 | Bacteria | 972 |
| 189 | Ga0157372_11830645 | 3300013307 | Bacteria | 698 |
| 190 | Ga0157372_11880988 | 3300013307 | Bacteria | 688 |
| 191 | Ga0157372_12799510 | 3300013307 | Bacteria | 559 |
| 192 | Ga0157375_10003162 | 3300013308 | Bacteria | 14294 |
| 193 | Ga0163163_11274601 | 3300014325 | Bacteria | 797 |
| 194 | Ga0182008_10022942 | 3300014497 | Bacteria | 3193 |
| 195 | Ga0157377_10054158 | 3300014745 | Bacteria | 2270 |
| 196 | Ga0157376_10000089 | 3300014969 | Bacteria | 69351 |
| 197 | Ga0157376_11704152 | 3300014969 | Bacteria | 665 |
| 198 | Ga0182006_1000192 | 3300015261 | Bacteria | 62926 |
| 199 | Ga0182006_1000511 | 3300015261 | Bacteria | 29588 |
| 200 | Ga0182006_1014937 | 3300015261 | Bacteria | 3339 |
| 201 | Ga0182006_1269873 | 3300015261 | Bacteria | 558 |
| 202 | Ga0182007_10000037 | 3300015262 | Bacteria | 123677 |
| 203 | Ga0182007_10048499 | 3300015262 | Bacteria | 1404 |
| 204 | Ga0182007_10059194 | 3300015262 | Bacteria | 1256 |
| 205 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 206 | Ga0182005_1000021 | 3300015265 | Bacteria | 272185 |
| 207 | Ga0182005_1107264 | 3300015265 | Bacteria | 787 |
| 208 | Ga0163161_10058762 | 3300017792 | Bacteria | 2795 |
| 209 | Ga0163161_10133657 | 3300017792 | Bacteria | 1873 |
| 210 | Ga0206351_10021820 | 3300020077 | Bacteria | 1498 |
| 211 | Ga0206350_10473795 | 3300020080 | Bacteria | 905 |
| 212 | Ga0154015_1180754 | 3300020610 | Bacteria | 31444 |
| 213 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 214 | Ga0213872_10008110 | 3300021361 | Bacteria | 5097 |
| 215 | Ga0224712_10138994 | 3300022467 | Bacteria | 1067 |
| 216 | Ga0209674_117304 | 3300025226 | Bacteria | 588 |
| 217 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 218 | Ga0209672_103798 | 3300025228 | Bacteria | 2996 |
| 219 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 220 | Ga0209563_100397 | 3300025230 | Bacteria | 15582 |
| 221 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 222 | Ga0209258_106615 | 3300025242 | Bacteria | 1796 |
| 223 | Ga0207425_1022788 | 3300025245 | Bacteria | 1316 |
| 224 | Ga0209646_1000023 | 3300025246 | Bacteria | 441100 |
| 225 | Ga0209026_1035601 | 3300025250 | Bacteria | 730 |
| 226 | Ga0209677_101933 | 3300025253 | Bacteria | 8281 |
| 227 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 228 | Ga0209148_1003469 | 3300025254 | Bacteria | 4353 |
| 229 | Ga0209759_1000178 | 3300025256 | Bacteria | 105147 |
| 230 | Ga0209759_1002236 | 3300025256 | Bacteria | 8826 |
| 231 | Ga0209129_1029037 | 3300025258 | Bacteria | 935 |
| 232 | Ga0209565_1033768 | 3300025263 | Bacteria | 984 |
| 233 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 234 | Ga0209455_1000566 | 3300025272 | Bacteria | 24635 |
| 235 | Ga0209455_1000856 | 3300025272 | Bacteria | 16265 |
| 236 | Ga0209455_1040195 | 3300025272 | Bacteria | 717 |
| 237 | Ga0209673_1066881 | 3300025273 | Bacteria | 872 |
| 238 | Ga0209025_1000283 | 3300025294 | Bacteria | 114855 |
| 239 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 240 | Ga0209256_1024493 | 3300025299 | Bacteria | 1776 |
| 241 | Ga0207426_1075160 | 3300025302 | Bacteria | 930 |
| 242 | Ga0207656_10000454 | 3300025321 | Bacteria | 13714 |
| 243 | Ga0207696_1028734 | 3300025711 | Bacteria | 1703 |
| 244 | Ga0207655_1001387 | 3300025728 | Bacteria | 22630 |
| 245 | Ga0207682_10536099 | 3300025893 | Bacteria | 554 |
| 246 | Ga0207688_10210177 | 3300025901 | Bacteria | 1169 |
| 247 | Ga0207680_10435786 | 3300025903 | Bacteria | 929 |
| 248 | Ga0207647_10000941 | 3300025904 | Bacteria | 22528 |
| 249 | Ga0207647_10006656 | 3300025904 | Bacteria | 8398 |
| 250 | Ga0207647_10042324 | 3300025904 | Bacteria | 2858 |
| 251 | Ga0207647_10063441 | 3300025904 | Bacteria | 2247 |
| 252 | Ga0207647_10067352 | 3300025904 | Bacteria | 2170 |
| 253 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 254 | Ga0207705_10070816 | 3300025909 | Bacteria | 2527 |
| 255 | Ga0207705_10131055 | 3300025909 | Bacteria | 1866 |
| 256 | Ga0207705_10735449 | 3300025909 | Bacteria | 766 |
| 257 | Ga0207705_11073686 | 3300025909 | Bacteria | 621 |
| 258 | Ga0207654_10838580 | 3300025911 | Bacteria | 665 |
| 259 | Ga0207695_10429123 | 3300025913 | Bacteria | 1206 |
| 260 | Ga0207695_10978525 | 3300025913 | Bacteria | 726 |
| 261 | Ga0207695_11506689 | 3300025913 | Bacteria | 553 |
| 262 | Ga0207671_10026530 | 3300025914 | Bacteria | 4339 |
| 263 | Ga0207671_10102853 | 3300025914 | Bacteria | 2166 |
| 264 | Ga0207671_10692746 | 3300025914 | Bacteria | 810 |
| 265 | Ga0207657_10000019 | 3300025919 | Bacteria | 159785 |
| 266 | Ga0207649_10002825 | 3300025920 | Bacteria | 9571 |
| 267 | Ga0207649_10169288 | 3300025920 | Bacteria | 1520 |
| 268 | Ga0207652_10676801 | 3300025921 | Bacteria | 922 |
| 269 | Ga0207694_10003984 | 3300025924 | Bacteria | 11643 |
| 270 | Ga0207694_10066731 | 3300025924 | Bacteria | 2807 |
| 271 | Ga0207659_11907505 | 3300025926 | Bacteria | 503 |
| 272 | Ga0207644_10778748 | 3300025931 | Bacteria | 800 |
| 273 | Ga0207690_10000028 | 3300025932 | Bacteria | 160775 |
| 274 | Ga0207690_10400851 | 3300025932 | Bacteria | 1094 |
| 275 | Ga0207706_10002199 | 3300025933 | Bacteria | 19005 |
| 276 | Ga0207706_10446267 | 3300025933 | Bacteria | 1119 |
| 277 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 278 | Ga0207669_10000222 | 3300025937 | Bacteria | 25932 |
| 279 | Ga0207669_10088491 | 3300025937 | Bacteria | 2008 |
| 280 | Ga0207711_10008080 | 3300025941 | Bacteria | 8808 |
| 281 | Ga0207711_11030039 | 3300025941 | Bacteria | 763 |
| 282 | Ga0207689_11026426 | 3300025942 | Bacteria | 696 |
| 283 | Ga0207679_10117683 | 3300025945 | Bacteria | 2109 |
| 284 | Ga0207679_10185217 | 3300025945 | Bacteria | 1726 |
| 285 | Ga0207667_10007455 | 3300025949 | Bacteria | 13143 |
| 286 | Ga0207667_10022597 | 3300025949 | Bacteria | 6941 |
| 287 | Ga0207667_10023782 | 3300025949 | Bacteria | 6743 |
| 288 | Ga0207667_10205733 | 3300025949 | Bacteria | 2018 |
| 289 | Ga0207667_10397640 | 3300025949 | Bacteria | 1403 |
| 290 | Ga0207667_11213207 | 3300025949 | Bacteria | 734 |
| 291 | Ga0207712_10344146 | 3300025961 | Bacteria | 1237 |
| 292 | Ga0207712_10525035 | 3300025961 | Bacteria | 1015 |
| 293 | Ga0207668_11638405 | 3300025972 | Bacteria | 581 |
| 294 | Ga0207640_10000065 | 3300025981 | Bacteria | 86695 |
| 295 | Ga0207640_10092457 | 3300025981 | Bacteria | 2098 |
| 296 | Ga0207658_10209300 | 3300025986 | Bacteria | 1633 |
| 297 | Ga0207703_11765182 | 3300026035 | Bacteria | 595 |
| 298 | Ga0207639_10000519 | 3300026041 | Bacteria | 26590 |
| 299 | Ga0207678_10001003 | 3300026067 | Bacteria | 25716 |
| 300 | Ga0207678_10024511 | 3300026067 | Bacteria | 5270 |
| 301 | Ga0207678_10229421 | 3300026067 | Bacteria | 1590 |
| 302 | Ga0207702_10062377 | 3300026078 | Bacteria | 3183 |
| 303 | Ga0207648_10297915 | 3300026089 | Bacteria | 1446 |
| 304 | Ga0207674_10001593 | 3300026116 | Bacteria | 29207 |
| 305 | Ga0207674_10186835 | 3300026116 | Bacteria | 2022 |
| 306 | Ga0207674_11835306 | 3300026116 | Bacteria | 573 |
| 307 | Ga0207675_100250745 | 3300026118 | Bacteria | 1713 |
| 308 | Ga0207683_10004368 | 3300026121 | Bacteria | 12211 |
| 309 | Ga0207698_10000357 | 3300026142 | Bacteria | 26870 |
| 310 | Ga0207698_11049680 | 3300026142 | Bacteria | 827 |
| 311 | Ga0209281_1026850 | 3300027111 | Bacteria | 1060 |
| 312 | Ga0209371_1037884 | 3300027312 | Bacteria | 998 |
| 313 | Ga0268266_10468311 | 3300028379 | Bacteria | 1200 |
| 314 | Ga0268266_11357776 | 3300028379 | Bacteria | 686 |
| 315 | Ga0268266_12018031 | 3300028379 | Bacteria | 550 |
| 316 | Ga0268264_11395650 | 3300028381 | Bacteria | 711 |
| 317 | Ga0307517_10052336 | 3300028786 | Bacteria | 4095 |
| 318 | Ga0307515_10006558 | 3300028794 | Bacteria | 23248 |
| 319 | Ga0307515_10253862 | 3300028794 | Bacteria | 1506 |
| 320 | Ga0265338_10000023 | 3300028800 | Bacteria | 300147 |
| 321 | Ga0265338_10001259 | 3300028800 | Bacteria | 41748 |
| 322 | Ga0268256_1022311 | 3300030500 | Bacteria | 1663 |
| 323 | Ga0307508_10445132 | 3300031616 | Bacteria | 888 |
| 324 | Ga0307516_10252620 | 3300031730 | Bacteria | 1457 |
| 325 | Ga0307413_12172044 | 3300031824 | Bacteria | 503 |
| 326 | Ga0395899_0239091 | 3300037312 | Bacteria | 1250 |
| 327 | Ga0395899_0650477 | 3300037312 | Bacteria | 666 |
| 328 | Ga0395900_0010958 | 3300037418 | Bacteria | 9270 |
| 329 | Ga0395900_0094687 | 3300037418 | Bacteria | 3068 |
| 330 | Ga0395900_0207832 | 3300037418 | Bacteria | 1978 |
| 331 | Ga0395900_0883880 | 3300037418 | Bacteria | 818 |
| 332 | Ga0395900_1556678 | 3300037418 | Bacteria | 573 |
| 333 | Ga0395898_0002757 | 3300037466 | Bacteria | 20242 |
| 334 | Ga0395898_0051147 | 3300037466 | Bacteria | 4041 |
| 335 | Ga0395898_0241069 | 3300037466 | Bacteria | 1724 |
| 336 | Ga0395898_0259935 | 3300037466 | Bacteria | 1656 |
| 337 | Ga0395905_0459497 | 3300037471 | Bacteria | 1171 |
| 338 | Ga0395905_0588007 | 3300037471 | Bacteria | 1015 |
| 339 | Ga0395901_0027759 | 3300038443 | Bacteria | 5820 |
| 340 | Ga0395901_0175982 | 3300038443 | Bacteria | 2244 |
| 341 | Ga0395901_0218079 | 3300038443 | Bacteria | 1994 |
| 342 | Ga0395901_0534470 | 3300038443 | Bacteria | 1190 |
| 343 | Ga0395901_0732088 | 3300038443 | Bacteria | 983 |
| 344 | Ga0436361_0076881 | 3300039447 | Bacteria | 560 |
| 345 | Ga0436361_0485655 | 3300039447 | Bacteria | 4330 |
| 346 | Ga0451795_0601512 | 3300041456 | Bacteria | 2088 |
| 347 | Ga0451800_1000663 | 3300041459 | Bacteria | 822 |
| 348 | Ga0451802_1942149 | 3300041460 | Bacteria | 600 |
| 349 | Ga0451806_569546 | 3300041462 | Bacteria | 516 |
| 350 | Ga0451804_0760028 | 3300041463 | Bacteria | 741 |
| 351 | Ga0451833_0389902 | 3300041491 | Bacteria | 880 |
| 352 | Ga0451837_0579300 | 3300041494 | Bacteria | 562 |
| 353 | Ga0451841_0754232 | 3300041498 | Bacteria | 619 |
| 354 | Ga0439431_0206232 | 3300041997 | Bacteria | 574 |
| 355 | Ga0439433_0100713 | 3300041999 | Bacteria | 717 |
| 356 | Ga0439449_0023929 | 3300042007 | Bacteria | 2284 |
| 357 | Ga0439450_139352 | 3300042008 | Bacteria | 632 |
| 358 | Ga0439455_0024469 | 3300042012 | Bacteria | 1461 |
| 359 | Ga0439458_0107000 | 3300042157 | Bacteria | 729 |
| 360 | Ga0466972_0380509 | 3300044658 | Unclassified | 661 |
| 361 | Ga0466965_0465760 | 3300044683 | Bacteria | 705 |
| 362 | Ga0466965_0521090 | 3300044683 | Unclassified | 668 |
| 363 | Ga0466966_0939872 | 3300044684 | Unclassified | 521 |
| 364 | Ga0466961_0002467 | 3300044693 | Bacteria | 11472 |
| 365 | Ga0466964_0049769 | 3300044706 | Bacteria | 1716 |
| 366 | Ga0466964_0346058 | 3300044706 | Bacteria | 762 |
| 367 | Ga0453684_0000077 | 3300044712 | Bacteria | 435536 |
| 368 | Ga0466971_0728255 | 3300044719 | Unclassified | 500 |
| 369 | Ga0466968_0360668 | 3300044735 | Unclassified | 707 |
| 370 | Ga0466970_0094071 | 3300044765 | Bacteria | 1628 |
| 371 | Ga0466957_0011555 | 3300044842 | Bacteria | 5099 |
| 372 | Ga0466959_0019920 | 3300045049 | Bacteria | 4938 |
| 373 | Ga0466959_0223194 | 3300045049 | Bacteria | 1306 |
| 374 | Ga0466958_0406309 | 3300045836 | Bacteria | 879 |
| 375 | Ga0466958_0506377 | 3300045836 | Bacteria | 783 |
| 376 | Ga0466967_0281706 | 3300045976 | Bacteria | 1595 |
| 377 | Ga0495617_051801 | 3300046452 | Bacteria | 1364 |
| 378 | Ga0495617_153676 | 3300046452 | Bacteria | 731 |
| 379 | Ga0495629_0054526 | 3300046459 | Bacteria | 2796 |
| 380 | Ga0495638_0081041 | 3300046460 | Bacteria | 1971 |
| 381 | Ga0495638_0243614 | 3300046460 | Bacteria | 994 |
| 382 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 383 | Ga0495650_0000193 | 3300046471 | Bacteria | 131834 |
| 384 | Ga0495650_0007364 | 3300046471 | Bacteria | 6631 |
| 385 | Ga0495650_0037862 | 3300046471 | Bacteria | 2094 |
| 386 | Ga0495650_0094521 | 3300046471 | Bacteria | 1131 |
| 387 | Ga0495650_0131825 | 3300046471 | Bacteria | 911 |
| 388 | Ga0495580_0001051 | 3300046472 | Bacteria | 24258 |
| 389 | Ga0495584_0020121 | 3300046491 | Bacteria | 3391 |
| 390 | Ga0495585_0030891 | 3300046492 | Bacteria | 3045 |
| 391 | Ga0495585_0306413 | 3300046492 | Bacteria | 780 |
| 392 | Ga0495596_0007300 | 3300046500 | Bacteria | 4995 |
| 393 | Ga0495596_0108004 | 3300046500 | Bacteria | 1080 |
| 394 | Ga0495607_0023525 | 3300046501 | Bacteria | 3856 |
| 395 | Ga0495583_0018703 | 3300046506 | Bacteria | 3641 |
| 396 | Ga0495583_0055168 | 3300046506 | Bacteria | 1796 |
| 397 | Ga0495583_0145199 | 3300046506 | Bacteria | 986 |
| 398 | Ga0495606_0000084 | 3300046507 | Bacteria | 158428 |
| 399 | Ga0495606_0005424 | 3300046507 | Bacteria | 12220 |
| 400 | Ga0495606_0050421 | 3300046507 | Bacteria | 2723 |
| 401 | Ga0495606_0051882 | 3300046507 | Bacteria | 2672 |
| 402 | Ga0495606_0146023 | 3300046507 | Bacteria | 1393 |
| 403 | Ga0495606_0163865 | 3300046507 | Bacteria | 1295 |
| 404 | Ga0495606_0256596 | 3300046507 | Bacteria | 967 |
| 405 | Ga0495606_0373838 | 3300046507 | Bacteria | 749 |
| 406 | Ga0495610_0000734 | 3300046512 | Bacteria | 31036 |
| 407 | Ga0495610_0005527 | 3300046512 | Bacteria | 8954 |
| 408 | Ga0495610_0014792 | 3300046512 | Bacteria | 4567 |
| 409 | Ga0495610_0085008 | 3300046512 | Bacteria | 1445 |
| 410 | Ga0495616_0138571 | 3300046513 | Bacteria | 1110 |
| 411 | Ga0495616_0253081 | 3300046513 | Bacteria | 756 |
| 412 | Ga0495628_0325463 | 3300046516 | Bacteria | 1134 |
| 413 | Ga0495631_0095376 | 3300046518 | Bacteria | 1281 |
| 414 | Ga0495631_0353555 | 3300046518 | Bacteria | 625 |
| 415 | Ga0495637_0038501 | 3300046520 | Bacteria | 2070 |
| 416 | Ga0495637_0088811 | 3300046520 | Bacteria | 1222 |
| 417 | Ga0495637_0157753 | 3300046520 | Bacteria | 853 |
| 418 | Ga0495643_0000022 | 3300046522 | Bacteria | 289691 |
| 419 | Ga0495643_0012099 | 3300046522 | Bacteria | 5216 |
| 420 | Ga0495643_0036849 | 3300046522 | Bacteria | 2685 |
| 421 | Ga0495643_0100493 | 3300046522 | Bacteria | 1483 |
| 422 | Ga0495643_0287750 | 3300046522 | Bacteria | 753 |
| 423 | Ga0495644_0021790 | 3300046523 | Bacteria | 2443 |
| 424 | Ga0495648_0000923 | 3300046524 | Bacteria | 30591 |
| 425 | Ga0495648_0004643 | 3300046524 | Bacteria | 11658 |
| 426 | Ga0495648_0022483 | 3300046524 | Bacteria | 4339 |
| 427 | Ga0495648_0028087 | 3300046524 | Bacteria | 3751 |
| 428 | Ga0495648_0085957 | 3300046524 | Bacteria | 1775 |
| 429 | Ga0495648_0317951 | 3300046524 | Bacteria | 723 |
| 430 | Ga0495663_0033194 | 3300046525 | Bacteria | 1540 |
| 431 | Ga0495642_0000616 | 3300046528 | Bacteria | 17924 |
| 432 | Ga0495642_0049088 | 3300046528 | Bacteria | 1733 |
| 433 | Ga0495654_0016464 | 3300046530 | Bacteria | 3908 |
| 434 | Ga0495609_0271481 | 3300046538 | Bacteria | 695 |
| 435 | Ga0495597_0000149 | 3300046542 | Bacteria | 61717 |
| 436 | Ga0495597_0000302 | 3300046542 | Bacteria | 44243 |
| 437 | Ga0495597_0006279 | 3300046542 | Bacteria | 6158 |
| 438 | Ga0495597_0009473 | 3300046542 | Bacteria | 4807 |
| 439 | Ga0495633_0000813 | 3300046558 | Bacteria | 27626 |
| 440 | Ga0495633_0005592 | 3300046558 | Bacteria | 7627 |
| 441 | Ga0495633_0139941 | 3300046558 | Bacteria | 1119 |
| 442 | Ga0495633_0572187 | 3300046558 | Bacteria | 508 |
| 443 | Ga0495668_0297278 | 3300046616 | Bacteria | 885 |
| 444 | Ga0495668_0372515 | 3300046616 | Bacteria | 784 |
| 445 | Ga0495611_0135002 | 3300046648 | Bacteria | 1152 |
| 446 | Ga0495625_0012563 | 3300046660 | Bacteria | 6855 |
| 447 | Ga0495625_0046683 | 3300046660 | Bacteria | 3124 |
| 448 | Ga0495625_0070936 | 3300046660 | Bacteria | 2446 |
| 449 | Ga0495625_0098977 | 3300046660 | Bacteria | 2005 |
| 450 | Ga0495625_0108543 | 3300046660 | Bacteria | 1899 |
| 451 | Ga0495625_0728162 | 3300046660 | Bacteria | 583 |
| 452 | Ga0495659_0000197 | 3300046664 | Bacteria | 26421 |
| 453 | Ga0495669_0016648 | 3300046684 | Plasmid | 3150 |
| 454 | Ga0495670_0232459 | 3300046691 | Bacteria | 980 |
| 455 | Ga0495671_0000612 | 3300046692 | Bacteria | 26137 |
| 456 | Ga0495671_0024342 | 3300046692 | Bacteria | 3154 |
| 457 | Ga0495671_0056790 | 3300046692 | Bacteria | 1938 |
| 458 | Ga0495649_0005585 | 3300046694 | Bacteria | 7959 |
| 459 | Ga0495649_0037173 | 3300046694 | Bacteria | 2673 |
| 460 | Ga0495649_0067139 | 3300046694 | Bacteria | 1924 |
| 461 | Ga0495649_0109591 | 3300046694 | Bacteria | 1464 |
| 462 | Ga0495649_0363824 | 3300046694 | Bacteria | 729 |
| 463 | Ga0495660_0456015 | 3300046810 | Bacteria | 552 |
| 464 | Ga0495581_0193707 | 3300047315 | Bacteria | 1189 |
| 465 | Ga0495636_0010162 | 3300047318 | Bacteria | 3712 |
| 466 | Ga0495672_0000325 | 3300047320 | Bacteria | 63353 |
| 467 | Ga0495672_0000364 | 3300047320 | Bacteria | 57893 |
| 468 | Ga0495672_0000501 | 3300047320 | Bacteria | 45072 |
| 469 | Ga0495672_0001049 | 3300047320 | Bacteria | 28219 |
| 470 | Ga0495672_0348603 | 3300047320 | Bacteria | 688 |
| 471 | Ga0495683_0051518 | 3300047323 | Bacteria | 2057 |
| 472 | Ga0495687_012939 | 3300047443 | Bacteria | 4383 |
| 473 | Ga0495687_203931 | 3300047443 | Bacteria | 625 |
| 474 | Ga0495677_0024700 | 3300047445 | Bacteria | 2180 |
| 475 | Ga0495677_0057593 | 3300047445 | Bacteria | 1437 |
| 476 | Ga0495673_0000109 | 3300047469 | Bacteria | 166877 |
| 477 | Ga0495673_0205000 | 3300047469 | Bacteria | 736 |
| 478 | Ga0495681_0016089 | 3300047470 | Bacteria | 4210 |
| 479 | Ga0495681_0172865 | 3300047470 | Bacteria | 892 |
| 480 | Ga0495686_0000101 | 3300047472 | Bacteria | 178238 |
| 481 | Ga0495614_0177950 | 3300048089 | Bacteria | 956 |
| 482 | Ga0495626_0005743 | 3300048091 | Bacteria | 7167 |
| 483 | Ga0496100_0268316 | 3300048903 | Bacteria | 1268 |
| 484 | Ga0496100_0534773 | 3300048903 | Bacteria | 905 |
| 485 | Ga0496101_0106433 | 3300048904 | Bacteria | 2106 |
| 486 | Ga0496101_0349128 | 3300048904 | Bacteria | 1162 |
| 487 | Ga0496101_1204057 | 3300048904 | Bacteria | 593 |
| 488 | Ga0496102_0002580 | 3300048905 | Bacteria | 15450 |
| 489 | Ga0496102_0528058 | 3300048905 | Bacteria | 1103 |
| 490 | Ga0496103_0000055 | 3300048906 | Bacteria | 143870 |
| 491 | Ga0496104_0045333 | 3300048907 | Bacteria | 4135 |
| 492 | Ga0496104_0047175 | 3300048907 | Bacteria | 4059 |
| 493 | Ga0496104_1166766 | 3300048907 | Bacteria | 673 |
| 494 | Ga0496105_0000312 | 3300048908 | Bacteria | 31860 |
| 495 | Ga0496105_0007690 | 3300048908 | Bacteria | 8357 |
| 496 | Ga0496105_0119568 | 3300048908 | Bacteria | 2173 |
| 497 | Ga0496105_0339469 | 3300048908 | Bacteria | 1201 |
| 498 | Ga0496106_0422606 | 3300048909 | Bacteria | 1071 |
| 499 | Ga0496110_0080950 | 3300048913 | Bacteria | 2895 |
| 500 | Ga0496111_0020612 | 3300048914 | Bacteria | 4591 |
| 501 | Ga0496112_0312124 | 3300048915 | Bacteria | 1517 |
| 502 | Ga0496113_0057875 | 3300048916 | Bacteria | 2915 |
| 503 | Ga0496113_0491568 | 3300048916 | Bacteria | 985 |
| 504 | Ga0496114_0009646 | 3300048917 | Bacteria | 7667 |
| 505 | Ga0496115_0004364 | 3300048918 | Bacteria | 10237 |
| 506 | Ga0496115_0112966 | 3300048918 | Bacteria | 2232 |
| 507 | Ga0496116_0020028 | 3300048919 | Bacteria | 5097 |
| 508 | Ga0496116_0122599 | 3300048919 | Bacteria | 1500 |
| 509 | Ga0496117_0000549 | 3300048920 | Bacteria | 61657 |
| 510 | Ga0496118_0000552 | 3300048921 | Bacteria | 61677 |
| 511 | Ga0496118_0165361 | 3300048921 | Bacteria | 1360 |
| 512 | Ga0496118_0169619 | 3300048921 | Bacteria | 1335 |
| 513 | Ga0496119_0014198 | 3300048922 | Bacteria | 6257 |
| 514 | Ga0496120_0068375 | 3300048923 | Bacteria | 1960 |
| 515 | Ga0496121_0014836 | 3300048924 | Bacteria | 8223 |
| 516 | Ga0496121_0164364 | 3300048924 | Bacteria | 1619 |
| 517 | Ga0496122_0043037 | 3300048925 | Bacteria | 3543 |
| 518 | Ga0496122_0309594 | 3300048925 | Bacteria | 846 |
| 519 | Ga0496123_0031086 | 3300048926 | Bacteria | 3892 |
| 520 | Ga0496123_0156595 | 3300048926 | Bacteria | 1220 |
| 521 | Ga0496123_0225966 | 3300048926 | Bacteria | 940 |
| 522 | Ga0496123_0470952 | 3300048926 | Bacteria | 555 |
| 523 | Ga0496124_0000585 | 3300048927 | Bacteria | 61469 |
| 524 | Ga0496124_0004757 | 3300048927 | Bacteria | 15634 |
| 525 | Ga0496124_0102521 | 3300048927 | Bacteria | 2315 |
| 526 | Ga0496124_0234341 | 3300048927 | Bacteria | 1370 |
| 527 | Ga0496125_0004698 | 3300048928 | Bacteria | 15566 |
| 528 | Ga0496125_0006119 | 3300048928 | Bacteria | 13127 |
| 529 | Ga0496125_0369737 | 3300048928 | Bacteria | 849 |
| 530 | Ga0496126_0009285 | 3300048929 | Bacteria | 10476 |
| 531 | Ga0496126_0233254 | 3300048929 | Bacteria | 1541 |
| 532 | Ga0496126_0295151 | 3300048929 | Bacteria | 1339 |
| 533 | Ga0496126_1016119 | 3300048929 | Bacteria | 621 |
| 534 | Ga0496126_1403280 | 3300048929 | Bacteria | 504 |
| 535 | Ga0495678_000103 | 3300049459 | Bacteria | 103891 |
| 536 | Ga0495682_0039775 | 3300049460 | Bacteria | 1726 |
| 537 | Ga0495682_0128364 | 3300049460 | Bacteria | 907 |
| 538 | Ga0495682_0183882 | 3300049460 | Bacteria | 742 |
| 539 | Ga0495682_0191133 | 3300049460 | Bacteria | 727 |
| 540 | Ga0501031_0079328 | 3300049568 | Bacteria | 2139 |
| 541 | Ga0501031_0102170 | 3300049568 | Bacteria | 1870 |
| 542 | Ga0501031_1037589 | 3300049568 | Bacteria | 524 |
| 543 | Ga0501032_0019135 | 3300049569 | Bacteria | 4791 |
| 544 | Ga0501033_0007594 | 3300049570 | Bacteria | 8431 |
| 545 | Ga0501033_0036341 | 3300049570 | Bacteria | 3691 |
| 546 | Ga0501033_0409778 | 3300049570 | Unclassified | 945 |
| 547 | Ga0501034_0071540 | 3300049571 | Bacteria | 3478 |
| 548 | Ga0501034_0210446 | 3300049571 | Bacteria | 1900 |
| 549 | Ga0501034_0476579 | 3300049571 | Bacteria | 1163 |
| 550 | Ga0501034_0712084 | 3300049571 | Unclassified | 902 |
| 551 | Ga0501036_0191909 | 3300049572 | Bacteria | 1718 |
| 552 | Ga0501037_0042094 | 3300049573 | Bacteria | 3357 |
| 553 | Ga0501037_0136352 | 3300049573 | Bacteria | 1758 |
| 554 | Ga0501038_0086638 | 3300049574 | Bacteria | 2631 |
| 555 | Ga0501038_0396734 | 3300049574 | Bacteria | 1068 |
| 556 | Ga0501043_0112910 | 3300049579 | Unclassified | 2134 |
| 557 | Ga0501046_0611996 | 3300049580 | Bacteria | 772 |
| 558 | Ga0501047_0001719 | 3300049581 | Bacteria | 21291 |
| 559 | Ga0501047_0108940 | 3300049581 | Bacteria | 2652 |
| 560 | Ga0501080_0370053 | 3300049742 | Bacteria | 1292 |
| 561 | Ga0501035_0014272 | 3300049822 | Bacteria | 7333 |
| 562 | Ga0501035_0100203 | 3300049822 | Bacteria | 2543 |
| 563 | Ga0501035_0219819 | 3300049822 | Bacteria | 1622 |
| 564 | Ga0501035_0498054 | 3300049822 | Bacteria | 1003 |
| 565 | Ga0501044_0000759 | 3300049823 | Bacteria | 39033 |
| 566 | Ga0501044_0012342 | 3300049823 | Bacteria | 9249 |
| 567 | Ga0501044_0038454 | 3300049823 | Bacteria | 4997 |
| 568 | Ga0501044_0154261 | 3300049823 | Bacteria | 2277 |
| 569 | nmdc:mga03683_173575_c1 | 3300050489 | Bacteria | 980 |
| 570 | nmdc:mga0k408_178985_c1 | 3300050493 | Bacteria | 1264 |
| 571 | nmdc:mga0k408_72993_c1 | 3300050493 | Bacteria | 1565 |
| 572 | nmdc:mga07m45_689296_c1 | 3300050496 | Bacteria | 588 |
| 573 | Ga0500644_0018207 | 3300053088 | Bacteria | 2053 |
| 574 | Ga0500644_0459925 | 3300053088 | Bacteria | 558 |
| 575 | Ga0500647_0086843 | 3300053091 | Bacteria | 1499 |
| 576 | Ga0500566_0203076 | 3300053094 | Bacteria | 999 |
| 577 | Ga0500594_0012219 | 3300053118 | Bacteria | 2019 |
| 578 | Ga0500618_001793 | 3300053125 | Bacteria | 9069 |
| 579 | Ga0500618_014036 | 3300053125 | Bacteria | 2058 |
| 580 | Ga0500621_247680 | 3300053126 | Bacteria | 600 |
| 581 | Ga0500642_0000731 | 3300053130 | Bacteria | 9673 |
| 582 | Ga0500655_002387 | 3300053133 | Bacteria | 3439 |
| 583 | Ga0500586_000914 | 3300053145 | Bacteria | 6075 |
| 584 | Ga0500604_0010999 | 3300053151 | Bacteria | 2426 |
| 585 | Ga0500622_0252891 | 3300053156 | Bacteria | 773 |
| 586 | Ga0500636_0166188 | 3300053177 | Bacteria | 1198 |
| 587 | Ga0500645_000506 | 3300053730 | Bacteria | 26243 |
| 588 | Ga0500645_020596 | 3300053730 | Bacteria | 2043 |
| 589 | Ga0500596_000856 | 3300053735 | Bacteria | 6052 |
| 590 | Ga0500661_043388 | 3300055283 | Bacteria | 798 |
| 591 | Ga0587128_114121 | 3300059630 | Bacteria | 581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001915 | JGI24741J21665_1012780 | JGI24741J21665_10127802 | 63 |
| 2 | 3300001979 | JGI24740J21852_10000687 | JGI24740J21852_1000068710 | 63 |
| 3 | 3300001979 | JGI24740J21852_10058749 | JGI24740J21852_100587492 | 63 |
| 4 | 3300001989 | JGI24739J22299_10001673 | JGI24739J22299_100016739 | 63 |
| 5 | 3300001990 | JGI24737J22298_10001659 | JGI24737J22298_100016595 | 63 |
| 6 | 3300001990 | JGI24737J22298_10154741 | JGI24737J22298_101547412 | 63 |
| 7 | 3300002067 | JGI24735J21928_10001615 | JGI24735J21928_100016158 | 63 |
| 8 | 3300002067 | JGI24735J21928_10006876 | JGI24735J21928_100068761 | 63 |
| 9 | 3300002075 | JGI24738J21930_10001024 | JGI24738J21930_100010245 | 63 |
| 10 | 3300002075 | JGI24738J21930_10004804 | JGI24738J21930_100048045 | 63 |
| 11 | 3300002077 | JGI24744J21845_10001801 | JGI24744J21845_100018012 | 63 |
| 12 | 3300002738 | JGI25154J39366_1001108 | JGI25154J39366_10011082 | 63 |
| 13 | 3300003187 | JGI25151J46595_10005111 | JGI25151J46595_100051113 | 63 |
| 14 | 3300003322 | rootL2_10000610 | rootL2_100006106 | 63 |
| 15 | 3300003322 | rootL2_10110713 | rootL2_101107134 | 63 |
| 16 | 3300003323 | rootH1_10015466 | rootH1_100154666 | 63 |
| 17 | 3300003567 | Ga0006554J51385_1047400 | Ga0006554J51385_10474001 | 63 |
| 18 | 3300003758 | Ga0055532_1000400 | Ga0055532_10004002 | 63 |
| 19 | 3300003759 | Ga0055525_1000654 | Ga0055525_10006548 | 63 |
| 20 | 3300003760 | Ga0055527_1000274 | Ga0055527_10002743 | 63 |
| 21 | 3300003761 | Ga0055535_1000569 | Ga0055535_100056923 | 63 |
| 22 | 3300003762 | Ga0055542_1009120 | Ga0055542_10091201 | 63 |
| 23 | 3300003762 | Ga0055542_1012678 | Ga0055542_10126782 | 63 |
| 24 | 3300003762 | Ga0055542_1022193 | Ga0055542_10221931 | 63 |
| 25 | 3300003763 | Ga0055529_1000970 | Ga0055529_100097014 | 63 |
| 26 | 3300003763 | Ga0055529_1005735 | Ga0055529_10057353 | 63 |
| 27 | 3300005327 | Ga0070658_10000136 | Ga0070658_1000013614 | 63 |
| 28 | 3300005327 | Ga0070658_10264846 | Ga0070658_102648462 | 63 |
| 29 | 3300005327 | Ga0070658_10274731 | Ga0070658_102747312 | 63 |
| 30 | 3300005328 | Ga0070676_10002760 | Ga0070676_100027606 | 63 |
| 31 | 3300005328 | Ga0070676_10011676 | Ga0070676_100116764 | 63 |
| 32 | 3300005334 | Ga0068869_100000200 | Ga0068869_10000020014 | 63 |
| 33 | 3300005338 | Ga0068868_100000049 | Ga0068868_10000004972 | 63 |
| 34 | 3300005339 | Ga0070660_100000011 | Ga0070660_10000001144 | 63 |
| 35 | 3300005339 | Ga0070660_101073323 | Ga0070660_1010733231 | 63 |
| 36 | 3300005344 | Ga0070661_100004782 | Ga0070661_1000047826 | 63 |
| 37 | 3300005344 | Ga0070661_100268469 | Ga0070661_1002684693 | 63 |
| 38 | 3300005344 | Ga0070661_101021381 | Ga0070661_1010213812 | 63 |
| 39 | 3300005344 | Ga0070661_101179706 | Ga0070661_1011797061 | 63 |
| 40 | 3300005354 | Ga0070675_100015819 | Ga0070675_1000158192 | 63 |
| 41 | 3300005354 | Ga0070675_100428834 | Ga0070675_1004288343 | 63 |
| 42 | 3300005364 | Ga0070673_100000006 | Ga0070673_100000006136 | 63 |
| 43 | 3300005364 | Ga0070673_100352037 | Ga0070673_1003520372 | 63 |
| 44 | 3300005366 | Ga0070659_100000239 | Ga0070659_10000023927 | 63 |
| 45 | 3300005366 | Ga0070659_100083808 | Ga0070659_1000838085 | 63 |
| 46 | 3300005366 | Ga0070659_100496015 | Ga0070659_1004960152 | 63 |
| 47 | 3300005436 | Ga0070713_101290888 | Ga0070713_1012908881 | 63 |
| 48 | 3300005455 | Ga0070663_100000291 | Ga0070663_10000029119 | 63 |
| 49 | 3300005455 | Ga0070663_100036404 | Ga0070663_1000364043 | 63 |
| 50 | 3300005455 | Ga0070663_100226817 | Ga0070663_1002268172 | 63 |
| 51 | 3300005457 | Ga0070662_100000574 | Ga0070662_1000005747 | 63 |
| 52 | 3300005457 | Ga0070662_101879111 | Ga0070662_1018791112 | 63 |
| 53 | 3300005459 | Ga0068867_100000001 | Ga0068867_100000001381 | 63 |
| 54 | 3300005530 | Ga0070679_101051982 | Ga0070679_1010519821 | 63 |
| 55 | 3300005535 | Ga0070684_102301579 | Ga0070684_1023015791 | 63 |
| 56 | 3300005539 | Ga0068853_100000475 | Ga0068853_10000047513 | 63 |
| 57 | 3300005539 | Ga0068853_100006265 | Ga0068853_10000626511 | 63 |
| 58 | 3300005539 | Ga0068853_100249883 | Ga0068853_1002498832 | 63 |
| 59 | 3300005539 | Ga0068853_100911220 | Ga0068853_1009112202 | 63 |
| 60 | 3300005543 | Ga0070672_100324522 | Ga0070672_1003245224 | 63 |
| 61 | 3300005543 | Ga0070672_100846330 | Ga0070672_1008463302 | 63 |
| 62 | 3300005548 | Ga0070665_100424242 | Ga0070665_1004242421 | 63 |
| 63 | 3300005548 | Ga0070665_102213378 | Ga0070665_1022133782 | 63 |
| 64 | 3300005563 | Ga0068855_100001542 | Ga0068855_1000015424 | 63 |
| 65 | 3300005563 | Ga0068855_100002263 | Ga0068855_1000022633 | 63 |
| 66 | 3300005563 | Ga0068855_100045914 | Ga0068855_1000459148 | 63 |
| 67 | 3300005563 | Ga0068855_100711736 | Ga0068855_1007117361 | 63 |
| 68 | 3300005563 | Ga0068855_101188741 | Ga0068855_1011887412 | 63 |
| 69 | 3300005563 | Ga0068855_102330115 | Ga0068855_1023301152 | 63 |
| 70 | 3300005564 | Ga0070664_100008244 | Ga0070664_1000082444 | 63 |
| 71 | 3300005564 | Ga0070664_100121199 | Ga0070664_1001211992 | 63 |
| 72 | 3300005564 | Ga0070664_101487728 | Ga0070664_1014877282 | 63 |
| 73 | 3300005577 | Ga0068857_100000670 | Ga0068857_1000006707 | 63 |
| 74 | 3300005577 | Ga0068857_100510743 | Ga0068857_1005107433 | 63 |
| 75 | 3300005577 | Ga0068857_101261950 | Ga0068857_1012619502 | 63 |
| 76 | 3300005578 | Ga0068854_100000036 | Ga0068854_10000003691 | 63 |
| 77 | 3300005578 | Ga0068854_100002610 | Ga0068854_1000026107 | 63 |
| 78 | 3300005578 | Ga0068854_100003389 | Ga0068854_10000338910 | 63 |
| 79 | 3300005614 | Ga0068856_100083806 | Ga0068856_1000838064 | 63 |
| 80 | 3300005614 | Ga0068856_100490594 | Ga0068856_1004905942 | 63 |
| 81 | 3300005614 | Ga0068856_100979879 | Ga0068856_1009798792 | 63 |
| 82 | 3300005616 | Ga0068852_100000450 | Ga0068852_10000045023 | 63 |
| 83 | 3300005616 | Ga0068852_100076454 | Ga0068852_1000764542 | 63 |
| 84 | 3300005616 | Ga0068852_100124182 | Ga0068852_1001241821 | 63 |
| 85 | 3300005616 | Ga0068852_102267076 | Ga0068852_1022670761 | 63 |
| 86 | 3300005834 | Ga0068851_10001264 | Ga0068851_1000126411 | 63 |
| 87 | 3300005834 | Ga0068851_10024314 | Ga0068851_100243143 | 63 |
| 88 | 3300005842 | Ga0068858_100080012 | Ga0068858_1000800122 | 63 |
| 89 | 3300006051 | Ga0075364_10010430 | Ga0075364_100104306 | 63 |
| 90 | 3300006177 | Ga0075362_10081612 | Ga0075362_100816122 | 63 |
| 91 | 3300006195 | Ga0075366_10146656 | Ga0075366_101466562 | 63 |
| 92 | 3300006237 | Ga0097621_100001076 | Ga0097621_10000107629 | 63 |
| 93 | 3300006358 | Ga0068871_100004490 | Ga0068871_10000449012 | 63 |
| 94 | 3300006881 | Ga0068865_100000003 | Ga0068865_100000003212 | 63 |
| 95 | 3300006946 | Ga0079104_1054502 | Ga0079104_10545022 | 63 |
| 96 | 3300009036 | Ga0105244_10000513 | Ga0105244_1000051333 | 63 |
| 97 | 3300009036 | Ga0105244_10004237 | Ga0105244_100042378 | 63 |
| 98 | 3300009092 | Ga0105250_10008145 | Ga0105250_100081455 | 63 |
| 99 | 3300009093 | Ga0105240_10036197 | Ga0105240_100361977 | 63 |
| 100 | 3300009093 | Ga0105240_10091518 | Ga0105240_100915186 | 63 |
| 101 | 3300009093 | Ga0105240_10619704 | Ga0105240_106197042 | 63 |
| 102 | 3300009093 | Ga0105240_10910164 | Ga0105240_109101642 | 63 |
| 103 | 3300009093 | Ga0105240_10918266 | Ga0105240_109182662 | 63 |
| 104 | 3300009093 | Ga0105240_11232756 | Ga0105240_112327562 | 63 |
| 105 | 3300009093 | Ga0105240_11401393 | Ga0105240_114013932 | 63 |
| 106 | 3300009093 | Ga0105240_12415232 | Ga0105240_124152322 | 63 |
| 107 | 3300009093 | Ga0105240_12687615 | Ga0105240_126876151 | 63 |
| 108 | 3300009098 | Ga0105245_10000113 | Ga0105245_1000011364 | 63 |
| 109 | 3300009148 | Ga0105243_10000373 | Ga0105243_1000037357 | 63 |
| 110 | 3300009174 | Ga0105241_10113361 | Ga0105241_101133611 | 63 |
| 111 | 3300009176 | Ga0105242_10000165 | Ga0105242_1000016517 | 63 |
| 112 | 3300009177 | Ga0105248_10011752 | Ga0105248_100117526 | 63 |
| 113 | 3300009177 | Ga0105248_10616256 | Ga0105248_106162563 | 63 |
| 114 | 3300009177 | Ga0105248_10731518 | Ga0105248_107315182 | 63 |
| 115 | 3300009545 | Ga0105237_10132938 | Ga0105237_101329382 | 63 |
| 116 | 3300009545 | Ga0105237_10142332 | Ga0105237_101423322 | 63 |
| 117 | 3300009545 | Ga0105237_10296548 | Ga0105237_102965483 | 63 |
| 118 | 3300009545 | Ga0105237_10311286 | Ga0105237_103112863 | 63 |
| 119 | 3300009545 | Ga0105237_10994367 | Ga0105237_109943672 | 63 |
| 120 | 3300009551 | Ga0105238_10001089 | Ga0105238_1000108915 | 63 |
| 121 | 3300009551 | Ga0105238_10058421 | Ga0105238_100584215 | 63 |
| 122 | 3300009551 | Ga0105238_10388094 | Ga0105238_103880942 | 63 |
| 123 | 3300009553 | Ga0105249_10014083 | Ga0105249_100140833 | 63 |
| 124 | 3300009553 | Ga0105249_10023929 | Ga0105249_100239292 | 63 |
| 125 | 3300010375 | Ga0105239_10175331 | Ga0105239_101753313 | 63 |
| 126 | 3300010375 | Ga0105239_10311482 | Ga0105239_103114824 | 63 |
| 127 | 3300010375 | Ga0105239_13047297 | Ga0105239_130472971 | 63 |
| 128 | 3300011119 | Ga0105246_10044455 | Ga0105246_100444551 | 63 |
| 129 | 3300013100 | Ga0157373_10000025 | Ga0157373_10000025111 | 63 |
| 130 | 3300013100 | Ga0157373_10005064 | Ga0157373_1000506411 | 63 |
| 131 | 3300013100 | Ga0157373_10024803 | Ga0157373_100248033 | 63 |
| 132 | 3300013100 | Ga0157373_11143501 | Ga0157373_111435012 | 63 |
| 133 | 3300013102 | Ga0157371_10001141 | Ga0157371_1000114128 | 63 |
| 134 | 3300013102 | Ga0157371_10160624 | Ga0157371_101606242 | 63 |
| 135 | 3300013104 | Ga0157370_10000017 | Ga0157370_10000017127 | 63 |
| 136 | 3300013104 | Ga0157370_10000027 | Ga0157370_10000027111 | 63 |
| 137 | 3300013104 | Ga0157370_10003021 | Ga0157370_100030217 | 63 |
| 138 | 3300013104 | Ga0157370_10005061 | Ga0157370_1000506112 | 63 |
| 139 | 3300013104 | Ga0157370_10062642 | Ga0157370_100626424 | 63 |
| 140 | 3300013104 | Ga0157370_10239905 | Ga0157370_102399052 | 63 |
| 141 | 3300013104 | Ga0157370_10268427 | Ga0157370_102684273 | 63 |
| 142 | 3300013104 | Ga0157370_11607996 | Ga0157370_116079962 | 63 |
| 143 | 3300013105 | Ga0157369_10001890 | Ga0157369_1000189022 | 63 |
| 144 | 3300013105 | Ga0157369_10091327 | Ga0157369_100913273 | 63 |
| 145 | 3300013105 | Ga0157369_10178619 | Ga0157369_101786192 | 63 |
| 146 | 3300013105 | Ga0157369_10188586 | Ga0157369_101885863 | 63 |
| 147 | 3300013105 | Ga0157369_10546708 | Ga0157369_105467083 | 63 |
| 148 | 3300013105 | Ga0157369_11129362 | Ga0157369_111293622 | 63 |
| 149 | 3300013296 | Ga0157374_10002557 | Ga0157374_1000255714 | 63 |
| 150 | 3300013296 | Ga0157374_10437431 | Ga0157374_104374313 | 63 |
| 151 | 3300013296 | Ga0157374_10846121 | Ga0157374_108461211 | 63 |
| 152 | 3300013297 | Ga0157378_13106981 | Ga0157378_131069812 | 63 |
| 153 | 3300013297 | Ga0157378_13112564 | Ga0157378_131125642 | 63 |
| 154 | 3300013307 | Ga0157372_10003306 | Ga0157372_1000330612 | 63 |
| 155 | 3300013307 | Ga0157372_10004582 | Ga0157372_1000458215 | 63 |
| 156 | 3300013307 | Ga0157372_10236954 | Ga0157372_102369543 | 63 |
| 157 | 3300013307 | Ga0157372_10994519 | Ga0157372_109945192 | 63 |
| 158 | 3300013307 | Ga0157372_11830645 | Ga0157372_118306451 | 63 |
| 159 | 3300013307 | Ga0157372_11880988 | Ga0157372_118809882 | 63 |
| 160 | 3300013307 | Ga0157372_12799510 | Ga0157372_127995101 | 63 |
| 161 | 3300013308 | Ga0157375_10003162 | Ga0157375_1000316210 | 63 |
| 162 | 3300014325 | Ga0163163_11274601 | Ga0163163_112746012 | 63 |
| 163 | 3300014497 | Ga0182008_10022942 | Ga0182008_100229425 | 63 |
| 164 | 3300014745 | Ga0157377_10054158 | Ga0157377_100541583 | 63 |
| 165 | 3300014969 | Ga0157376_10000089 | Ga0157376_1000008965 | 63 |
| 166 | 3300015261 | Ga0182006_1000192 | Ga0182006_100019231 | 63 |
| 167 | 3300015261 | Ga0182006_1000511 | Ga0182006_100051110 | 63 |
| 168 | 3300015261 | Ga0182006_1014937 | Ga0182006_10149371 | 63 |
| 169 | 3300015261 | Ga0182006_1269873 | Ga0182006_12698731 | 63 |
| 170 | 3300015262 | Ga0182007_10000037 | Ga0182007_1000003794 | 63 |
| 171 | 3300015262 | Ga0182007_10048499 | Ga0182007_100484992 | 63 |
| 172 | 3300015262 | Ga0182007_10059194 | Ga0182007_100591942 | 63 |
| 173 | 3300015265 | Ga0182005_1000008 | Ga0182005_1000008206 | 63 |
| 174 | 3300015265 | Ga0182005_1000021 | Ga0182005_1000021240 | 63 |
| 175 | 3300015265 | Ga0182005_1107264 | Ga0182005_11072643 | 63 |
| 176 | 3300017792 | Ga0163161_10058762 | Ga0163161_100587623 | 63 |
| 177 | 3300020077 | Ga0206351_10021820 | Ga0206351_100218202 | 63 |
| 178 | 3300020080 | Ga0206350_10473795 | Ga0206350_104737952 | 63 |
| 179 | 3300020610 | Ga0154015_1180754 | Ga0154015_118075431 | 63 |
| 180 | 3300021327 | Ga0214543_1000015 | Ga0214543_1000015221 | 63 |
| 181 | 3300021361 | Ga0213872_10008110 | Ga0213872_100081104 | 63 |
| 182 | 3300022467 | Ga0224712_10138994 | Ga0224712_101389942 | 63 |
| 183 | 3300025228 | Ga0209672_100012 | Ga0209672_100012636 | 63 |
| 184 | 3300025228 | Ga0209672_103798 | Ga0209672_1037983 | 63 |
| 185 | 3300025229 | Ga0209147_100007 | Ga0209147_100007135 | 63 |
| 186 | 3300025230 | Ga0209563_100397 | Ga0209563_10039720 | 63 |
| 187 | 3300025242 | Ga0209258_100014 | Ga0209258_100014568 | 63 |
| 188 | 3300025242 | Ga0209258_106615 | Ga0209258_1066152 | 63 |
| 189 | 3300025245 | Ga0207425_1022788 | Ga0207425_10227882 | 63 |
| 190 | 3300025246 | Ga0209646_1000023 | Ga0209646_10000233 | 63 |
| 191 | 3300025253 | Ga0209677_101933 | Ga0209677_10193317 | 63 |
| 192 | 3300025254 | Ga0209148_1003469 | Ga0209148_10034694 | 63 |
| 193 | 3300025256 | Ga0209759_1000178 | Ga0209759_10001789 | 63 |
| 194 | 3300025256 | Ga0209759_1002236 | Ga0209759_100223610 | 63 |
| 195 | 3300025258 | Ga0209129_1029037 | Ga0209129_10290371 | 63 |
| 196 | 3300025272 | Ga0209455_1000566 | Ga0209455_100056624 | 63 |
| 197 | 3300025272 | Ga0209455_1000856 | Ga0209455_10008564 | 63 |
| 198 | 3300025294 | Ga0209025_1000283 | Ga0209025_1000283115 | 63 |
| 199 | 3300025302 | Ga0207426_1075160 | Ga0207426_10751601 | 63 |
| 200 | 3300025321 | Ga0207656_10000454 | Ga0207656_1000045418 | 63 |
| 201 | 3300025711 | Ga0207696_1028734 | Ga0207696_10287341 | 63 |
| 202 | 3300025728 | Ga0207655_1001387 | Ga0207655_10013872 | 63 |
| 203 | 3300025904 | Ga0207647_10000941 | Ga0207647_100009419 | 63 |
| 204 | 3300025904 | Ga0207647_10006656 | Ga0207647_100066565 | 63 |
| 205 | 3300025904 | Ga0207647_10042324 | Ga0207647_100423242 | 63 |
| 206 | 3300025904 | Ga0207647_10063441 | Ga0207647_100634413 | 63 |
| 207 | 3300025909 | Ga0207705_10000021 | Ga0207705_10000021135 | 63 |
| 208 | 3300025909 | Ga0207705_10070816 | Ga0207705_100708164 | 63 |
| 209 | 3300025909 | Ga0207705_10131055 | Ga0207705_101310552 | 63 |
| 210 | 3300025909 | Ga0207705_10735449 | Ga0207705_107354492 | 63 |
| 211 | 3300025909 | Ga0207705_11073686 | Ga0207705_110736862 | 63 |
| 212 | 3300025911 | Ga0207654_10838580 | Ga0207654_108385801 | 63 |
| 213 | 3300025913 | Ga0207695_10429123 | Ga0207695_104291233 | 63 |
| 214 | 3300025913 | Ga0207695_10978525 | Ga0207695_109785252 | 63 |
| 215 | 3300025913 | Ga0207695_11506689 | Ga0207695_115066892 | 63 |
| 216 | 3300025914 | Ga0207671_10026530 | Ga0207671_100265302 | 63 |
| 217 | 3300025914 | Ga0207671_10102853 | Ga0207671_101028532 | 63 |
| 218 | 3300025914 | Ga0207671_10692746 | Ga0207671_106927462 | 63 |
| 219 | 3300025919 | Ga0207657_10000019 | Ga0207657_1000001943 | 63 |
| 220 | 3300025920 | Ga0207649_10002825 | Ga0207649_100028259 | 63 |
| 221 | 3300025920 | Ga0207649_10169288 | Ga0207649_101692881 | 63 |
| 222 | 3300025921 | Ga0207652_10676801 | Ga0207652_106768012 | 63 |
| 223 | 3300025924 | Ga0207694_10003984 | Ga0207694_1000398410 | 63 |
| 224 | 3300025924 | Ga0207694_10066731 | Ga0207694_100667313 | 63 |
| 225 | 3300025932 | Ga0207690_10000028 | Ga0207690_1000002843 | 63 |
| 226 | 3300025932 | Ga0207690_10400851 | Ga0207690_104008512 | 63 |
| 227 | 3300025933 | Ga0207706_10002199 | Ga0207706_1000219920 | 63 |
| 228 | 3300025941 | Ga0207711_10008080 | Ga0207711_1000808015 | 63 |
| 229 | 3300025941 | Ga0207711_11030039 | Ga0207711_110300392 | 63 |
| 230 | 3300025945 | Ga0207679_10117683 | Ga0207679_101176833 | 63 |
| 231 | 3300025945 | Ga0207679_10185217 | Ga0207679_101852172 | 63 |
| 232 | 3300025949 | Ga0207667_10007455 | Ga0207667_1000745511 | 63 |
| 233 | 3300025949 | Ga0207667_10022597 | Ga0207667_100225973 | 63 |
| 234 | 3300025949 | Ga0207667_10023782 | Ga0207667_100237822 | 63 |
| 235 | 3300025949 | Ga0207667_10205733 | Ga0207667_102057333 | 63 |
| 236 | 3300025949 | Ga0207667_10397640 | Ga0207667_103976402 | 63 |
| 237 | 3300025961 | Ga0207712_10344146 | Ga0207712_103441462 | 63 |
| 238 | 3300025961 | Ga0207712_10525035 | Ga0207712_105250352 | 63 |
| 239 | 3300025981 | Ga0207640_10000065 | Ga0207640_1000006522 | 63 |
| 240 | 3300025981 | Ga0207640_10092457 | Ga0207640_100924571 | 63 |
| 241 | 3300026035 | Ga0207703_11765182 | Ga0207703_117651822 | 63 |
| 242 | 3300026041 | Ga0207639_10000519 | Ga0207639_1000051923 | 63 |
| 243 | 3300026067 | Ga0207678_10001003 | Ga0207678_1000100310 | 63 |
| 244 | 3300026067 | Ga0207678_10024511 | Ga0207678_100245114 | 63 |
| 245 | 3300026067 | Ga0207678_10229421 | Ga0207678_102294212 | 63 |
| 246 | 3300026078 | Ga0207702_10062377 | Ga0207702_100623774 | 63 |
| 247 | 3300026116 | Ga0207674_10001593 | Ga0207674_1000159311 | 63 |
| 248 | 3300026116 | Ga0207674_10186835 | Ga0207674_101868354 | 63 |
| 249 | 3300026116 | Ga0207674_11835306 | Ga0207674_118353062 | 63 |
| 250 | 3300026142 | Ga0207698_10000357 | Ga0207698_1000035723 | 63 |
| 251 | 3300026142 | Ga0207698_11049680 | Ga0207698_110496802 | 63 |
| 252 | 3300027111 | Ga0209281_1026850 | Ga0209281_10268502 | 63 |
| 253 | 3300027312 | Ga0209371_1037884 | Ga0209371_10378842 | 63 |
| 254 | 3300028379 | Ga0268266_11357776 | Ga0268266_113577761 | 63 |
| 255 | 3300028379 | Ga0268266_12018031 | Ga0268266_120180312 | 63 |
| 256 | 3300028381 | Ga0268264_11395650 | Ga0268264_113956502 | 63 |
| 257 | 3300028794 | Ga0307515_10006558 | Ga0307515_1000655822 | 63 |
| 258 | 3300028794 | Ga0307515_10253862 | Ga0307515_102538622 | 63 |
| 259 | 3300028800 | Ga0265338_10000023 | Ga0265338_10000023119 | 63 |
| 260 | 3300028800 | Ga0265338_10001259 | Ga0265338_1000125913 | 63 |
| 261 | 3300030500 | Ga0268256_1022311 | Ga0268256_10223112 | 63 |
| 262 | 3300031616 | Ga0307508_10445132 | Ga0307508_104451322 | 63 |
| 263 | 3300031730 | Ga0307516_10252620 | Ga0307516_102526202 | 63 |
| 264 | 3300031824 | Ga0307413_12172044 | Ga0307413_121720441 | 63 |
| 265 | 3300037312 | Ga0395899_0239091 | Ga0395899_0239091_133_357 | 63 |
| 266 | 3300037312 | Ga0395899_0650477 | Ga0395899_0650477_346_540 | 63 |
| 267 | 3300037418 | Ga0395900_0010958 | Ga0395900_0010958_3057_3281 | 63 |
| 268 | 3300037418 | Ga0395900_0094687 | Ga0395900_0094687_1561_1755 | 63 |
| 269 | 3300037418 | Ga0395900_0207832 | Ga0395900_0207832_1668_1862 | 63 |
| 270 | 3300037418 | Ga0395900_0883880 | Ga0395900_0883880_197_391 | 63 |
| 271 | 3300037418 | Ga0395900_1556678 | Ga0395900_1556678_262_456 | 63 |
| 272 | 3300037466 | Ga0395898_0002757 | Ga0395898_0002757_10465_10659 | 63 |
| 273 | 3300037466 | Ga0395898_0051147 | Ga0395898_0051147_2599_2823 | 63 |
| 274 | 3300037466 | Ga0395898_0241069 | Ga0395898_0241069_965_1159 | 63 |
| 275 | 3300037466 | Ga0395898_0259935 | Ga0395898_0259935_886_1080 | 63 |
| 276 | 3300037471 | Ga0395905_0459497 | Ga0395905_0459497_222_446 | 63 |
| 277 | 3300038443 | Ga0395901_0027759 | Ga0395901_0027759_4066_4260 | 63 |
| 278 | 3300038443 | Ga0395901_0175982 | Ga0395901_0175982_239_433 | 63 |
| 279 | 3300038443 | Ga0395901_0218079 | Ga0395901_0218079_1562_1756 | 63 |
| 280 | 3300038443 | Ga0395901_0732088 | Ga0395901_0732088_248_472 | 63 |
| 281 | 3300039447 | Ga0436361_0076881 | Ga0436361_0076881_19_213 | 63 |
| 282 | 3300039447 | Ga0436361_0485655 | Ga0436361_0485655_1918_2115 | 63 |
| 283 | 3300041456 | Ga0451795_0601512 | Ga0451795_0601512_1844_2044 | 63 |
| 284 | 3300041459 | Ga0451800_1000663 | Ga0451800_1000663_189_389 | 63 |
| 285 | 3300041462 | Ga0451806_569546 | Ga0451806_569546_78_275 | 63 |
| 286 | 3300041463 | Ga0451804_0760028 | Ga0451804_0760028_354_554 | 63 |
| 287 | 3300041491 | Ga0451833_0389902 | Ga0451833_0389902_587_787 | 63 |
| 288 | 3300041494 | Ga0451837_0579300 | Ga0451837_0579300_69_269 | 63 |
| 289 | 3300041498 | Ga0451841_0754232 | Ga0451841_0754232_104_298 | 63 |
| 290 | 3300041997 | Ga0439431_0206232 | Ga0439431_0206232_355_555 | 63 |
| 291 | 3300041999 | Ga0439433_0100713 | Ga0439433_0100713_454_648 | 63 |
| 292 | 3300042007 | Ga0439449_0023929 | Ga0439449_0023929_1538_1732 | 63 |
| 293 | 3300042008 | Ga0439450_139352 | Ga0439450_139352_117_311 | 63 |
| 294 | 3300042012 | Ga0439455_0024469 | Ga0439455_0024469_1177_1371 | 63 |
| 295 | 3300042157 | Ga0439458_0107000 | Ga0439458_0107000_450_644 | 63 |
| 296 | 3300044658 | Ga0466972_0380509 | Ga0466972_0380509_219_413 | 63 |
| 297 | 3300044683 | Ga0466965_0465760 | Ga0466965_0465760_402_596 | 63 |
| 298 | 3300044683 | Ga0466965_0521090 | Ga0466965_0521090_235_429 | 63 |
| 299 | 3300044684 | Ga0466966_0939872 | Ga0466966_0939872_208_402 | 63 |
| 300 | 3300044693 | Ga0466961_0002467 | Ga0466961_0002467_6223_6417 | 63 |
| 301 | 3300044706 | Ga0466964_0049769 | Ga0466964_0049769_216_410 | 63 |
| 302 | 3300044706 | Ga0466964_0346058 | Ga0466964_0346058_541_735 | 63 |
| 303 | 3300044712 | Ga0453684_0000077 | Ga0453684_0000077_37316_37516 | 63 |
| 304 | 3300044719 | Ga0466971_0728255 | Ga0466971_0728255_178_372 | 63 |
| 305 | 3300044735 | Ga0466968_0360668 | Ga0466968_0360668_284_478 | 63 |
| 306 | 3300044765 | Ga0466970_0094071 | Ga0466970_0094071_401_595 | 63 |
| 307 | 3300044842 | Ga0466957_0011555 | Ga0466957_0011555_2986_3180 | 63 |
| 308 | 3300045049 | Ga0466959_0019920 | Ga0466959_0019920_4493_4687 | 63 |
| 309 | 3300045049 | Ga0466959_0223194 | Ga0466959_0223194_242_436 | 63 |
| 310 | 3300045836 | Ga0466958_0406309 | Ga0466958_0406309_430_624 | 63 |
| 311 | 3300045836 | Ga0466958_0506377 | Ga0466958_0506377_360_554 | 63 |
| 312 | 3300045976 | Ga0466967_0281706 | Ga0466967_0281706_421_615 | 63 |
| 313 | 3300046452 | Ga0495617_051801 | Ga0495617_051801_1006_1200 | 63 |
| 314 | 3300046452 | Ga0495617_153676 | Ga0495617_153676_430_624 | 63 |
| 315 | 3300046459 | Ga0495629_0054526 | Ga0495629_0054526_1506_1700 | 63 |
| 316 | 3300046460 | Ga0495638_0081041 | Ga0495638_0081041_498_695 | 63 |
| 317 | 3300046460 | Ga0495638_0243614 | Ga0495638_0243614_57_257 | 63 |
| 318 | 3300046471 | Ga0495650_0000015 | Ga0495650_0000015_375882_376076 | 63 |
| 319 | 3300046471 | Ga0495650_0000193 | Ga0495650_0000193_82619_82813 | 63 |
| 320 | 3300046471 | Ga0495650_0007364 | Ga0495650_0007364_872_1066 | 63 |
| 321 | 3300046471 | Ga0495650_0037862 | Ga0495650_0037862_1790_1984 | 63 |
| 322 | 3300046471 | Ga0495650_0094521 | Ga0495650_0094521_713_907 | 63 |
| 323 | 3300046471 | Ga0495650_0131825 | Ga0495650_0131825_705_899 | 63 |
| 324 | 3300046472 | Ga0495580_0001051 | Ga0495580_0001051_22186_22380 | 63 |
| 325 | 3300046492 | Ga0495585_0030891 | Ga0495585_0030891_1740_1934 | 63 |
| 326 | 3300046500 | Ga0495596_0007300 | Ga0495596_0007300_1011_1205 | 63 |
| 327 | 3300046500 | Ga0495596_0108004 | Ga0495596_0108004_508_702 | 63 |
| 328 | 3300046501 | Ga0495607_0023525 | Ga0495607_0023525_2377_2571 | 63 |
| 329 | 3300046506 | Ga0495583_0055168 | Ga0495583_0055168_1251_1448 | 63 |
| 330 | 3300046506 | Ga0495583_0145199 | Ga0495583_0145199_336_530 | 63 |
| 331 | 3300046507 | Ga0495606_0000084 | Ga0495606_0000084_56975_57172 | 63 |
| 332 | 3300046507 | Ga0495606_0005424 | Ga0495606_0005424_6717_6950 | 63 |
| 333 | 3300046507 | Ga0495606_0146023 | Ga0495606_0146023_661_858 | 63 |
| 334 | 3300046507 | Ga0495606_0163865 | Ga0495606_0163865_364_558 | 63 |
| 335 | 3300046507 | Ga0495606_0256596 | Ga0495606_0256596_57_251 | 63 |
| 336 | 3300046507 | Ga0495606_0373838 | Ga0495606_0373838_189_383 | 63 |
| 337 | 3300046512 | Ga0495610_0000734 | Ga0495610_0000734_28495_28728 | 63 |
| 338 | 3300046512 | Ga0495610_0005527 | Ga0495610_0005527_834_1031 | 63 |
| 339 | 3300046512 | Ga0495610_0014792 | Ga0495610_0014792_1585_1782 | 63 |
| 340 | 3300046513 | Ga0495616_0253081 | Ga0495616_0253081_453_647 | 63 |
| 341 | 3300046516 | Ga0495628_0325463 | Ga0495628_0325463_234_428 | 63 |
| 342 | 3300046518 | Ga0495631_0353555 | Ga0495631_0353555_55_252 | 63 |
| 343 | 3300046520 | Ga0495637_0038501 | Ga0495637_0038501_861_1055 | 63 |
| 344 | 3300046520 | Ga0495637_0157753 | Ga0495637_0157753_510_704 | 63 |
| 345 | 3300046522 | Ga0495643_0000022 | Ga0495643_0000022_216956_217153 | 63 |
| 346 | 3300046522 | Ga0495643_0036849 | Ga0495643_0036849_2042_2236 | 63 |
| 347 | 3300046522 | Ga0495643_0287750 | Ga0495643_0287750_376_570 | 63 |
| 348 | 3300046523 | Ga0495644_0021790 | Ga0495644_0021790_1774_1968 | 63 |
| 349 | 3300046524 | Ga0495648_0000923 | Ga0495648_0000923_9900_10094 | 63 |
| 350 | 3300046524 | Ga0495648_0022483 | Ga0495648_0022483_2783_2980 | 63 |
| 351 | 3300046524 | Ga0495648_0028087 | Ga0495648_0028087_158_355 | 63 |
| 352 | 3300046524 | Ga0495648_0085957 | Ga0495648_0085957_953_1150 | 63 |
| 353 | 3300046524 | Ga0495648_0317951 | Ga0495648_0317951_126_323 | 63 |
| 354 | 3300046528 | Ga0495642_0000616 | Ga0495642_0000616_2702_2896 | 63 |
| 355 | 3300046528 | Ga0495642_0049088 | Ga0495642_0049088_1428_1622 | 63 |
| 356 | 3300046530 | Ga0495654_0016464 | Ga0495654_0016464_1921_2115 | 63 |
| 357 | 3300046542 | Ga0495597_0000149 | Ga0495597_0000149_22878_23072 | 63 |
| 358 | 3300046542 | Ga0495597_0000302 | Ga0495597_0000302_21350_21547 | 63 |
| 359 | 3300046542 | Ga0495597_0006279 | Ga0495597_0006279_4996_5190 | 63 |
| 360 | 3300046542 | Ga0495597_0009473 | Ga0495597_0009473_3067_3261 | 63 |
| 361 | 3300046558 | Ga0495633_0005592 | Ga0495633_0005592_5540_5737 | 63 |
| 362 | 3300046558 | Ga0495633_0572187 | Ga0495633_0572187_34_234 | 63 |
| 363 | 3300046616 | Ga0495668_0297278 | Ga0495668_0297278_636_830 | 63 |
| 364 | 3300046616 | Ga0495668_0372515 | Ga0495668_0372515_158_355 | 63 |
| 365 | 3300046660 | Ga0495625_0012563 | Ga0495625_0012563_782_979 | 63 |
| 366 | 3300046660 | Ga0495625_0046683 | Ga0495625_0046683_855_1052 | 63 |
| 367 | 3300046660 | Ga0495625_0728162 | Ga0495625_0728162_159_371 | 63 |
| 368 | 3300046664 | Ga0495659_0000197 | Ga0495659_0000197_4442_4636 | 63 |
| 369 | 3300046684 | Ga0495669_0016648 | Ga0495669_0016648_1435_1629 | 63 |
| 370 | 3300046692 | Ga0495671_0000612 | Ga0495671_0000612_21602_21796 | 63 |
| 371 | 3300046692 | Ga0495671_0024342 | Ga0495671_0024342_170_367 | 63 |
| 372 | 3300046692 | Ga0495671_0056790 | Ga0495671_0056790_1638_1835 | 63 |
| 373 | 3300046694 | Ga0495649_0005585 | Ga0495649_0005585_1270_1464 | 63 |
| 374 | 3300046694 | Ga0495649_0037173 | Ga0495649_0037173_2138_2335 | 63 |
| 375 | 3300046694 | Ga0495649_0067139 | Ga0495649_0067139_853_1050 | 63 |
| 376 | 3300046694 | Ga0495649_0109591 | Ga0495649_0109591_911_1105 | 63 |
| 377 | 3300046810 | Ga0495660_0456015 | Ga0495660_0456015_126_320 | 63 |
| 378 | 3300047315 | Ga0495581_0193707 | Ga0495581_0193707_809_1003 | 63 |
| 379 | 3300047318 | Ga0495636_0010162 | Ga0495636_0010162_3464_3658 | 63 |
| 380 | 3300047320 | Ga0495672_0000325 | Ga0495672_0000325_43858_44055 | 63 |
| 381 | 3300047320 | Ga0495672_0000364 | Ga0495672_0000364_8982_9176 | 63 |
| 382 | 3300047320 | Ga0495672_0000501 | Ga0495672_0000501_33505_33699 | 63 |
| 383 | 3300047320 | Ga0495672_0001049 | Ga0495672_0001049_3164_3358 | 63 |
| 384 | 3300047320 | Ga0495672_0348603 | Ga0495672_0348603_345_542 | 63 |
| 385 | 3300047443 | Ga0495687_012939 | Ga0495687_012939_4178_4372 | 63 |
| 386 | 3300047443 | Ga0495687_203931 | Ga0495687_203931_327_521 | 63 |
| 387 | 3300047445 | Ga0495677_0024700 | Ga0495677_0024700_617_811 | 63 |
| 388 | 3300047445 | Ga0495677_0057593 | Ga0495677_0057593_725_922 | 63 |
| 389 | 3300047469 | Ga0495673_0000109 | Ga0495673_0000109_57811_58008 | 63 |
| 390 | 3300047469 | Ga0495673_0205000 | Ga0495673_0205000_211_408 | 63 |
| 391 | 3300047470 | Ga0495681_0172865 | Ga0495681_0172865_90_329 | 63 |
| 392 | 3300047472 | Ga0495686_0000101 | Ga0495686_0000101_46224_46418 | 63 |
| 393 | 3300048089 | Ga0495614_0177950 | Ga0495614_0177950_544_738 | 63 |
| 394 | 3300048091 | Ga0495626_0005743 | Ga0495626_0005743_3321_3515 | 63 |
| 395 | 3300048903 | Ga0496100_0268316 | Ga0496100_0268316_940_1134 | 63 |
| 396 | 3300048903 | Ga0496100_0534773 | Ga0496100_0534773_295_489 | 63 |
| 397 | 3300048904 | Ga0496101_0106433 | Ga0496101_0106433_773_967 | 63 |
| 398 | 3300048904 | Ga0496101_0349128 | Ga0496101_0349128_671_865 | 63 |
| 399 | 3300048905 | Ga0496102_0528058 | Ga0496102_0528058_366_560 | 63 |
| 400 | 3300048907 | Ga0496104_1166766 | Ga0496104_1166766_386_580 | 63 |
| 401 | 3300048908 | Ga0496105_0119568 | Ga0496105_0119568_725_919 | 63 |
| 402 | 3300048908 | Ga0496105_0339469 | Ga0496105_0339469_405_599 | 63 |
| 403 | 3300048909 | Ga0496106_0422606 | Ga0496106_0422606_161_355 | 63 |
| 404 | 3300048915 | Ga0496112_0312124 | Ga0496112_0312124_732_926 | 63 |
| 405 | 3300048916 | Ga0496113_0491568 | Ga0496113_0491568_106_300 | 63 |
| 406 | 3300048919 | Ga0496116_0122599 | Ga0496116_0122599_704_898 | 63 |
| 407 | 3300048921 | Ga0496118_0165361 | Ga0496118_0165361_762_956 | 63 |
| 408 | 3300048921 | Ga0496118_0169619 | Ga0496118_0169619_356_550 | 63 |
| 409 | 3300048924 | Ga0496121_0164364 | Ga0496121_0164364_503_697 | 63 |
| 410 | 3300048925 | Ga0496122_0309594 | Ga0496122_0309594_599_793 | 63 |
| 411 | 3300048926 | Ga0496123_0156595 | Ga0496123_0156595_390_584 | 63 |
| 412 | 3300048926 | Ga0496123_0225966 | Ga0496123_0225966_341_535 | 63 |
| 413 | 3300048926 | Ga0496123_0470952 | Ga0496123_0470952_227_421 | 63 |
| 414 | 3300048927 | Ga0496124_0004757 | Ga0496124_0004757_9705_9902 | 63 |
| 415 | 3300048927 | Ga0496124_0102521 | Ga0496124_0102521_1984_2178 | 63 |
| 416 | 3300048927 | Ga0496124_0234341 | Ga0496124_0234341_326_520 | 63 |
| 417 | 3300048928 | Ga0496125_0004698 | Ga0496125_0004698_2128_2322 | 63 |
| 418 | 3300048928 | Ga0496125_0369737 | Ga0496125_0369737_229_423 | 63 |
| 419 | 3300048929 | Ga0496126_0295151 | Ga0496126_0295151_616_810 | 63 |
| 420 | 3300048929 | Ga0496126_1016119 | Ga0496126_1016119_109_303 | 63 |
| 421 | 3300048929 | Ga0496126_1403280 | Ga0496126_1403280_75_275 | 63 |
| 422 | 3300049459 | Ga0495678_000103 | Ga0495678_000103_25338_25535 | 63 |
| 423 | 3300049460 | Ga0495682_0039775 | Ga0495682_0039775_1313_1507 | 63 |
| 424 | 3300049460 | Ga0495682_0128364 | Ga0495682_0128364_88_285 | 63 |
| 425 | 3300049460 | Ga0495682_0183882 | Ga0495682_0183882_49_246 | 63 |
| 426 | 3300049460 | Ga0495682_0191133 | Ga0495682_0191133_235_429 | 63 |
| 427 | 3300049568 | Ga0501031_0079328 | Ga0501031_0079328_1603_1797 | 63 |
| 428 | 3300049568 | Ga0501031_0102170 | Ga0501031_0102170_742_936 | 63 |
| 429 | 3300049568 | Ga0501031_1037589 | Ga0501031_1037589_54_248 | 63 |
| 430 | 3300049569 | Ga0501032_0019135 | Ga0501032_0019135_688_882 | 63 |
| 431 | 3300049570 | Ga0501033_0007594 | Ga0501033_0007594_1653_1850 | 63 |
| 432 | 3300049570 | Ga0501033_0036341 | Ga0501033_0036341_458_652 | 63 |
| 433 | 3300049570 | Ga0501033_0409778 | Ga0501033_0409778_329_523 | 63 |
| 434 | 3300049571 | Ga0501034_0071540 | Ga0501034_0071540_3264_3461 | 63 |
| 435 | 3300049571 | Ga0501034_0210446 | Ga0501034_0210446_669_863 | 63 |
| 436 | 3300049571 | Ga0501034_0476579 | Ga0501034_0476579_519_713 | 63 |
| 437 | 3300049571 | Ga0501034_0712084 | Ga0501034_0712084_395_595 | 63 |
| 438 | 3300049572 | Ga0501036_0191909 | Ga0501036_0191909_784_978 | 63 |
| 439 | 3300049573 | Ga0501037_0042094 | Ga0501037_0042094_2543_2737 | 63 |
| 440 | 3300049573 | Ga0501037_0136352 | Ga0501037_0136352_1093_1299 | 63 |
| 441 | 3300049574 | Ga0501038_0086638 | Ga0501038_0086638_580_774 | 63 |
| 442 | 3300049574 | Ga0501038_0396734 | Ga0501038_0396734_757_954 | 63 |
| 443 | 3300049579 | Ga0501043_0112910 | Ga0501043_0112910_1050_1244 | 63 |
| 444 | 3300049580 | Ga0501046_0611996 | Ga0501046_0611996_506_700 | 63 |
| 445 | 3300049581 | Ga0501047_0001719 | Ga0501047_0001719_16837_17034 | 63 |
| 446 | 3300049581 | Ga0501047_0108940 | Ga0501047_0108940_708_902 | 63 |
| 447 | 3300049742 | Ga0501080_0370053 | Ga0501080_0370053_1029_1223 | 63 |
| 448 | 3300049822 | Ga0501035_0014272 | Ga0501035_0014272_6579_6776 | 63 |
| 449 | 3300049822 | Ga0501035_0100203 | Ga0501035_0100203_866_1063 | 63 |
| 450 | 3300049822 | Ga0501035_0219819 | Ga0501035_0219819_652_846 | 63 |
| 451 | 3300049822 | Ga0501035_0498054 | Ga0501035_0498054_476_670 | 63 |
| 452 | 3300049823 | Ga0501044_0000759 | Ga0501044_0000759_37138_37335 | 63 |
| 453 | 3300049823 | Ga0501044_0012342 | Ga0501044_0012342_6278_6472 | 63 |
| 454 | 3300049823 | Ga0501044_0038454 | Ga0501044_0038454_3956_4150 | 63 |
| 455 | 3300049823 | Ga0501044_0154261 | Ga0501044_0154261_1911_2117 | 63 |
| 456 | 3300050489 | nmdc:mga03683_173575_c1 | nmdc:mga03683_173575_c1_449_643 | 63 |
| 457 | 3300050493 | nmdc:mga0k408_72993_c1 | nmdc:mga0k408_72993_c1_581_775 | 63 |
| 458 | 3300050496 | nmdc:mga07m45_689296_c1 | nmdc:mga07m45_689296_c1_157_354 | 63 |
| 459 | 3300053088 | Ga0500644_0018207 | Ga0500644_0018207_398_598 | 63 |
| 460 | 3300053088 | Ga0500644_0459925 | Ga0500644_0459925_265_459 | 63 |
| 461 | 3300053091 | Ga0500647_0086843 | Ga0500647_0086843_248_442 | 63 |
| 462 | 3300053094 | Ga0500566_0203076 | Ga0500566_0203076_584_784 | 63 |
| 463 | 3300053118 | Ga0500594_0012219 | Ga0500594_0012219_282_479 | 63 |
| 464 | 3300053125 | Ga0500618_001793 | Ga0500618_001793_40_234 | 63 |
| 465 | 3300053125 | Ga0500618_014036 | Ga0500618_014036_516_713 | 63 |
| 466 | 3300053126 | Ga0500621_247680 | Ga0500621_247680_368_562 | 63 |
| 467 | 3300053133 | Ga0500655_002387 | Ga0500655_002387_2827_3021 | 63 |
| 468 | 3300053145 | Ga0500586_000914 | Ga0500586_000914_3568_3765 | 63 |
| 469 | 3300053151 | Ga0500604_0010999 | Ga0500604_0010999_771_971 | 63 |
| 470 | 3300053156 | Ga0500622_0252891 | Ga0500622_0252891_178_375 | 63 |
| 471 | 3300053177 | Ga0500636_0166188 | Ga0500636_0166188_730_924 | 63 |
| 472 | 3300053730 | Ga0500645_000506 | Ga0500645_000506_11299_11499 | 63 |
| 473 | 3300053730 | Ga0500645_020596 | Ga0500645_020596_995_1189 | 63 |
| 474 | 3300048929 | Ga0496126_0233254 | Ga0496126_0233254_1272_1466 | 64 |
| 475 | 3300001904 | JGI24736J21556_1034195 | JGI24736J21556_10341952 | 65 |
| 476 | 3300002077 | JGI24744J21845_10030038 | JGI24744J21845_100300382 | 65 |
| 477 | 3300002244 | JGI24742J22300_10010840 | JGI24742J22300_100108401 | 65 |
| 478 | 3300003215 | JGI25153J46596_10000034 | JGI25153J46596_1000003481 | 65 |
| 479 | 3300003762 | Ga0055542_1000041 | Ga0055542_100004152 | 65 |
| 480 | 3300003763 | Ga0055529_1000040 | Ga0055529_100004077 | 65 |
| 481 | 3300005333 | Ga0070677_10324233 | Ga0070677_103242332 | 65 |
| 482 | 3300005338 | Ga0068868_100294044 | Ga0068868_1002940442 | 65 |
| 483 | 3300005354 | Ga0070675_100404195 | Ga0070675_1004041952 | 65 |
| 484 | 3300005355 | Ga0070671_101524155 | Ga0070671_1015241551 | 65 |
| 485 | 3300005356 | Ga0070674_100002936 | Ga0070674_1000029367 | 65 |
| 486 | 3300005356 | Ga0070674_100121034 | Ga0070674_1001210344 | 65 |
| 487 | 3300005456 | Ga0070678_100241504 | Ga0070678_1002415042 | 65 |
| 488 | 3300005457 | Ga0070662_101539744 | Ga0070662_1015397441 | 65 |
| 489 | 3300005459 | Ga0068867_100601287 | Ga0068867_1006012872 | 65 |
| 490 | 3300005548 | Ga0070665_100369185 | Ga0070665_1003691852 | 65 |
| 491 | 3300005563 | Ga0068855_101848150 | Ga0068855_1018481502 | 65 |
| 492 | 3300005616 | Ga0068852_101282124 | Ga0068852_1012821242 | 65 |
| 493 | 3300005617 | Ga0068859_101950709 | Ga0068859_1019507092 | 65 |
| 494 | 3300005719 | Ga0068861_101006640 | Ga0068861_1010066402 | 65 |
| 495 | 3300006186 | Ga0075369_10558191 | Ga0075369_105581911 | 65 |
| 496 | 3300006195 | Ga0075366_10944336 | Ga0075366_109443361 | 65 |
| 497 | 3300006237 | Ga0097621_100017596 | Ga0097621_1000175963 | 65 |
| 498 | 3300006353 | Ga0075370_10232116 | Ga0075370_102321162 | 65 |
| 499 | 3300006358 | Ga0068871_100133788 | Ga0068871_1001337882 | 65 |
| 500 | 3300006931 | Ga0097620_101950618 | Ga0097620_1019506182 | 65 |
| 501 | 3300009148 | Ga0105243_10002803 | Ga0105243_100028037 | 65 |
| 502 | 3300010375 | Ga0105239_11402277 | Ga0105239_114022772 | 65 |
| 503 | 3300011119 | Ga0105246_10191210 | Ga0105246_101912103 | 65 |
| 504 | 3300013100 | Ga0157373_10849107 | Ga0157373_108491072 | 65 |
| 505 | 3300013102 | Ga0157371_11437065 | Ga0157371_114370651 | 65 |
| 506 | 3300014969 | Ga0157376_11704152 | Ga0157376_117041522 | 65 |
| 507 | 3300017792 | Ga0163161_10133657 | Ga0163161_101336572 | 65 |
| 508 | 3300025226 | Ga0209674_117304 | Ga0209674_1173042 | 65 |
| 509 | 3300025250 | Ga0209026_1035601 | Ga0209026_10356011 | 65 |
| 510 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008242 | 65 |
| 511 | 3300025263 | Ga0209565_1033768 | Ga0209565_10337681 | 65 |
| 512 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021181 | 65 |
| 513 | 3300025272 | Ga0209455_1040195 | Ga0209455_10401952 | 65 |
| 514 | 3300025273 | Ga0209673_1066881 | Ga0209673_10668811 | 65 |
| 515 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007552 | 65 |
| 516 | 3300025299 | Ga0209256_1024493 | Ga0209256_10244932 | 65 |
| 517 | 3300025893 | Ga0207682_10536099 | Ga0207682_105360992 | 65 |
| 518 | 3300025901 | Ga0207688_10210177 | Ga0207688_102101772 | 65 |
| 519 | 3300025903 | Ga0207680_10435786 | Ga0207680_104357862 | 65 |
| 520 | 3300025904 | Ga0207647_10067352 | Ga0207647_100673523 | 65 |
| 521 | 3300025926 | Ga0207659_11907505 | Ga0207659_119075052 | 65 |
| 522 | 3300025931 | Ga0207644_10778748 | Ga0207644_107787482 | 65 |
| 523 | 3300025933 | Ga0207706_10446267 | Ga0207706_104462672 | 65 |
| 524 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005243 | 65 |
| 525 | 3300025937 | Ga0207669_10000222 | Ga0207669_100002226 | 65 |
| 526 | 3300025937 | Ga0207669_10088491 | Ga0207669_100884914 | 65 |
| 527 | 3300025942 | Ga0207689_11026426 | Ga0207689_110264262 | 65 |
| 528 | 3300025949 | Ga0207667_11213207 | Ga0207667_112132072 | 65 |
| 529 | 3300025972 | Ga0207668_11638405 | Ga0207668_116384051 | 65 |
| 530 | 3300025986 | Ga0207658_10209300 | Ga0207658_102093001 | 65 |
| 531 | 3300026089 | Ga0207648_10297915 | Ga0207648_102979152 | 65 |
| 532 | 3300026118 | Ga0207675_100250745 | Ga0207675_1002507452 | 65 |
| 533 | 3300026121 | Ga0207683_10004368 | Ga0207683_1000436815 | 65 |
| 534 | 3300028379 | Ga0268266_10468311 | Ga0268266_104683112 | 65 |
| 535 | 3300028786 | Ga0307517_10052336 | Ga0307517_100523363 | 65 |
| 536 | 3300037471 | Ga0395905_0588007 | Ga0395905_0588007_737_934 | 65 |
| 537 | 3300038443 | Ga0395901_0534470 | Ga0395901_0534470_709_906 | 65 |
| 538 | 3300041460 | Ga0451802_1942149 | Ga0451802_1942149_55_252 | 65 |
| 539 | 3300046491 | Ga0495584_0020121 | Ga0495584_0020121_15_212 | 65 |
| 540 | 3300046492 | Ga0495585_0306413 | Ga0495585_0306413_270_467 | 65 |
| 541 | 3300046506 | Ga0495583_0018703 | Ga0495583_0018703_333_530 | 65 |
| 542 | 3300046507 | Ga0495606_0050421 | Ga0495606_0050421_1709_1906 | 65 |
| 543 | 3300046507 | Ga0495606_0051882 | Ga0495606_0051882_67_264 | 65 |
| 544 | 3300046512 | Ga0495610_0085008 | Ga0495610_0085008_1010_1207 | 65 |
| 545 | 3300046513 | Ga0495616_0138571 | Ga0495616_0138571_646_843 | 65 |
| 546 | 3300046518 | Ga0495631_0095376 | Ga0495631_0095376_202_399 | 65 |
| 547 | 3300046520 | Ga0495637_0088811 | Ga0495637_0088811_510_707 | 65 |
| 548 | 3300046522 | Ga0495643_0012099 | Ga0495643_0012099_1154_1351 | 65 |
| 549 | 3300046522 | Ga0495643_0100493 | Ga0495643_0100493_1216_1413 | 65 |
| 550 | 3300046524 | Ga0495648_0004643 | Ga0495648_0004643_2446_2643 | 65 |
| 551 | 3300046525 | Ga0495663_0033194 | Ga0495663_0033194_789_986 | 65 |
| 552 | 3300046538 | Ga0495609_0271481 | Ga0495609_0271481_382_579 | 65 |
| 553 | 3300046558 | Ga0495633_0000813 | Ga0495633_0000813_23630_23827 | 65 |
| 554 | 3300046558 | Ga0495633_0139941 | Ga0495633_0139941_294_491 | 65 |
| 555 | 3300046648 | Ga0495611_0135002 | Ga0495611_0135002_568_765 | 65 |
| 556 | 3300046660 | Ga0495625_0070936 | Ga0495625_0070936_756_953 | 65 |
| 557 | 3300046660 | Ga0495625_0098977 | Ga0495625_0098977_1783_1980 | 65 |
| 558 | 3300046660 | Ga0495625_0108543 | Ga0495625_0108543_165_362 | 65 |
| 559 | 3300046691 | Ga0495670_0232459 | Ga0495670_0232459_561_758 | 65 |
| 560 | 3300046694 | Ga0495649_0363824 | Ga0495649_0363824_314_511 | 65 |
| 561 | 3300047323 | Ga0495683_0051518 | Ga0495683_0051518_1030_1227 | 65 |
| 562 | 3300047470 | Ga0495681_0016089 | Ga0495681_0016089_2042_2239 | 65 |
| 563 | 3300048904 | Ga0496101_1204057 | Ga0496101_1204057_112_309 | 65 |
| 564 | 3300048905 | Ga0496102_0002580 | Ga0496102_0002580_13022_13219 | 65 |
| 565 | 3300048906 | Ga0496103_0000055 | Ga0496103_0000055_130577_130774 | 65 |
| 566 | 3300048907 | Ga0496104_0045333 | Ga0496104_0045333_1900_2097 | 65 |
| 567 | 3300048907 | Ga0496104_0047175 | Ga0496104_0047175_1600_1806 | 65 |
| 568 | 3300048908 | Ga0496105_0000312 | Ga0496105_0000312_29338_29544 | 65 |
| 569 | 3300048908 | Ga0496105_0007690 | Ga0496105_0007690_2118_2315 | 65 |
| 570 | 3300048913 | Ga0496110_0080950 | Ga0496110_0080950_2119_2316 | 65 |
| 571 | 3300048914 | Ga0496111_0020612 | Ga0496111_0020612_2283_2480 | 65 |
| 572 | 3300048916 | Ga0496113_0057875 | Ga0496113_0057875_2696_2893 | 65 |
| 573 | 3300048917 | Ga0496114_0009646 | Ga0496114_0009646_2764_2961 | 65 |
| 574 | 3300048918 | Ga0496115_0004364 | Ga0496115_0004364_2129_2326 | 65 |
| 575 | 3300048918 | Ga0496115_0112966 | Ga0496115_0112966_603_809 | 65 |
| 576 | 3300048919 | Ga0496116_0020028 | Ga0496116_0020028_2131_2328 | 65 |
| 577 | 3300048920 | Ga0496117_0000549 | Ga0496117_0000549_13269_13466 | 65 |
| 578 | 3300048921 | Ga0496118_0000552 | Ga0496118_0000552_13151_13348 | 65 |
| 579 | 3300048922 | Ga0496119_0014198 | Ga0496119_0014198_4681_4878 | 65 |
| 580 | 3300048923 | Ga0496120_0068375 | Ga0496120_0068375_371_568 | 65 |
| 581 | 3300048924 | Ga0496121_0014836 | Ga0496121_0014836_5878_6075 | 65 |
| 582 | 3300048925 | Ga0496122_0043037 | Ga0496122_0043037_1560_1757 | 65 |
| 583 | 3300048926 | Ga0496123_0031086 | Ga0496123_0031086_2862_3059 | 65 |
| 584 | 3300048927 | Ga0496124_0000585 | Ga0496124_0000585_13022_13219 | 65 |
| 585 | 3300048928 | Ga0496125_0006119 | Ga0496125_0006119_9547_9744 | 65 |
| 586 | 3300048929 | Ga0496126_0009285 | Ga0496126_0009285_2202_2399 | 65 |
| 587 | 3300050493 | nmdc:mga0k408_178985_c1 | nmdc:mga0k408_178985_c1_912_1109 | 65 |
| 588 | 3300053130 | Ga0500642_0000731 | Ga0500642_0000731_3133_3330 | 65 |
| 589 | 3300053735 | Ga0500596_000856 | Ga0500596_000856_2392_2589 | 65 |
| 590 | 3300055283 | Ga0500661_043388 | Ga0500661_043388_313_510 | 65 |
| 591 | 3300059630 | Ga0587128_114121 | Ga0587128_114121_235_432 | 65 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar