F467044

General Info

Members Datasets Scaffolds Average Seq Length
591 302 591 65

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1054502|Ga0079104_10545022
Length 79
Sequence MLSERSCRSQAKRDKRMRLIIALLLPWLTFFTIGRPMAGIICLILQVTVIGWLPAAIWAVYALSQYKTDQKIRNAMGGR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
176 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
177 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
180 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
289 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
290 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
291 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
292 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
295 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
296 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
297 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
301 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
302 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.66
Nodule 0.51
Rhizoplane 4.91
Rhizosphere 76.48
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1034195 3300001904 Bacteria 785
2 JGI24741J21665_1012780 3300001915 Bacteria 1435
3 JGI24740J21852_10000687 3300001979 Bacteria 14679
4 JGI24740J21852_10058749 3300001979 Bacteria 1068
5 JGI24739J22299_10001673 3300001989 Bacteria 8429
6 JGI24737J22298_10001659 3300001990 Bacteria 7940
7 JGI24737J22298_10154741 3300001990 Bacteria 677
8 JGI24735J21928_10001615 3300002067 Bacteria 7973
9 JGI24735J21928_10006876 3300002067 Bacteria 3723
10 JGI24738J21930_10001024 3300002075 Bacteria 7975
11 JGI24738J21930_10004804 3300002075 Bacteria 3286
12 JGI24744J21845_10001801 3300002077 Bacteria 4297
13 JGI24744J21845_10030038 3300002077 Bacteria 1042
14 JGI24742J22300_10010840 3300002244 Bacteria 1510
15 JGI25154J39366_1001108 3300002738 Bacteria 10507
16 JGI25151J46595_10005111 3300003187 Bacteria 6815
17 JGI25153J46596_10000034 3300003215 Bacteria 192215
18 rootL2_10000610 3300003322 Bacteria 20668
19 rootL2_10110713 3300003322 Bacteria 4502
20 rootH1_10015466 3300003323 Bacteria 4282
21 Ga0006554J51385_1047400 3300003567 Bacteria 604
22 Ga0055532_1000400 3300003758 Bacteria 21575
23 Ga0055525_1000654 3300003759 Bacteria 13460
24 Ga0055527_1000274 3300003760 Bacteria 30896
25 Ga0055535_1000569 3300003761 Bacteria 31098
26 Ga0055542_1000041 3300003762 Bacteria 208892
27 Ga0055542_1009120 3300003762 Bacteria 1891
28 Ga0055542_1012678 3300003762 Bacteria 1448
29 Ga0055542_1022193 3300003762 Bacteria 906
30 Ga0055529_1000040 3300003763 Bacteria 230562
31 Ga0055529_1000970 3300003763 Bacteria 14586
32 Ga0055529_1005735 3300003763 Bacteria 1772
33 Ga0070658_10000136 3300005327 Bacteria 64472
34 Ga0070658_10264846 3300005327 Bacteria 1460
35 Ga0070658_10274731 3300005327 Bacteria 1434
36 Ga0070676_10002760 3300005328 Bacteria 9070
37 Ga0070676_10011676 3300005328 Bacteria 4780
38 Ga0070677_10324233 3300005333 Bacteria 790
39 Ga0068869_100000200 3300005334 Bacteria 31213
40 Ga0068868_100000049 3300005338 Bacteria 67274
41 Ga0068868_100294044 3300005338 Bacteria 1378
42 Ga0070660_100000011 3300005339 Bacteria 133167
43 Ga0070660_101073323 3300005339 Bacteria 681
44 Ga0070661_100004782 3300005344 Bacteria 9323
45 Ga0070661_100268469 3300005344 Bacteria 1321
46 Ga0070661_101021381 3300005344 Bacteria 686
47 Ga0070661_101179706 3300005344 Bacteria 640
48 Ga0070675_100015819 3300005354 Bacteria 5973
49 Ga0070675_100404195 3300005354 Bacteria 1219
50 Ga0070675_100428834 3300005354 Bacteria 1183
51 Ga0070671_101524155 3300005355 Bacteria 592
52 Ga0070674_100002936 3300005356 Bacteria 9449
53 Ga0070674_100121034 3300005356 Bacteria 1938
54 Ga0070673_100000006 3300005364 Bacteria 184299
55 Ga0070673_100352037 3300005364 Unclassified 1307
56 Ga0070659_100000239 3300005366 Bacteria 42871
57 Ga0070659_100083808 3300005366 Bacteria 2549
58 Ga0070659_100496015 3300005366 Bacteria 1040
59 Ga0070713_101290888 3300005436 Bacteria 707
60 Ga0070663_100000291 3300005455 Bacteria 25597
61 Ga0070663_100036404 3300005455 Bacteria 3420
62 Ga0070663_100226817 3300005455 Bacteria 1469
63 Ga0070678_100241504 3300005456 Bacteria 1510
64 Ga0070662_100000574 3300005457 Bacteria 22427
65 Ga0070662_101539744 3300005457 Bacteria 574
66 Ga0070662_101879111 3300005457 Bacteria 517
67 Ga0068867_100000001 3300005459 Bacteria 427563
68 Ga0068867_100601287 3300005459 Bacteria 959
69 Ga0070679_101051982 3300005530 Bacteria 758
70 Ga0070684_102301579 3300005535 Bacteria 508
71 Ga0068853_100000475 3300005539 Bacteria 27392
72 Ga0068853_100006265 3300005539 Bacteria 9430
73 Ga0068853_100249883 3300005539 Bacteria 1627
74 Ga0068853_100911220 3300005539 Bacteria 845
75 Ga0070672_100324522 3300005543 Bacteria 1309
76 Ga0070672_100846330 3300005543 Bacteria 806
77 Ga0070665_100369185 3300005548 Bacteria 1442
78 Ga0070665_100424242 3300005548 Bacteria 1339
79 Ga0070665_102213378 3300005548 Unclassified 553
80 Ga0068855_100001542 3300005563 Bacteria 28971
81 Ga0068855_100002263 3300005563 Bacteria 23756
82 Ga0068855_100045914 3300005563 Bacteria 5164
83 Ga0068855_100711736 3300005563 Bacteria 1074
84 Ga0068855_101188741 3300005563 Bacteria 793
85 Ga0068855_101848150 3300005563 Bacteria 613
86 Ga0068855_102330115 3300005563 Bacteria 535
87 Ga0070664_100008244 3300005564 Bacteria 8425
88 Ga0070664_100121199 3300005564 Bacteria 2290
89 Ga0070664_101487728 3300005564 Bacteria 641
90 Ga0068857_100000670 3300005577 Bacteria 25389
91 Ga0068857_100510743 3300005577 Bacteria 1129
92 Ga0068857_101261950 3300005577 Bacteria 716
93 Ga0068854_100000036 3300005578 Bacteria 102170
94 Ga0068854_100002610 3300005578 Bacteria 11173
95 Ga0068854_100003389 3300005578 Bacteria 9929
96 Ga0068856_100083806 3300005614 Bacteria 3167
97 Ga0068856_100490594 3300005614 Bacteria 1249
98 Ga0068856_100979879 3300005614 Bacteria 864
99 Ga0068852_100000450 3300005616 Bacteria 27149
100 Ga0068852_100076454 3300005616 Bacteria 2956
101 Ga0068852_100124182 3300005616 Bacteria 2368
102 Ga0068852_101282124 3300005616 Bacteria 754
103 Ga0068852_102267076 3300005616 Bacteria 564
104 Ga0068859_101950709 3300005617 Bacteria 648
105 Ga0068861_101006640 3300005719 Bacteria 796
106 Ga0068851_10001264 3300005834 Bacteria 11009
107 Ga0068851_10024314 3300005834 Bacteria 2966
108 Ga0068858_100080012 3300005842 Bacteria 3036
109 Ga0075364_10010430 3300006051 Bacteria 5611
110 Ga0075362_10081612 3300006177 Bacteria 1491
111 Ga0075369_10558191 3300006186 Bacteria 547
112 Ga0075366_10146656 3300006195 Bacteria 1428
113 Ga0075366_10944336 3300006195 Bacteria 538
114 Ga0097621_100001076 3300006237 Bacteria 19102
115 Ga0097621_100017596 3300006237 Bacteria 5432
116 Ga0075370_10232116 3300006353 Bacteria 1092
117 Ga0068871_100004490 3300006358 Bacteria 9718
118 Ga0068871_100133788 3300006358 Bacteria 2104
119 Ga0068865_100000003 3300006881 Bacteria 231761
120 Ga0097620_101950618 3300006931 Bacteria 648
121 Ga0079104_1054502 3300006946 Bacteria 879
122 Ga0105244_10000513 3300009036 Bacteria 34566
123 Ga0105244_10004237 3300009036 Bacteria 9954
124 Ga0105250_10008145 3300009092 Bacteria 4463
125 Ga0105240_10036197 3300009093 Bacteria 6351
126 Ga0105240_10091518 3300009093 Bacteria 3715
127 Ga0105240_10619704 3300009093 Bacteria 1189
128 Ga0105240_10910164 3300009093 Bacteria 946
129 Ga0105240_10918266 3300009093 Bacteria 941
130 Ga0105240_11232756 3300009093 Bacteria 791
131 Ga0105240_11401393 3300009093 Bacteria 735
132 Ga0105240_12415232 3300009093 Bacteria 544
133 Ga0105240_12687615 3300009093 Bacteria 514
134 Ga0105245_10000113 3300009098 Bacteria 78545
135 Ga0105243_10000373 3300009148 Bacteria 48115
136 Ga0105243_10002803 3300009148 Bacteria 14476
137 Ga0105241_10113361 3300009174 Bacteria 2173
138 Ga0105242_10000165 3300009176 Bacteria 49974
139 Ga0105248_10011752 3300009177 Bacteria 9657
140 Ga0105248_10616256 3300009177 Bacteria 1224
141 Ga0105248_10731518 3300009177 Bacteria 1116
142 Ga0105237_10132938 3300009545 Bacteria 2483
143 Ga0105237_10142332 3300009545 Bacteria 2393
144 Ga0105237_10296548 3300009545 Bacteria 1620
145 Ga0105237_10311286 3300009545 Bacteria 1578
146 Ga0105237_10994367 3300009545 Bacteria 846
147 Ga0105238_10001089 3300009551 Bacteria 27423
148 Ga0105238_10058421 3300009551 Bacteria 3866
149 Ga0105238_10388094 3300009551 Bacteria 1388
150 Ga0105249_10014083 3300009553 Bacteria 7069
151 Ga0105249_10023929 3300009553 Bacteria 5487
152 Ga0105239_10175331 3300010375 Bacteria 2398
153 Ga0105239_10311482 3300010375 Bacteria 1774
154 Ga0105239_11402277 3300010375 Bacteria 807
155 Ga0105239_13047297 3300010375 Bacteria 546
156 Ga0105246_10044455 3300011119 Bacteria 3019
157 Ga0105246_10191210 3300011119 Bacteria 1584
158 Ga0157373_10000025 3300013100 Bacteria 146728
159 Ga0157373_10005064 3300013100 Bacteria 9903
160 Ga0157373_10024803 3300013100 Bacteria 4341
161 Ga0157373_10849107 3300013100 Bacteria 675
162 Ga0157373_11143501 3300013100 Bacteria 585
163 Ga0157371_10001141 3300013102 Bacteria 28613
164 Ga0157371_10160624 3300013102 Bacteria 1605
165 Ga0157371_11437065 3300013102 Bacteria 536
166 Ga0157370_10000017 3300013104 Bacteria 169971
167 Ga0157370_10000027 3300013104 Bacteria 146729
168 Ga0157370_10003021 3300013104 Bacteria 19971
169 Ga0157370_10005061 3300013104 Bacteria 14880
170 Ga0157370_10062642 3300013104 Bacteria 3526
171 Ga0157370_10239905 3300013104 Bacteria 1677
172 Ga0157370_10268427 3300013104 Bacteria 1577
173 Ga0157370_11607996 3300013104 Bacteria 584
174 Ga0157369_10001890 3300013105 Bacteria 25252
175 Ga0157369_10091327 3300013105 Bacteria 3251
176 Ga0157369_10178619 3300013105 Bacteria 2234
177 Ga0157369_10188586 3300013105 Bacteria 2167
178 Ga0157369_10546708 3300013105 Bacteria 1197
179 Ga0157369_11129362 3300013105 Bacteria 801
180 Ga0157374_10002557 3300013296 Bacteria 15350
181 Ga0157374_10437431 3300013296 Bacteria 1308
182 Ga0157374_10846121 3300013296 Bacteria 931
183 Ga0157378_13106981 3300013297 Bacteria 515
184 Ga0157378_13112564 3300013297 Bacteria 515
185 Ga0157372_10003306 3300013307 Bacteria 17412
186 Ga0157372_10004582 3300013307 Bacteria 14700
187 Ga0157372_10236954 3300013307 Bacteria 2117
188 Ga0157372_10994519 3300013307 Bacteria 972
189 Ga0157372_11830645 3300013307 Bacteria 698
190 Ga0157372_11880988 3300013307 Bacteria 688
191 Ga0157372_12799510 3300013307 Bacteria 559
192 Ga0157375_10003162 3300013308 Bacteria 14294
193 Ga0163163_11274601 3300014325 Bacteria 797
194 Ga0182008_10022942 3300014497 Bacteria 3193
195 Ga0157377_10054158 3300014745 Bacteria 2270
196 Ga0157376_10000089 3300014969 Bacteria 69351
197 Ga0157376_11704152 3300014969 Bacteria 665
198 Ga0182006_1000192 3300015261 Bacteria 62926
199 Ga0182006_1000511 3300015261 Bacteria 29588
200 Ga0182006_1014937 3300015261 Bacteria 3339
201 Ga0182006_1269873 3300015261 Bacteria 558
202 Ga0182007_10000037 3300015262 Bacteria 123677
203 Ga0182007_10048499 3300015262 Bacteria 1404
204 Ga0182007_10059194 3300015262 Bacteria 1256
205 Ga0182005_1000008 3300015265 Bacteria 471394
206 Ga0182005_1000021 3300015265 Bacteria 272185
207 Ga0182005_1107264 3300015265 Bacteria 787
208 Ga0163161_10058762 3300017792 Bacteria 2795
209 Ga0163161_10133657 3300017792 Bacteria 1873
210 Ga0206351_10021820 3300020077 Bacteria 1498
211 Ga0206350_10473795 3300020080 Bacteria 905
212 Ga0154015_1180754 3300020610 Bacteria 31444
213 Ga0214543_1000015 3300021327 Bacteria 305679
214 Ga0213872_10008110 3300021361 Bacteria 5097
215 Ga0224712_10138994 3300022467 Bacteria 1067
216 Ga0209674_117304 3300025226 Bacteria 588
217 Ga0209672_100012 3300025228 Bacteria 795742
218 Ga0209672_103798 3300025228 Bacteria 2996
219 Ga0209147_100007 3300025229 Bacteria 795684
220 Ga0209563_100397 3300025230 Bacteria 15582
221 Ga0209258_100014 3300025242 Bacteria 720132
222 Ga0209258_106615 3300025242 Bacteria 1796
223 Ga0207425_1022788 3300025245 Bacteria 1316
224 Ga0209646_1000023 3300025246 Bacteria 441100
225 Ga0209026_1035601 3300025250 Bacteria 730
226 Ga0209677_101933 3300025253 Bacteria 8281
227 Ga0209148_1000008 3300025254 Bacteria 1504371
228 Ga0209148_1003469 3300025254 Bacteria 4353
229 Ga0209759_1000178 3300025256 Bacteria 105147
230 Ga0209759_1002236 3300025256 Bacteria 8826
231 Ga0209129_1029037 3300025258 Bacteria 935
232 Ga0209565_1033768 3300025263 Bacteria 984
233 Ga0209455_1000002 3300025272 Bacteria 1505459
234 Ga0209455_1000566 3300025272 Bacteria 24635
235 Ga0209455_1000856 3300025272 Bacteria 16265
236 Ga0209455_1040195 3300025272 Bacteria 717
237 Ga0209673_1066881 3300025273 Bacteria 872
238 Ga0209025_1000283 3300025294 Bacteria 114855
239 Ga0209758_1000007 3300025297 Bacteria 1270410
240 Ga0209256_1024493 3300025299 Bacteria 1776
241 Ga0207426_1075160 3300025302 Bacteria 930
242 Ga0207656_10000454 3300025321 Bacteria 13714
243 Ga0207696_1028734 3300025711 Bacteria 1703
244 Ga0207655_1001387 3300025728 Bacteria 22630
245 Ga0207682_10536099 3300025893 Bacteria 554
246 Ga0207688_10210177 3300025901 Bacteria 1169
247 Ga0207680_10435786 3300025903 Bacteria 929
248 Ga0207647_10000941 3300025904 Bacteria 22528
249 Ga0207647_10006656 3300025904 Bacteria 8398
250 Ga0207647_10042324 3300025904 Bacteria 2858
251 Ga0207647_10063441 3300025904 Bacteria 2247
252 Ga0207647_10067352 3300025904 Bacteria 2170
253 Ga0207705_10000021 3300025909 Bacteria 309436
254 Ga0207705_10070816 3300025909 Bacteria 2527
255 Ga0207705_10131055 3300025909 Bacteria 1866
256 Ga0207705_10735449 3300025909 Bacteria 766
257 Ga0207705_11073686 3300025909 Bacteria 621
258 Ga0207654_10838580 3300025911 Bacteria 665
259 Ga0207695_10429123 3300025913 Bacteria 1206
260 Ga0207695_10978525 3300025913 Bacteria 726
261 Ga0207695_11506689 3300025913 Bacteria 553
262 Ga0207671_10026530 3300025914 Bacteria 4339
263 Ga0207671_10102853 3300025914 Bacteria 2166
264 Ga0207671_10692746 3300025914 Bacteria 810
265 Ga0207657_10000019 3300025919 Bacteria 159785
266 Ga0207649_10002825 3300025920 Bacteria 9571
267 Ga0207649_10169288 3300025920 Bacteria 1520
268 Ga0207652_10676801 3300025921 Bacteria 922
269 Ga0207694_10003984 3300025924 Bacteria 11643
270 Ga0207694_10066731 3300025924 Bacteria 2807
271 Ga0207659_11907505 3300025926 Bacteria 503
272 Ga0207644_10778748 3300025931 Bacteria 800
273 Ga0207690_10000028 3300025932 Bacteria 160775
274 Ga0207690_10400851 3300025932 Bacteria 1094
275 Ga0207706_10002199 3300025933 Bacteria 19005
276 Ga0207706_10446267 3300025933 Bacteria 1119
277 Ga0207709_10000005 3300025935 Bacteria 806813
278 Ga0207669_10000222 3300025937 Bacteria 25932
279 Ga0207669_10088491 3300025937 Bacteria 2008
280 Ga0207711_10008080 3300025941 Bacteria 8808
281 Ga0207711_11030039 3300025941 Bacteria 763
282 Ga0207689_11026426 3300025942 Bacteria 696
283 Ga0207679_10117683 3300025945 Bacteria 2109
284 Ga0207679_10185217 3300025945 Bacteria 1726
285 Ga0207667_10007455 3300025949 Bacteria 13143
286 Ga0207667_10022597 3300025949 Bacteria 6941
287 Ga0207667_10023782 3300025949 Bacteria 6743
288 Ga0207667_10205733 3300025949 Bacteria 2018
289 Ga0207667_10397640 3300025949 Bacteria 1403
290 Ga0207667_11213207 3300025949 Bacteria 734
291 Ga0207712_10344146 3300025961 Bacteria 1237
292 Ga0207712_10525035 3300025961 Bacteria 1015
293 Ga0207668_11638405 3300025972 Bacteria 581
294 Ga0207640_10000065 3300025981 Bacteria 86695
295 Ga0207640_10092457 3300025981 Bacteria 2098
296 Ga0207658_10209300 3300025986 Bacteria 1633
297 Ga0207703_11765182 3300026035 Bacteria 595
298 Ga0207639_10000519 3300026041 Bacteria 26590
299 Ga0207678_10001003 3300026067 Bacteria 25716
300 Ga0207678_10024511 3300026067 Bacteria 5270
301 Ga0207678_10229421 3300026067 Bacteria 1590
302 Ga0207702_10062377 3300026078 Bacteria 3183
303 Ga0207648_10297915 3300026089 Bacteria 1446
304 Ga0207674_10001593 3300026116 Bacteria 29207
305 Ga0207674_10186835 3300026116 Bacteria 2022
306 Ga0207674_11835306 3300026116 Bacteria 573
307 Ga0207675_100250745 3300026118 Bacteria 1713
308 Ga0207683_10004368 3300026121 Bacteria 12211
309 Ga0207698_10000357 3300026142 Bacteria 26870
310 Ga0207698_11049680 3300026142 Bacteria 827
311 Ga0209281_1026850 3300027111 Bacteria 1060
312 Ga0209371_1037884 3300027312 Bacteria 998
313 Ga0268266_10468311 3300028379 Bacteria 1200
314 Ga0268266_11357776 3300028379 Bacteria 686
315 Ga0268266_12018031 3300028379 Bacteria 550
316 Ga0268264_11395650 3300028381 Bacteria 711
317 Ga0307517_10052336 3300028786 Bacteria 4095
318 Ga0307515_10006558 3300028794 Bacteria 23248
319 Ga0307515_10253862 3300028794 Bacteria 1506
320 Ga0265338_10000023 3300028800 Bacteria 300147
321 Ga0265338_10001259 3300028800 Bacteria 41748
322 Ga0268256_1022311 3300030500 Bacteria 1663
323 Ga0307508_10445132 3300031616 Bacteria 888
324 Ga0307516_10252620 3300031730 Bacteria 1457
325 Ga0307413_12172044 3300031824 Bacteria 503
326 Ga0395899_0239091 3300037312 Bacteria 1250
327 Ga0395899_0650477 3300037312 Bacteria 666
328 Ga0395900_0010958 3300037418 Bacteria 9270
329 Ga0395900_0094687 3300037418 Bacteria 3068
330 Ga0395900_0207832 3300037418 Bacteria 1978
331 Ga0395900_0883880 3300037418 Bacteria 818
332 Ga0395900_1556678 3300037418 Bacteria 573
333 Ga0395898_0002757 3300037466 Bacteria 20242
334 Ga0395898_0051147 3300037466 Bacteria 4041
335 Ga0395898_0241069 3300037466 Bacteria 1724
336 Ga0395898_0259935 3300037466 Bacteria 1656
337 Ga0395905_0459497 3300037471 Bacteria 1171
338 Ga0395905_0588007 3300037471 Bacteria 1015
339 Ga0395901_0027759 3300038443 Bacteria 5820
340 Ga0395901_0175982 3300038443 Bacteria 2244
341 Ga0395901_0218079 3300038443 Bacteria 1994
342 Ga0395901_0534470 3300038443 Bacteria 1190
343 Ga0395901_0732088 3300038443 Bacteria 983
344 Ga0436361_0076881 3300039447 Bacteria 560
345 Ga0436361_0485655 3300039447 Bacteria 4330
346 Ga0451795_0601512 3300041456 Bacteria 2088
347 Ga0451800_1000663 3300041459 Bacteria 822
348 Ga0451802_1942149 3300041460 Bacteria 600
349 Ga0451806_569546 3300041462 Bacteria 516
350 Ga0451804_0760028 3300041463 Bacteria 741
351 Ga0451833_0389902 3300041491 Bacteria 880
352 Ga0451837_0579300 3300041494 Bacteria 562
353 Ga0451841_0754232 3300041498 Bacteria 619
354 Ga0439431_0206232 3300041997 Bacteria 574
355 Ga0439433_0100713 3300041999 Bacteria 717
356 Ga0439449_0023929 3300042007 Bacteria 2284
357 Ga0439450_139352 3300042008 Bacteria 632
358 Ga0439455_0024469 3300042012 Bacteria 1461
359 Ga0439458_0107000 3300042157 Bacteria 729
360 Ga0466972_0380509 3300044658 Unclassified 661
361 Ga0466965_0465760 3300044683 Bacteria 705
362 Ga0466965_0521090 3300044683 Unclassified 668
363 Ga0466966_0939872 3300044684 Unclassified 521
364 Ga0466961_0002467 3300044693 Bacteria 11472
365 Ga0466964_0049769 3300044706 Bacteria 1716
366 Ga0466964_0346058 3300044706 Bacteria 762
367 Ga0453684_0000077 3300044712 Bacteria 435536
368 Ga0466971_0728255 3300044719 Unclassified 500
369 Ga0466968_0360668 3300044735 Unclassified 707
370 Ga0466970_0094071 3300044765 Bacteria 1628
371 Ga0466957_0011555 3300044842 Bacteria 5099
372 Ga0466959_0019920 3300045049 Bacteria 4938
373 Ga0466959_0223194 3300045049 Bacteria 1306
374 Ga0466958_0406309 3300045836 Bacteria 879
375 Ga0466958_0506377 3300045836 Bacteria 783
376 Ga0466967_0281706 3300045976 Bacteria 1595
377 Ga0495617_051801 3300046452 Bacteria 1364
378 Ga0495617_153676 3300046452 Bacteria 731
379 Ga0495629_0054526 3300046459 Bacteria 2796
380 Ga0495638_0081041 3300046460 Bacteria 1971
381 Ga0495638_0243614 3300046460 Bacteria 994
382 Ga0495650_0000015 3300046471 Bacteria 557595
383 Ga0495650_0000193 3300046471 Bacteria 131834
384 Ga0495650_0007364 3300046471 Bacteria 6631
385 Ga0495650_0037862 3300046471 Bacteria 2094
386 Ga0495650_0094521 3300046471 Bacteria 1131
387 Ga0495650_0131825 3300046471 Bacteria 911
388 Ga0495580_0001051 3300046472 Bacteria 24258
389 Ga0495584_0020121 3300046491 Bacteria 3391
390 Ga0495585_0030891 3300046492 Bacteria 3045
391 Ga0495585_0306413 3300046492 Bacteria 780
392 Ga0495596_0007300 3300046500 Bacteria 4995
393 Ga0495596_0108004 3300046500 Bacteria 1080
394 Ga0495607_0023525 3300046501 Bacteria 3856
395 Ga0495583_0018703 3300046506 Bacteria 3641
396 Ga0495583_0055168 3300046506 Bacteria 1796
397 Ga0495583_0145199 3300046506 Bacteria 986
398 Ga0495606_0000084 3300046507 Bacteria 158428
399 Ga0495606_0005424 3300046507 Bacteria 12220
400 Ga0495606_0050421 3300046507 Bacteria 2723
401 Ga0495606_0051882 3300046507 Bacteria 2672
402 Ga0495606_0146023 3300046507 Bacteria 1393
403 Ga0495606_0163865 3300046507 Bacteria 1295
404 Ga0495606_0256596 3300046507 Bacteria 967
405 Ga0495606_0373838 3300046507 Bacteria 749
406 Ga0495610_0000734 3300046512 Bacteria 31036
407 Ga0495610_0005527 3300046512 Bacteria 8954
408 Ga0495610_0014792 3300046512 Bacteria 4567
409 Ga0495610_0085008 3300046512 Bacteria 1445
410 Ga0495616_0138571 3300046513 Bacteria 1110
411 Ga0495616_0253081 3300046513 Bacteria 756
412 Ga0495628_0325463 3300046516 Bacteria 1134
413 Ga0495631_0095376 3300046518 Bacteria 1281
414 Ga0495631_0353555 3300046518 Bacteria 625
415 Ga0495637_0038501 3300046520 Bacteria 2070
416 Ga0495637_0088811 3300046520 Bacteria 1222
417 Ga0495637_0157753 3300046520 Bacteria 853
418 Ga0495643_0000022 3300046522 Bacteria 289691
419 Ga0495643_0012099 3300046522 Bacteria 5216
420 Ga0495643_0036849 3300046522 Bacteria 2685
421 Ga0495643_0100493 3300046522 Bacteria 1483
422 Ga0495643_0287750 3300046522 Bacteria 753
423 Ga0495644_0021790 3300046523 Bacteria 2443
424 Ga0495648_0000923 3300046524 Bacteria 30591
425 Ga0495648_0004643 3300046524 Bacteria 11658
426 Ga0495648_0022483 3300046524 Bacteria 4339
427 Ga0495648_0028087 3300046524 Bacteria 3751
428 Ga0495648_0085957 3300046524 Bacteria 1775
429 Ga0495648_0317951 3300046524 Bacteria 723
430 Ga0495663_0033194 3300046525 Bacteria 1540
431 Ga0495642_0000616 3300046528 Bacteria 17924
432 Ga0495642_0049088 3300046528 Bacteria 1733
433 Ga0495654_0016464 3300046530 Bacteria 3908
434 Ga0495609_0271481 3300046538 Bacteria 695
435 Ga0495597_0000149 3300046542 Bacteria 61717
436 Ga0495597_0000302 3300046542 Bacteria 44243
437 Ga0495597_0006279 3300046542 Bacteria 6158
438 Ga0495597_0009473 3300046542 Bacteria 4807
439 Ga0495633_0000813 3300046558 Bacteria 27626
440 Ga0495633_0005592 3300046558 Bacteria 7627
441 Ga0495633_0139941 3300046558 Bacteria 1119
442 Ga0495633_0572187 3300046558 Bacteria 508
443 Ga0495668_0297278 3300046616 Bacteria 885
444 Ga0495668_0372515 3300046616 Bacteria 784
445 Ga0495611_0135002 3300046648 Bacteria 1152
446 Ga0495625_0012563 3300046660 Bacteria 6855
447 Ga0495625_0046683 3300046660 Bacteria 3124
448 Ga0495625_0070936 3300046660 Bacteria 2446
449 Ga0495625_0098977 3300046660 Bacteria 2005
450 Ga0495625_0108543 3300046660 Bacteria 1899
451 Ga0495625_0728162 3300046660 Bacteria 583
452 Ga0495659_0000197 3300046664 Bacteria 26421
453 Ga0495669_0016648 3300046684 Plasmid 3150
454 Ga0495670_0232459 3300046691 Bacteria 980
455 Ga0495671_0000612 3300046692 Bacteria 26137
456 Ga0495671_0024342 3300046692 Bacteria 3154
457 Ga0495671_0056790 3300046692 Bacteria 1938
458 Ga0495649_0005585 3300046694 Bacteria 7959
459 Ga0495649_0037173 3300046694 Bacteria 2673
460 Ga0495649_0067139 3300046694 Bacteria 1924
461 Ga0495649_0109591 3300046694 Bacteria 1464
462 Ga0495649_0363824 3300046694 Bacteria 729
463 Ga0495660_0456015 3300046810 Bacteria 552
464 Ga0495581_0193707 3300047315 Bacteria 1189
465 Ga0495636_0010162 3300047318 Bacteria 3712
466 Ga0495672_0000325 3300047320 Bacteria 63353
467 Ga0495672_0000364 3300047320 Bacteria 57893
468 Ga0495672_0000501 3300047320 Bacteria 45072
469 Ga0495672_0001049 3300047320 Bacteria 28219
470 Ga0495672_0348603 3300047320 Bacteria 688
471 Ga0495683_0051518 3300047323 Bacteria 2057
472 Ga0495687_012939 3300047443 Bacteria 4383
473 Ga0495687_203931 3300047443 Bacteria 625
474 Ga0495677_0024700 3300047445 Bacteria 2180
475 Ga0495677_0057593 3300047445 Bacteria 1437
476 Ga0495673_0000109 3300047469 Bacteria 166877
477 Ga0495673_0205000 3300047469 Bacteria 736
478 Ga0495681_0016089 3300047470 Bacteria 4210
479 Ga0495681_0172865 3300047470 Bacteria 892
480 Ga0495686_0000101 3300047472 Bacteria 178238
481 Ga0495614_0177950 3300048089 Bacteria 956
482 Ga0495626_0005743 3300048091 Bacteria 7167
483 Ga0496100_0268316 3300048903 Bacteria 1268
484 Ga0496100_0534773 3300048903 Bacteria 905
485 Ga0496101_0106433 3300048904 Bacteria 2106
486 Ga0496101_0349128 3300048904 Bacteria 1162
487 Ga0496101_1204057 3300048904 Bacteria 593
488 Ga0496102_0002580 3300048905 Bacteria 15450
489 Ga0496102_0528058 3300048905 Bacteria 1103
490 Ga0496103_0000055 3300048906 Bacteria 143870
491 Ga0496104_0045333 3300048907 Bacteria 4135
492 Ga0496104_0047175 3300048907 Bacteria 4059
493 Ga0496104_1166766 3300048907 Bacteria 673
494 Ga0496105_0000312 3300048908 Bacteria 31860
495 Ga0496105_0007690 3300048908 Bacteria 8357
496 Ga0496105_0119568 3300048908 Bacteria 2173
497 Ga0496105_0339469 3300048908 Bacteria 1201
498 Ga0496106_0422606 3300048909 Bacteria 1071
499 Ga0496110_0080950 3300048913 Bacteria 2895
500 Ga0496111_0020612 3300048914 Bacteria 4591
501 Ga0496112_0312124 3300048915 Bacteria 1517
502 Ga0496113_0057875 3300048916 Bacteria 2915
503 Ga0496113_0491568 3300048916 Bacteria 985
504 Ga0496114_0009646 3300048917 Bacteria 7667
505 Ga0496115_0004364 3300048918 Bacteria 10237
506 Ga0496115_0112966 3300048918 Bacteria 2232
507 Ga0496116_0020028 3300048919 Bacteria 5097
508 Ga0496116_0122599 3300048919 Bacteria 1500
509 Ga0496117_0000549 3300048920 Bacteria 61657
510 Ga0496118_0000552 3300048921 Bacteria 61677
511 Ga0496118_0165361 3300048921 Bacteria 1360
512 Ga0496118_0169619 3300048921 Bacteria 1335
513 Ga0496119_0014198 3300048922 Bacteria 6257
514 Ga0496120_0068375 3300048923 Bacteria 1960
515 Ga0496121_0014836 3300048924 Bacteria 8223
516 Ga0496121_0164364 3300048924 Bacteria 1619
517 Ga0496122_0043037 3300048925 Bacteria 3543
518 Ga0496122_0309594 3300048925 Bacteria 846
519 Ga0496123_0031086 3300048926 Bacteria 3892
520 Ga0496123_0156595 3300048926 Bacteria 1220
521 Ga0496123_0225966 3300048926 Bacteria 940
522 Ga0496123_0470952 3300048926 Bacteria 555
523 Ga0496124_0000585 3300048927 Bacteria 61469
524 Ga0496124_0004757 3300048927 Bacteria 15634
525 Ga0496124_0102521 3300048927 Bacteria 2315
526 Ga0496124_0234341 3300048927 Bacteria 1370
527 Ga0496125_0004698 3300048928 Bacteria 15566
528 Ga0496125_0006119 3300048928 Bacteria 13127
529 Ga0496125_0369737 3300048928 Bacteria 849
530 Ga0496126_0009285 3300048929 Bacteria 10476
531 Ga0496126_0233254 3300048929 Bacteria 1541
532 Ga0496126_0295151 3300048929 Bacteria 1339
533 Ga0496126_1016119 3300048929 Bacteria 621
534 Ga0496126_1403280 3300048929 Bacteria 504
535 Ga0495678_000103 3300049459 Bacteria 103891
536 Ga0495682_0039775 3300049460 Bacteria 1726
537 Ga0495682_0128364 3300049460 Bacteria 907
538 Ga0495682_0183882 3300049460 Bacteria 742
539 Ga0495682_0191133 3300049460 Bacteria 727
540 Ga0501031_0079328 3300049568 Bacteria 2139
541 Ga0501031_0102170 3300049568 Bacteria 1870
542 Ga0501031_1037589 3300049568 Bacteria 524
543 Ga0501032_0019135 3300049569 Bacteria 4791
544 Ga0501033_0007594 3300049570 Bacteria 8431
545 Ga0501033_0036341 3300049570 Bacteria 3691
546 Ga0501033_0409778 3300049570 Unclassified 945
547 Ga0501034_0071540 3300049571 Bacteria 3478
548 Ga0501034_0210446 3300049571 Bacteria 1900
549 Ga0501034_0476579 3300049571 Bacteria 1163
550 Ga0501034_0712084 3300049571 Unclassified 902
551 Ga0501036_0191909 3300049572 Bacteria 1718
552 Ga0501037_0042094 3300049573 Bacteria 3357
553 Ga0501037_0136352 3300049573 Bacteria 1758
554 Ga0501038_0086638 3300049574 Bacteria 2631
555 Ga0501038_0396734 3300049574 Bacteria 1068
556 Ga0501043_0112910 3300049579 Unclassified 2134
557 Ga0501046_0611996 3300049580 Bacteria 772
558 Ga0501047_0001719 3300049581 Bacteria 21291
559 Ga0501047_0108940 3300049581 Bacteria 2652
560 Ga0501080_0370053 3300049742 Bacteria 1292
561 Ga0501035_0014272 3300049822 Bacteria 7333
562 Ga0501035_0100203 3300049822 Bacteria 2543
563 Ga0501035_0219819 3300049822 Bacteria 1622
564 Ga0501035_0498054 3300049822 Bacteria 1003
565 Ga0501044_0000759 3300049823 Bacteria 39033
566 Ga0501044_0012342 3300049823 Bacteria 9249
567 Ga0501044_0038454 3300049823 Bacteria 4997
568 Ga0501044_0154261 3300049823 Bacteria 2277
569 nmdc:mga03683_173575_c1 3300050489 Bacteria 980
570 nmdc:mga0k408_178985_c1 3300050493 Bacteria 1264
571 nmdc:mga0k408_72993_c1 3300050493 Bacteria 1565
572 nmdc:mga07m45_689296_c1 3300050496 Bacteria 588
573 Ga0500644_0018207 3300053088 Bacteria 2053
574 Ga0500644_0459925 3300053088 Bacteria 558
575 Ga0500647_0086843 3300053091 Bacteria 1499
576 Ga0500566_0203076 3300053094 Bacteria 999
577 Ga0500594_0012219 3300053118 Bacteria 2019
578 Ga0500618_001793 3300053125 Bacteria 9069
579 Ga0500618_014036 3300053125 Bacteria 2058
580 Ga0500621_247680 3300053126 Bacteria 600
581 Ga0500642_0000731 3300053130 Bacteria 9673
582 Ga0500655_002387 3300053133 Bacteria 3439
583 Ga0500586_000914 3300053145 Bacteria 6075
584 Ga0500604_0010999 3300053151 Bacteria 2426
585 Ga0500622_0252891 3300053156 Bacteria 773
586 Ga0500636_0166188 3300053177 Bacteria 1198
587 Ga0500645_000506 3300053730 Bacteria 26243
588 Ga0500645_020596 3300053730 Bacteria 2043
589 Ga0500596_000856 3300053735 Bacteria 6052
590 Ga0500661_043388 3300055283 Bacteria 798
591 Ga0587128_114121 3300059630 Bacteria 581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001915 JGI24741J21665_1012780 JGI24741J21665_10127802 63
2 3300001979 JGI24740J21852_10000687 JGI24740J21852_1000068710 63
3 3300001979 JGI24740J21852_10058749 JGI24740J21852_100587492 63
4 3300001989 JGI24739J22299_10001673 JGI24739J22299_100016739 63
5 3300001990 JGI24737J22298_10001659 JGI24737J22298_100016595 63
6 3300001990 JGI24737J22298_10154741 JGI24737J22298_101547412 63
7 3300002067 JGI24735J21928_10001615 JGI24735J21928_100016158 63
8 3300002067 JGI24735J21928_10006876 JGI24735J21928_100068761 63
9 3300002075 JGI24738J21930_10001024 JGI24738J21930_100010245 63
10 3300002075 JGI24738J21930_10004804 JGI24738J21930_100048045 63
11 3300002077 JGI24744J21845_10001801 JGI24744J21845_100018012 63
12 3300002738 JGI25154J39366_1001108 JGI25154J39366_10011082 63
13 3300003187 JGI25151J46595_10005111 JGI25151J46595_100051113 63
14 3300003322 rootL2_10000610 rootL2_100006106 63
15 3300003322 rootL2_10110713 rootL2_101107134 63
16 3300003323 rootH1_10015466 rootH1_100154666 63
17 3300003567 Ga0006554J51385_1047400 Ga0006554J51385_10474001 63
18 3300003758 Ga0055532_1000400 Ga0055532_10004002 63
19 3300003759 Ga0055525_1000654 Ga0055525_10006548 63
20 3300003760 Ga0055527_1000274 Ga0055527_10002743 63
21 3300003761 Ga0055535_1000569 Ga0055535_100056923 63
22 3300003762 Ga0055542_1009120 Ga0055542_10091201 63
23 3300003762 Ga0055542_1012678 Ga0055542_10126782 63
24 3300003762 Ga0055542_1022193 Ga0055542_10221931 63
25 3300003763 Ga0055529_1000970 Ga0055529_100097014 63
26 3300003763 Ga0055529_1005735 Ga0055529_10057353 63
27 3300005327 Ga0070658_10000136 Ga0070658_1000013614 63
28 3300005327 Ga0070658_10264846 Ga0070658_102648462 63
29 3300005327 Ga0070658_10274731 Ga0070658_102747312 63
30 3300005328 Ga0070676_10002760 Ga0070676_100027606 63
31 3300005328 Ga0070676_10011676 Ga0070676_100116764 63
32 3300005334 Ga0068869_100000200 Ga0068869_10000020014 63
33 3300005338 Ga0068868_100000049 Ga0068868_10000004972 63
34 3300005339 Ga0070660_100000011 Ga0070660_10000001144 63
35 3300005339 Ga0070660_101073323 Ga0070660_1010733231 63
36 3300005344 Ga0070661_100004782 Ga0070661_1000047826 63
37 3300005344 Ga0070661_100268469 Ga0070661_1002684693 63
38 3300005344 Ga0070661_101021381 Ga0070661_1010213812 63
39 3300005344 Ga0070661_101179706 Ga0070661_1011797061 63
40 3300005354 Ga0070675_100015819 Ga0070675_1000158192 63
41 3300005354 Ga0070675_100428834 Ga0070675_1004288343 63
42 3300005364 Ga0070673_100000006 Ga0070673_100000006136 63
43 3300005364 Ga0070673_100352037 Ga0070673_1003520372 63
44 3300005366 Ga0070659_100000239 Ga0070659_10000023927 63
45 3300005366 Ga0070659_100083808 Ga0070659_1000838085 63
46 3300005366 Ga0070659_100496015 Ga0070659_1004960152 63
47 3300005436 Ga0070713_101290888 Ga0070713_1012908881 63
48 3300005455 Ga0070663_100000291 Ga0070663_10000029119 63
49 3300005455 Ga0070663_100036404 Ga0070663_1000364043 63
50 3300005455 Ga0070663_100226817 Ga0070663_1002268172 63
51 3300005457 Ga0070662_100000574 Ga0070662_1000005747 63
52 3300005457 Ga0070662_101879111 Ga0070662_1018791112 63
53 3300005459 Ga0068867_100000001 Ga0068867_100000001381 63
54 3300005530 Ga0070679_101051982 Ga0070679_1010519821 63
55 3300005535 Ga0070684_102301579 Ga0070684_1023015791 63
56 3300005539 Ga0068853_100000475 Ga0068853_10000047513 63
57 3300005539 Ga0068853_100006265 Ga0068853_10000626511 63
58 3300005539 Ga0068853_100249883 Ga0068853_1002498832 63
59 3300005539 Ga0068853_100911220 Ga0068853_1009112202 63
60 3300005543 Ga0070672_100324522 Ga0070672_1003245224 63
61 3300005543 Ga0070672_100846330 Ga0070672_1008463302 63
62 3300005548 Ga0070665_100424242 Ga0070665_1004242421 63
63 3300005548 Ga0070665_102213378 Ga0070665_1022133782 63
64 3300005563 Ga0068855_100001542 Ga0068855_1000015424 63
65 3300005563 Ga0068855_100002263 Ga0068855_1000022633 63
66 3300005563 Ga0068855_100045914 Ga0068855_1000459148 63
67 3300005563 Ga0068855_100711736 Ga0068855_1007117361 63
68 3300005563 Ga0068855_101188741 Ga0068855_1011887412 63
69 3300005563 Ga0068855_102330115 Ga0068855_1023301152 63
70 3300005564 Ga0070664_100008244 Ga0070664_1000082444 63
71 3300005564 Ga0070664_100121199 Ga0070664_1001211992 63
72 3300005564 Ga0070664_101487728 Ga0070664_1014877282 63
73 3300005577 Ga0068857_100000670 Ga0068857_1000006707 63
74 3300005577 Ga0068857_100510743 Ga0068857_1005107433 63
75 3300005577 Ga0068857_101261950 Ga0068857_1012619502 63
76 3300005578 Ga0068854_100000036 Ga0068854_10000003691 63
77 3300005578 Ga0068854_100002610 Ga0068854_1000026107 63
78 3300005578 Ga0068854_100003389 Ga0068854_10000338910 63
79 3300005614 Ga0068856_100083806 Ga0068856_1000838064 63
80 3300005614 Ga0068856_100490594 Ga0068856_1004905942 63
81 3300005614 Ga0068856_100979879 Ga0068856_1009798792 63
82 3300005616 Ga0068852_100000450 Ga0068852_10000045023 63
83 3300005616 Ga0068852_100076454 Ga0068852_1000764542 63
84 3300005616 Ga0068852_100124182 Ga0068852_1001241821 63
85 3300005616 Ga0068852_102267076 Ga0068852_1022670761 63
86 3300005834 Ga0068851_10001264 Ga0068851_1000126411 63
87 3300005834 Ga0068851_10024314 Ga0068851_100243143 63
88 3300005842 Ga0068858_100080012 Ga0068858_1000800122 63
89 3300006051 Ga0075364_10010430 Ga0075364_100104306 63
90 3300006177 Ga0075362_10081612 Ga0075362_100816122 63
91 3300006195 Ga0075366_10146656 Ga0075366_101466562 63
92 3300006237 Ga0097621_100001076 Ga0097621_10000107629 63
93 3300006358 Ga0068871_100004490 Ga0068871_10000449012 63
94 3300006881 Ga0068865_100000003 Ga0068865_100000003212 63
95 3300006946 Ga0079104_1054502 Ga0079104_10545022 63
96 3300009036 Ga0105244_10000513 Ga0105244_1000051333 63
97 3300009036 Ga0105244_10004237 Ga0105244_100042378 63
98 3300009092 Ga0105250_10008145 Ga0105250_100081455 63
99 3300009093 Ga0105240_10036197 Ga0105240_100361977 63
100 3300009093 Ga0105240_10091518 Ga0105240_100915186 63
101 3300009093 Ga0105240_10619704 Ga0105240_106197042 63
102 3300009093 Ga0105240_10910164 Ga0105240_109101642 63
103 3300009093 Ga0105240_10918266 Ga0105240_109182662 63
104 3300009093 Ga0105240_11232756 Ga0105240_112327562 63
105 3300009093 Ga0105240_11401393 Ga0105240_114013932 63
106 3300009093 Ga0105240_12415232 Ga0105240_124152322 63
107 3300009093 Ga0105240_12687615 Ga0105240_126876151 63
108 3300009098 Ga0105245_10000113 Ga0105245_1000011364 63
109 3300009148 Ga0105243_10000373 Ga0105243_1000037357 63
110 3300009174 Ga0105241_10113361 Ga0105241_101133611 63
111 3300009176 Ga0105242_10000165 Ga0105242_1000016517 63
112 3300009177 Ga0105248_10011752 Ga0105248_100117526 63
113 3300009177 Ga0105248_10616256 Ga0105248_106162563 63
114 3300009177 Ga0105248_10731518 Ga0105248_107315182 63
115 3300009545 Ga0105237_10132938 Ga0105237_101329382 63
116 3300009545 Ga0105237_10142332 Ga0105237_101423322 63
117 3300009545 Ga0105237_10296548 Ga0105237_102965483 63
118 3300009545 Ga0105237_10311286 Ga0105237_103112863 63
119 3300009545 Ga0105237_10994367 Ga0105237_109943672 63
120 3300009551 Ga0105238_10001089 Ga0105238_1000108915 63
121 3300009551 Ga0105238_10058421 Ga0105238_100584215 63
122 3300009551 Ga0105238_10388094 Ga0105238_103880942 63
123 3300009553 Ga0105249_10014083 Ga0105249_100140833 63
124 3300009553 Ga0105249_10023929 Ga0105249_100239292 63
125 3300010375 Ga0105239_10175331 Ga0105239_101753313 63
126 3300010375 Ga0105239_10311482 Ga0105239_103114824 63
127 3300010375 Ga0105239_13047297 Ga0105239_130472971 63
128 3300011119 Ga0105246_10044455 Ga0105246_100444551 63
129 3300013100 Ga0157373_10000025 Ga0157373_10000025111 63
130 3300013100 Ga0157373_10005064 Ga0157373_1000506411 63
131 3300013100 Ga0157373_10024803 Ga0157373_100248033 63
132 3300013100 Ga0157373_11143501 Ga0157373_111435012 63
133 3300013102 Ga0157371_10001141 Ga0157371_1000114128 63
134 3300013102 Ga0157371_10160624 Ga0157371_101606242 63
135 3300013104 Ga0157370_10000017 Ga0157370_10000017127 63
136 3300013104 Ga0157370_10000027 Ga0157370_10000027111 63
137 3300013104 Ga0157370_10003021 Ga0157370_100030217 63
138 3300013104 Ga0157370_10005061 Ga0157370_1000506112 63
139 3300013104 Ga0157370_10062642 Ga0157370_100626424 63
140 3300013104 Ga0157370_10239905 Ga0157370_102399052 63
141 3300013104 Ga0157370_10268427 Ga0157370_102684273 63
142 3300013104 Ga0157370_11607996 Ga0157370_116079962 63
143 3300013105 Ga0157369_10001890 Ga0157369_1000189022 63
144 3300013105 Ga0157369_10091327 Ga0157369_100913273 63
145 3300013105 Ga0157369_10178619 Ga0157369_101786192 63
146 3300013105 Ga0157369_10188586 Ga0157369_101885863 63
147 3300013105 Ga0157369_10546708 Ga0157369_105467083 63
148 3300013105 Ga0157369_11129362 Ga0157369_111293622 63
149 3300013296 Ga0157374_10002557 Ga0157374_1000255714 63
150 3300013296 Ga0157374_10437431 Ga0157374_104374313 63
151 3300013296 Ga0157374_10846121 Ga0157374_108461211 63
152 3300013297 Ga0157378_13106981 Ga0157378_131069812 63
153 3300013297 Ga0157378_13112564 Ga0157378_131125642 63
154 3300013307 Ga0157372_10003306 Ga0157372_1000330612 63
155 3300013307 Ga0157372_10004582 Ga0157372_1000458215 63
156 3300013307 Ga0157372_10236954 Ga0157372_102369543 63
157 3300013307 Ga0157372_10994519 Ga0157372_109945192 63
158 3300013307 Ga0157372_11830645 Ga0157372_118306451 63
159 3300013307 Ga0157372_11880988 Ga0157372_118809882 63
160 3300013307 Ga0157372_12799510 Ga0157372_127995101 63
161 3300013308 Ga0157375_10003162 Ga0157375_1000316210 63
162 3300014325 Ga0163163_11274601 Ga0163163_112746012 63
163 3300014497 Ga0182008_10022942 Ga0182008_100229425 63
164 3300014745 Ga0157377_10054158 Ga0157377_100541583 63
165 3300014969 Ga0157376_10000089 Ga0157376_1000008965 63
166 3300015261 Ga0182006_1000192 Ga0182006_100019231 63
167 3300015261 Ga0182006_1000511 Ga0182006_100051110 63
168 3300015261 Ga0182006_1014937 Ga0182006_10149371 63
169 3300015261 Ga0182006_1269873 Ga0182006_12698731 63
170 3300015262 Ga0182007_10000037 Ga0182007_1000003794 63
171 3300015262 Ga0182007_10048499 Ga0182007_100484992 63
172 3300015262 Ga0182007_10059194 Ga0182007_100591942 63
173 3300015265 Ga0182005_1000008 Ga0182005_1000008206 63
174 3300015265 Ga0182005_1000021 Ga0182005_1000021240 63
175 3300015265 Ga0182005_1107264 Ga0182005_11072643 63
176 3300017792 Ga0163161_10058762 Ga0163161_100587623 63
177 3300020077 Ga0206351_10021820 Ga0206351_100218202 63
178 3300020080 Ga0206350_10473795 Ga0206350_104737952 63
179 3300020610 Ga0154015_1180754 Ga0154015_118075431 63
180 3300021327 Ga0214543_1000015 Ga0214543_1000015221 63
181 3300021361 Ga0213872_10008110 Ga0213872_100081104 63
182 3300022467 Ga0224712_10138994 Ga0224712_101389942 63
183 3300025228 Ga0209672_100012 Ga0209672_100012636 63
184 3300025228 Ga0209672_103798 Ga0209672_1037983 63
185 3300025229 Ga0209147_100007 Ga0209147_100007135 63
186 3300025230 Ga0209563_100397 Ga0209563_10039720 63
187 3300025242 Ga0209258_100014 Ga0209258_100014568 63
188 3300025242 Ga0209258_106615 Ga0209258_1066152 63
189 3300025245 Ga0207425_1022788 Ga0207425_10227882 63
190 3300025246 Ga0209646_1000023 Ga0209646_10000233 63
191 3300025253 Ga0209677_101933 Ga0209677_10193317 63
192 3300025254 Ga0209148_1003469 Ga0209148_10034694 63
193 3300025256 Ga0209759_1000178 Ga0209759_10001789 63
194 3300025256 Ga0209759_1002236 Ga0209759_100223610 63
195 3300025258 Ga0209129_1029037 Ga0209129_10290371 63
196 3300025272 Ga0209455_1000566 Ga0209455_100056624 63
197 3300025272 Ga0209455_1000856 Ga0209455_10008564 63
198 3300025294 Ga0209025_1000283 Ga0209025_1000283115 63
199 3300025302 Ga0207426_1075160 Ga0207426_10751601 63
200 3300025321 Ga0207656_10000454 Ga0207656_1000045418 63
201 3300025711 Ga0207696_1028734 Ga0207696_10287341 63
202 3300025728 Ga0207655_1001387 Ga0207655_10013872 63
203 3300025904 Ga0207647_10000941 Ga0207647_100009419 63
204 3300025904 Ga0207647_10006656 Ga0207647_100066565 63
205 3300025904 Ga0207647_10042324 Ga0207647_100423242 63
206 3300025904 Ga0207647_10063441 Ga0207647_100634413 63
207 3300025909 Ga0207705_10000021 Ga0207705_10000021135 63
208 3300025909 Ga0207705_10070816 Ga0207705_100708164 63
209 3300025909 Ga0207705_10131055 Ga0207705_101310552 63
210 3300025909 Ga0207705_10735449 Ga0207705_107354492 63
211 3300025909 Ga0207705_11073686 Ga0207705_110736862 63
212 3300025911 Ga0207654_10838580 Ga0207654_108385801 63
213 3300025913 Ga0207695_10429123 Ga0207695_104291233 63
214 3300025913 Ga0207695_10978525 Ga0207695_109785252 63
215 3300025913 Ga0207695_11506689 Ga0207695_115066892 63
216 3300025914 Ga0207671_10026530 Ga0207671_100265302 63
217 3300025914 Ga0207671_10102853 Ga0207671_101028532 63
218 3300025914 Ga0207671_10692746 Ga0207671_106927462 63
219 3300025919 Ga0207657_10000019 Ga0207657_1000001943 63
220 3300025920 Ga0207649_10002825 Ga0207649_100028259 63
221 3300025920 Ga0207649_10169288 Ga0207649_101692881 63
222 3300025921 Ga0207652_10676801 Ga0207652_106768012 63
223 3300025924 Ga0207694_10003984 Ga0207694_1000398410 63
224 3300025924 Ga0207694_10066731 Ga0207694_100667313 63
225 3300025932 Ga0207690_10000028 Ga0207690_1000002843 63
226 3300025932 Ga0207690_10400851 Ga0207690_104008512 63
227 3300025933 Ga0207706_10002199 Ga0207706_1000219920 63
228 3300025941 Ga0207711_10008080 Ga0207711_1000808015 63
229 3300025941 Ga0207711_11030039 Ga0207711_110300392 63
230 3300025945 Ga0207679_10117683 Ga0207679_101176833 63
231 3300025945 Ga0207679_10185217 Ga0207679_101852172 63
232 3300025949 Ga0207667_10007455 Ga0207667_1000745511 63
233 3300025949 Ga0207667_10022597 Ga0207667_100225973 63
234 3300025949 Ga0207667_10023782 Ga0207667_100237822 63
235 3300025949 Ga0207667_10205733 Ga0207667_102057333 63
236 3300025949 Ga0207667_10397640 Ga0207667_103976402 63
237 3300025961 Ga0207712_10344146 Ga0207712_103441462 63
238 3300025961 Ga0207712_10525035 Ga0207712_105250352 63
239 3300025981 Ga0207640_10000065 Ga0207640_1000006522 63
240 3300025981 Ga0207640_10092457 Ga0207640_100924571 63
241 3300026035 Ga0207703_11765182 Ga0207703_117651822 63
242 3300026041 Ga0207639_10000519 Ga0207639_1000051923 63
243 3300026067 Ga0207678_10001003 Ga0207678_1000100310 63
244 3300026067 Ga0207678_10024511 Ga0207678_100245114 63
245 3300026067 Ga0207678_10229421 Ga0207678_102294212 63
246 3300026078 Ga0207702_10062377 Ga0207702_100623774 63
247 3300026116 Ga0207674_10001593 Ga0207674_1000159311 63
248 3300026116 Ga0207674_10186835 Ga0207674_101868354 63
249 3300026116 Ga0207674_11835306 Ga0207674_118353062 63
250 3300026142 Ga0207698_10000357 Ga0207698_1000035723 63
251 3300026142 Ga0207698_11049680 Ga0207698_110496802 63
252 3300027111 Ga0209281_1026850 Ga0209281_10268502 63
253 3300027312 Ga0209371_1037884 Ga0209371_10378842 63
254 3300028379 Ga0268266_11357776 Ga0268266_113577761 63
255 3300028379 Ga0268266_12018031 Ga0268266_120180312 63
256 3300028381 Ga0268264_11395650 Ga0268264_113956502 63
257 3300028794 Ga0307515_10006558 Ga0307515_1000655822 63
258 3300028794 Ga0307515_10253862 Ga0307515_102538622 63
259 3300028800 Ga0265338_10000023 Ga0265338_10000023119 63
260 3300028800 Ga0265338_10001259 Ga0265338_1000125913 63
261 3300030500 Ga0268256_1022311 Ga0268256_10223112 63
262 3300031616 Ga0307508_10445132 Ga0307508_104451322 63
263 3300031730 Ga0307516_10252620 Ga0307516_102526202 63
264 3300031824 Ga0307413_12172044 Ga0307413_121720441 63
265 3300037312 Ga0395899_0239091 Ga0395899_0239091_133_357 63
266 3300037312 Ga0395899_0650477 Ga0395899_0650477_346_540 63
267 3300037418 Ga0395900_0010958 Ga0395900_0010958_3057_3281 63
268 3300037418 Ga0395900_0094687 Ga0395900_0094687_1561_1755 63
269 3300037418 Ga0395900_0207832 Ga0395900_0207832_1668_1862 63
270 3300037418 Ga0395900_0883880 Ga0395900_0883880_197_391 63
271 3300037418 Ga0395900_1556678 Ga0395900_1556678_262_456 63
272 3300037466 Ga0395898_0002757 Ga0395898_0002757_10465_10659 63
273 3300037466 Ga0395898_0051147 Ga0395898_0051147_2599_2823 63
274 3300037466 Ga0395898_0241069 Ga0395898_0241069_965_1159 63
275 3300037466 Ga0395898_0259935 Ga0395898_0259935_886_1080 63
276 3300037471 Ga0395905_0459497 Ga0395905_0459497_222_446 63
277 3300038443 Ga0395901_0027759 Ga0395901_0027759_4066_4260 63
278 3300038443 Ga0395901_0175982 Ga0395901_0175982_239_433 63
279 3300038443 Ga0395901_0218079 Ga0395901_0218079_1562_1756 63
280 3300038443 Ga0395901_0732088 Ga0395901_0732088_248_472 63
281 3300039447 Ga0436361_0076881 Ga0436361_0076881_19_213 63
282 3300039447 Ga0436361_0485655 Ga0436361_0485655_1918_2115 63
283 3300041456 Ga0451795_0601512 Ga0451795_0601512_1844_2044 63
284 3300041459 Ga0451800_1000663 Ga0451800_1000663_189_389 63
285 3300041462 Ga0451806_569546 Ga0451806_569546_78_275 63
286 3300041463 Ga0451804_0760028 Ga0451804_0760028_354_554 63
287 3300041491 Ga0451833_0389902 Ga0451833_0389902_587_787 63
288 3300041494 Ga0451837_0579300 Ga0451837_0579300_69_269 63
289 3300041498 Ga0451841_0754232 Ga0451841_0754232_104_298 63
290 3300041997 Ga0439431_0206232 Ga0439431_0206232_355_555 63
291 3300041999 Ga0439433_0100713 Ga0439433_0100713_454_648 63
292 3300042007 Ga0439449_0023929 Ga0439449_0023929_1538_1732 63
293 3300042008 Ga0439450_139352 Ga0439450_139352_117_311 63
294 3300042012 Ga0439455_0024469 Ga0439455_0024469_1177_1371 63
295 3300042157 Ga0439458_0107000 Ga0439458_0107000_450_644 63
296 3300044658 Ga0466972_0380509 Ga0466972_0380509_219_413 63
297 3300044683 Ga0466965_0465760 Ga0466965_0465760_402_596 63
298 3300044683 Ga0466965_0521090 Ga0466965_0521090_235_429 63
299 3300044684 Ga0466966_0939872 Ga0466966_0939872_208_402 63
300 3300044693 Ga0466961_0002467 Ga0466961_0002467_6223_6417 63
301 3300044706 Ga0466964_0049769 Ga0466964_0049769_216_410 63
302 3300044706 Ga0466964_0346058 Ga0466964_0346058_541_735 63
303 3300044712 Ga0453684_0000077 Ga0453684_0000077_37316_37516 63
304 3300044719 Ga0466971_0728255 Ga0466971_0728255_178_372 63
305 3300044735 Ga0466968_0360668 Ga0466968_0360668_284_478 63
306 3300044765 Ga0466970_0094071 Ga0466970_0094071_401_595 63
307 3300044842 Ga0466957_0011555 Ga0466957_0011555_2986_3180 63
308 3300045049 Ga0466959_0019920 Ga0466959_0019920_4493_4687 63
309 3300045049 Ga0466959_0223194 Ga0466959_0223194_242_436 63
310 3300045836 Ga0466958_0406309 Ga0466958_0406309_430_624 63
311 3300045836 Ga0466958_0506377 Ga0466958_0506377_360_554 63
312 3300045976 Ga0466967_0281706 Ga0466967_0281706_421_615 63
313 3300046452 Ga0495617_051801 Ga0495617_051801_1006_1200 63
314 3300046452 Ga0495617_153676 Ga0495617_153676_430_624 63
315 3300046459 Ga0495629_0054526 Ga0495629_0054526_1506_1700 63
316 3300046460 Ga0495638_0081041 Ga0495638_0081041_498_695 63
317 3300046460 Ga0495638_0243614 Ga0495638_0243614_57_257 63
318 3300046471 Ga0495650_0000015 Ga0495650_0000015_375882_376076 63
319 3300046471 Ga0495650_0000193 Ga0495650_0000193_82619_82813 63
320 3300046471 Ga0495650_0007364 Ga0495650_0007364_872_1066 63
321 3300046471 Ga0495650_0037862 Ga0495650_0037862_1790_1984 63
322 3300046471 Ga0495650_0094521 Ga0495650_0094521_713_907 63
323 3300046471 Ga0495650_0131825 Ga0495650_0131825_705_899 63
324 3300046472 Ga0495580_0001051 Ga0495580_0001051_22186_22380 63
325 3300046492 Ga0495585_0030891 Ga0495585_0030891_1740_1934 63
326 3300046500 Ga0495596_0007300 Ga0495596_0007300_1011_1205 63
327 3300046500 Ga0495596_0108004 Ga0495596_0108004_508_702 63
328 3300046501 Ga0495607_0023525 Ga0495607_0023525_2377_2571 63
329 3300046506 Ga0495583_0055168 Ga0495583_0055168_1251_1448 63
330 3300046506 Ga0495583_0145199 Ga0495583_0145199_336_530 63
331 3300046507 Ga0495606_0000084 Ga0495606_0000084_56975_57172 63
332 3300046507 Ga0495606_0005424 Ga0495606_0005424_6717_6950 63
333 3300046507 Ga0495606_0146023 Ga0495606_0146023_661_858 63
334 3300046507 Ga0495606_0163865 Ga0495606_0163865_364_558 63
335 3300046507 Ga0495606_0256596 Ga0495606_0256596_57_251 63
336 3300046507 Ga0495606_0373838 Ga0495606_0373838_189_383 63
337 3300046512 Ga0495610_0000734 Ga0495610_0000734_28495_28728 63
338 3300046512 Ga0495610_0005527 Ga0495610_0005527_834_1031 63
339 3300046512 Ga0495610_0014792 Ga0495610_0014792_1585_1782 63
340 3300046513 Ga0495616_0253081 Ga0495616_0253081_453_647 63
341 3300046516 Ga0495628_0325463 Ga0495628_0325463_234_428 63
342 3300046518 Ga0495631_0353555 Ga0495631_0353555_55_252 63
343 3300046520 Ga0495637_0038501 Ga0495637_0038501_861_1055 63
344 3300046520 Ga0495637_0157753 Ga0495637_0157753_510_704 63
345 3300046522 Ga0495643_0000022 Ga0495643_0000022_216956_217153 63
346 3300046522 Ga0495643_0036849 Ga0495643_0036849_2042_2236 63
347 3300046522 Ga0495643_0287750 Ga0495643_0287750_376_570 63
348 3300046523 Ga0495644_0021790 Ga0495644_0021790_1774_1968 63
349 3300046524 Ga0495648_0000923 Ga0495648_0000923_9900_10094 63
350 3300046524 Ga0495648_0022483 Ga0495648_0022483_2783_2980 63
351 3300046524 Ga0495648_0028087 Ga0495648_0028087_158_355 63
352 3300046524 Ga0495648_0085957 Ga0495648_0085957_953_1150 63
353 3300046524 Ga0495648_0317951 Ga0495648_0317951_126_323 63
354 3300046528 Ga0495642_0000616 Ga0495642_0000616_2702_2896 63
355 3300046528 Ga0495642_0049088 Ga0495642_0049088_1428_1622 63
356 3300046530 Ga0495654_0016464 Ga0495654_0016464_1921_2115 63
357 3300046542 Ga0495597_0000149 Ga0495597_0000149_22878_23072 63
358 3300046542 Ga0495597_0000302 Ga0495597_0000302_21350_21547 63
359 3300046542 Ga0495597_0006279 Ga0495597_0006279_4996_5190 63
360 3300046542 Ga0495597_0009473 Ga0495597_0009473_3067_3261 63
361 3300046558 Ga0495633_0005592 Ga0495633_0005592_5540_5737 63
362 3300046558 Ga0495633_0572187 Ga0495633_0572187_34_234 63
363 3300046616 Ga0495668_0297278 Ga0495668_0297278_636_830 63
364 3300046616 Ga0495668_0372515 Ga0495668_0372515_158_355 63
365 3300046660 Ga0495625_0012563 Ga0495625_0012563_782_979 63
366 3300046660 Ga0495625_0046683 Ga0495625_0046683_855_1052 63
367 3300046660 Ga0495625_0728162 Ga0495625_0728162_159_371 63
368 3300046664 Ga0495659_0000197 Ga0495659_0000197_4442_4636 63
369 3300046684 Ga0495669_0016648 Ga0495669_0016648_1435_1629 63
370 3300046692 Ga0495671_0000612 Ga0495671_0000612_21602_21796 63
371 3300046692 Ga0495671_0024342 Ga0495671_0024342_170_367 63
372 3300046692 Ga0495671_0056790 Ga0495671_0056790_1638_1835 63
373 3300046694 Ga0495649_0005585 Ga0495649_0005585_1270_1464 63
374 3300046694 Ga0495649_0037173 Ga0495649_0037173_2138_2335 63
375 3300046694 Ga0495649_0067139 Ga0495649_0067139_853_1050 63
376 3300046694 Ga0495649_0109591 Ga0495649_0109591_911_1105 63
377 3300046810 Ga0495660_0456015 Ga0495660_0456015_126_320 63
378 3300047315 Ga0495581_0193707 Ga0495581_0193707_809_1003 63
379 3300047318 Ga0495636_0010162 Ga0495636_0010162_3464_3658 63
380 3300047320 Ga0495672_0000325 Ga0495672_0000325_43858_44055 63
381 3300047320 Ga0495672_0000364 Ga0495672_0000364_8982_9176 63
382 3300047320 Ga0495672_0000501 Ga0495672_0000501_33505_33699 63
383 3300047320 Ga0495672_0001049 Ga0495672_0001049_3164_3358 63
384 3300047320 Ga0495672_0348603 Ga0495672_0348603_345_542 63
385 3300047443 Ga0495687_012939 Ga0495687_012939_4178_4372 63
386 3300047443 Ga0495687_203931 Ga0495687_203931_327_521 63
387 3300047445 Ga0495677_0024700 Ga0495677_0024700_617_811 63
388 3300047445 Ga0495677_0057593 Ga0495677_0057593_725_922 63
389 3300047469 Ga0495673_0000109 Ga0495673_0000109_57811_58008 63
390 3300047469 Ga0495673_0205000 Ga0495673_0205000_211_408 63
391 3300047470 Ga0495681_0172865 Ga0495681_0172865_90_329 63
392 3300047472 Ga0495686_0000101 Ga0495686_0000101_46224_46418 63
393 3300048089 Ga0495614_0177950 Ga0495614_0177950_544_738 63
394 3300048091 Ga0495626_0005743 Ga0495626_0005743_3321_3515 63
395 3300048903 Ga0496100_0268316 Ga0496100_0268316_940_1134 63
396 3300048903 Ga0496100_0534773 Ga0496100_0534773_295_489 63
397 3300048904 Ga0496101_0106433 Ga0496101_0106433_773_967 63
398 3300048904 Ga0496101_0349128 Ga0496101_0349128_671_865 63
399 3300048905 Ga0496102_0528058 Ga0496102_0528058_366_560 63
400 3300048907 Ga0496104_1166766 Ga0496104_1166766_386_580 63
401 3300048908 Ga0496105_0119568 Ga0496105_0119568_725_919 63
402 3300048908 Ga0496105_0339469 Ga0496105_0339469_405_599 63
403 3300048909 Ga0496106_0422606 Ga0496106_0422606_161_355 63
404 3300048915 Ga0496112_0312124 Ga0496112_0312124_732_926 63
405 3300048916 Ga0496113_0491568 Ga0496113_0491568_106_300 63
406 3300048919 Ga0496116_0122599 Ga0496116_0122599_704_898 63
407 3300048921 Ga0496118_0165361 Ga0496118_0165361_762_956 63
408 3300048921 Ga0496118_0169619 Ga0496118_0169619_356_550 63
409 3300048924 Ga0496121_0164364 Ga0496121_0164364_503_697 63
410 3300048925 Ga0496122_0309594 Ga0496122_0309594_599_793 63
411 3300048926 Ga0496123_0156595 Ga0496123_0156595_390_584 63
412 3300048926 Ga0496123_0225966 Ga0496123_0225966_341_535 63
413 3300048926 Ga0496123_0470952 Ga0496123_0470952_227_421 63
414 3300048927 Ga0496124_0004757 Ga0496124_0004757_9705_9902 63
415 3300048927 Ga0496124_0102521 Ga0496124_0102521_1984_2178 63
416 3300048927 Ga0496124_0234341 Ga0496124_0234341_326_520 63
417 3300048928 Ga0496125_0004698 Ga0496125_0004698_2128_2322 63
418 3300048928 Ga0496125_0369737 Ga0496125_0369737_229_423 63
419 3300048929 Ga0496126_0295151 Ga0496126_0295151_616_810 63
420 3300048929 Ga0496126_1016119 Ga0496126_1016119_109_303 63
421 3300048929 Ga0496126_1403280 Ga0496126_1403280_75_275 63
422 3300049459 Ga0495678_000103 Ga0495678_000103_25338_25535 63
423 3300049460 Ga0495682_0039775 Ga0495682_0039775_1313_1507 63
424 3300049460 Ga0495682_0128364 Ga0495682_0128364_88_285 63
425 3300049460 Ga0495682_0183882 Ga0495682_0183882_49_246 63
426 3300049460 Ga0495682_0191133 Ga0495682_0191133_235_429 63
427 3300049568 Ga0501031_0079328 Ga0501031_0079328_1603_1797 63
428 3300049568 Ga0501031_0102170 Ga0501031_0102170_742_936 63
429 3300049568 Ga0501031_1037589 Ga0501031_1037589_54_248 63
430 3300049569 Ga0501032_0019135 Ga0501032_0019135_688_882 63
431 3300049570 Ga0501033_0007594 Ga0501033_0007594_1653_1850 63
432 3300049570 Ga0501033_0036341 Ga0501033_0036341_458_652 63
433 3300049570 Ga0501033_0409778 Ga0501033_0409778_329_523 63
434 3300049571 Ga0501034_0071540 Ga0501034_0071540_3264_3461 63
435 3300049571 Ga0501034_0210446 Ga0501034_0210446_669_863 63
436 3300049571 Ga0501034_0476579 Ga0501034_0476579_519_713 63
437 3300049571 Ga0501034_0712084 Ga0501034_0712084_395_595 63
438 3300049572 Ga0501036_0191909 Ga0501036_0191909_784_978 63
439 3300049573 Ga0501037_0042094 Ga0501037_0042094_2543_2737 63
440 3300049573 Ga0501037_0136352 Ga0501037_0136352_1093_1299 63
441 3300049574 Ga0501038_0086638 Ga0501038_0086638_580_774 63
442 3300049574 Ga0501038_0396734 Ga0501038_0396734_757_954 63
443 3300049579 Ga0501043_0112910 Ga0501043_0112910_1050_1244 63
444 3300049580 Ga0501046_0611996 Ga0501046_0611996_506_700 63
445 3300049581 Ga0501047_0001719 Ga0501047_0001719_16837_17034 63
446 3300049581 Ga0501047_0108940 Ga0501047_0108940_708_902 63
447 3300049742 Ga0501080_0370053 Ga0501080_0370053_1029_1223 63
448 3300049822 Ga0501035_0014272 Ga0501035_0014272_6579_6776 63
449 3300049822 Ga0501035_0100203 Ga0501035_0100203_866_1063 63
450 3300049822 Ga0501035_0219819 Ga0501035_0219819_652_846 63
451 3300049822 Ga0501035_0498054 Ga0501035_0498054_476_670 63
452 3300049823 Ga0501044_0000759 Ga0501044_0000759_37138_37335 63
453 3300049823 Ga0501044_0012342 Ga0501044_0012342_6278_6472 63
454 3300049823 Ga0501044_0038454 Ga0501044_0038454_3956_4150 63
455 3300049823 Ga0501044_0154261 Ga0501044_0154261_1911_2117 63
456 3300050489 nmdc:mga03683_173575_c1 nmdc:mga03683_173575_c1_449_643 63
457 3300050493 nmdc:mga0k408_72993_c1 nmdc:mga0k408_72993_c1_581_775 63
458 3300050496 nmdc:mga07m45_689296_c1 nmdc:mga07m45_689296_c1_157_354 63
459 3300053088 Ga0500644_0018207 Ga0500644_0018207_398_598 63
460 3300053088 Ga0500644_0459925 Ga0500644_0459925_265_459 63
461 3300053091 Ga0500647_0086843 Ga0500647_0086843_248_442 63
462 3300053094 Ga0500566_0203076 Ga0500566_0203076_584_784 63
463 3300053118 Ga0500594_0012219 Ga0500594_0012219_282_479 63
464 3300053125 Ga0500618_001793 Ga0500618_001793_40_234 63
465 3300053125 Ga0500618_014036 Ga0500618_014036_516_713 63
466 3300053126 Ga0500621_247680 Ga0500621_247680_368_562 63
467 3300053133 Ga0500655_002387 Ga0500655_002387_2827_3021 63
468 3300053145 Ga0500586_000914 Ga0500586_000914_3568_3765 63
469 3300053151 Ga0500604_0010999 Ga0500604_0010999_771_971 63
470 3300053156 Ga0500622_0252891 Ga0500622_0252891_178_375 63
471 3300053177 Ga0500636_0166188 Ga0500636_0166188_730_924 63
472 3300053730 Ga0500645_000506 Ga0500645_000506_11299_11499 63
473 3300053730 Ga0500645_020596 Ga0500645_020596_995_1189 63
474 3300048929 Ga0496126_0233254 Ga0496126_0233254_1272_1466 64
475 3300001904 JGI24736J21556_1034195 JGI24736J21556_10341952 65
476 3300002077 JGI24744J21845_10030038 JGI24744J21845_100300382 65
477 3300002244 JGI24742J22300_10010840 JGI24742J22300_100108401 65
478 3300003215 JGI25153J46596_10000034 JGI25153J46596_1000003481 65
479 3300003762 Ga0055542_1000041 Ga0055542_100004152 65
480 3300003763 Ga0055529_1000040 Ga0055529_100004077 65
481 3300005333 Ga0070677_10324233 Ga0070677_103242332 65
482 3300005338 Ga0068868_100294044 Ga0068868_1002940442 65
483 3300005354 Ga0070675_100404195 Ga0070675_1004041952 65
484 3300005355 Ga0070671_101524155 Ga0070671_1015241551 65
485 3300005356 Ga0070674_100002936 Ga0070674_1000029367 65
486 3300005356 Ga0070674_100121034 Ga0070674_1001210344 65
487 3300005456 Ga0070678_100241504 Ga0070678_1002415042 65
488 3300005457 Ga0070662_101539744 Ga0070662_1015397441 65
489 3300005459 Ga0068867_100601287 Ga0068867_1006012872 65
490 3300005548 Ga0070665_100369185 Ga0070665_1003691852 65
491 3300005563 Ga0068855_101848150 Ga0068855_1018481502 65
492 3300005616 Ga0068852_101282124 Ga0068852_1012821242 65
493 3300005617 Ga0068859_101950709 Ga0068859_1019507092 65
494 3300005719 Ga0068861_101006640 Ga0068861_1010066402 65
495 3300006186 Ga0075369_10558191 Ga0075369_105581911 65
496 3300006195 Ga0075366_10944336 Ga0075366_109443361 65
497 3300006237 Ga0097621_100017596 Ga0097621_1000175963 65
498 3300006353 Ga0075370_10232116 Ga0075370_102321162 65
499 3300006358 Ga0068871_100133788 Ga0068871_1001337882 65
500 3300006931 Ga0097620_101950618 Ga0097620_1019506182 65
501 3300009148 Ga0105243_10002803 Ga0105243_100028037 65
502 3300010375 Ga0105239_11402277 Ga0105239_114022772 65
503 3300011119 Ga0105246_10191210 Ga0105246_101912103 65
504 3300013100 Ga0157373_10849107 Ga0157373_108491072 65
505 3300013102 Ga0157371_11437065 Ga0157371_114370651 65
506 3300014969 Ga0157376_11704152 Ga0157376_117041522 65
507 3300017792 Ga0163161_10133657 Ga0163161_101336572 65
508 3300025226 Ga0209674_117304 Ga0209674_1173042 65
509 3300025250 Ga0209026_1035601 Ga0209026_10356011 65
510 3300025254 Ga0209148_1000008 Ga0209148_1000008242 65
511 3300025263 Ga0209565_1033768 Ga0209565_10337681 65
512 3300025272 Ga0209455_1000002 Ga0209455_10000021181 65
513 3300025272 Ga0209455_1040195 Ga0209455_10401952 65
514 3300025273 Ga0209673_1066881 Ga0209673_10668811 65
515 3300025297 Ga0209758_1000007 Ga0209758_1000007552 65
516 3300025299 Ga0209256_1024493 Ga0209256_10244932 65
517 3300025893 Ga0207682_10536099 Ga0207682_105360992 65
518 3300025901 Ga0207688_10210177 Ga0207688_102101772 65
519 3300025903 Ga0207680_10435786 Ga0207680_104357862 65
520 3300025904 Ga0207647_10067352 Ga0207647_100673523 65
521 3300025926 Ga0207659_11907505 Ga0207659_119075052 65
522 3300025931 Ga0207644_10778748 Ga0207644_107787482 65
523 3300025933 Ga0207706_10446267 Ga0207706_104462672 65
524 3300025935 Ga0207709_10000005 Ga0207709_10000005243 65
525 3300025937 Ga0207669_10000222 Ga0207669_100002226 65
526 3300025937 Ga0207669_10088491 Ga0207669_100884914 65
527 3300025942 Ga0207689_11026426 Ga0207689_110264262 65
528 3300025949 Ga0207667_11213207 Ga0207667_112132072 65
529 3300025972 Ga0207668_11638405 Ga0207668_116384051 65
530 3300025986 Ga0207658_10209300 Ga0207658_102093001 65
531 3300026089 Ga0207648_10297915 Ga0207648_102979152 65
532 3300026118 Ga0207675_100250745 Ga0207675_1002507452 65
533 3300026121 Ga0207683_10004368 Ga0207683_1000436815 65
534 3300028379 Ga0268266_10468311 Ga0268266_104683112 65
535 3300028786 Ga0307517_10052336 Ga0307517_100523363 65
536 3300037471 Ga0395905_0588007 Ga0395905_0588007_737_934 65
537 3300038443 Ga0395901_0534470 Ga0395901_0534470_709_906 65
538 3300041460 Ga0451802_1942149 Ga0451802_1942149_55_252 65
539 3300046491 Ga0495584_0020121 Ga0495584_0020121_15_212 65
540 3300046492 Ga0495585_0306413 Ga0495585_0306413_270_467 65
541 3300046506 Ga0495583_0018703 Ga0495583_0018703_333_530 65
542 3300046507 Ga0495606_0050421 Ga0495606_0050421_1709_1906 65
543 3300046507 Ga0495606_0051882 Ga0495606_0051882_67_264 65
544 3300046512 Ga0495610_0085008 Ga0495610_0085008_1010_1207 65
545 3300046513 Ga0495616_0138571 Ga0495616_0138571_646_843 65
546 3300046518 Ga0495631_0095376 Ga0495631_0095376_202_399 65
547 3300046520 Ga0495637_0088811 Ga0495637_0088811_510_707 65
548 3300046522 Ga0495643_0012099 Ga0495643_0012099_1154_1351 65
549 3300046522 Ga0495643_0100493 Ga0495643_0100493_1216_1413 65
550 3300046524 Ga0495648_0004643 Ga0495648_0004643_2446_2643 65
551 3300046525 Ga0495663_0033194 Ga0495663_0033194_789_986 65
552 3300046538 Ga0495609_0271481 Ga0495609_0271481_382_579 65
553 3300046558 Ga0495633_0000813 Ga0495633_0000813_23630_23827 65
554 3300046558 Ga0495633_0139941 Ga0495633_0139941_294_491 65
555 3300046648 Ga0495611_0135002 Ga0495611_0135002_568_765 65
556 3300046660 Ga0495625_0070936 Ga0495625_0070936_756_953 65
557 3300046660 Ga0495625_0098977 Ga0495625_0098977_1783_1980 65
558 3300046660 Ga0495625_0108543 Ga0495625_0108543_165_362 65
559 3300046691 Ga0495670_0232459 Ga0495670_0232459_561_758 65
560 3300046694 Ga0495649_0363824 Ga0495649_0363824_314_511 65
561 3300047323 Ga0495683_0051518 Ga0495683_0051518_1030_1227 65
562 3300047470 Ga0495681_0016089 Ga0495681_0016089_2042_2239 65
563 3300048904 Ga0496101_1204057 Ga0496101_1204057_112_309 65
564 3300048905 Ga0496102_0002580 Ga0496102_0002580_13022_13219 65
565 3300048906 Ga0496103_0000055 Ga0496103_0000055_130577_130774 65
566 3300048907 Ga0496104_0045333 Ga0496104_0045333_1900_2097 65
567 3300048907 Ga0496104_0047175 Ga0496104_0047175_1600_1806 65
568 3300048908 Ga0496105_0000312 Ga0496105_0000312_29338_29544 65
569 3300048908 Ga0496105_0007690 Ga0496105_0007690_2118_2315 65
570 3300048913 Ga0496110_0080950 Ga0496110_0080950_2119_2316 65
571 3300048914 Ga0496111_0020612 Ga0496111_0020612_2283_2480 65
572 3300048916 Ga0496113_0057875 Ga0496113_0057875_2696_2893 65
573 3300048917 Ga0496114_0009646 Ga0496114_0009646_2764_2961 65
574 3300048918 Ga0496115_0004364 Ga0496115_0004364_2129_2326 65
575 3300048918 Ga0496115_0112966 Ga0496115_0112966_603_809 65
576 3300048919 Ga0496116_0020028 Ga0496116_0020028_2131_2328 65
577 3300048920 Ga0496117_0000549 Ga0496117_0000549_13269_13466 65
578 3300048921 Ga0496118_0000552 Ga0496118_0000552_13151_13348 65
579 3300048922 Ga0496119_0014198 Ga0496119_0014198_4681_4878 65
580 3300048923 Ga0496120_0068375 Ga0496120_0068375_371_568 65
581 3300048924 Ga0496121_0014836 Ga0496121_0014836_5878_6075 65
582 3300048925 Ga0496122_0043037 Ga0496122_0043037_1560_1757 65
583 3300048926 Ga0496123_0031086 Ga0496123_0031086_2862_3059 65
584 3300048927 Ga0496124_0000585 Ga0496124_0000585_13022_13219 65
585 3300048928 Ga0496125_0006119 Ga0496125_0006119_9547_9744 65
586 3300048929 Ga0496126_0009285 Ga0496126_0009285_2202_2399 65
587 3300050493 nmdc:mga0k408_178985_c1 nmdc:mga0k408_178985_c1_912_1109 65
588 3300053130 Ga0500642_0000731 Ga0500642_0000731_3133_3330 65
589 3300053735 Ga0500596_000856 Ga0500596_000856_2392_2589 65
590 3300055283 Ga0500661_043388 Ga0500661_043388_313_510 65
591 3300059630 Ga0587128_114121 Ga0587128_114121_235_432 65

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01679

Pmp3

Proteolipid membrane potential modulator

15

64

0.91

Feature Viewer

pLDDT pTM Quality
83.68 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map