F467028

General Info

Members Datasets Scaffolds Average Seq Length
591 263 1182 245

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100002693|Ga0070678_10000269311
Length 271
Sequence MAGARLRVVRLPMNDTSSTPESTQETFISHLVELRTRLLHAIIAVFVVLLCLFPWAKDIYAVLAAPLIKALPSGATMIATDVTGTFLVPLKVTLMAAFLIALPYVLYQMWAFVAPGLYRHEKRLALPVIMSSVVFFALGMCFAYFVVFPIAFGFFAGYAPTGVQMMTDIDKYLSFVLTMFIAFGITFETPVVVIVLVRLGVVSLEKLRAIRGYVIVGAFVVGAVFTPPDILSQLMMAVPLWLLYELGLLVARFISVPKRDGDAIGEEKSAG

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
211 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.72
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100002693 3300005456 Bacteria 9797
2 JGI24738J21930_10027976 3300002075 Bacteria 1154
3 rootL2_10004552 3300003322 Bacteria 16584
4 Ga0070658_10021731 3300005327 Bacteria 5143
5 Ga0070658_10032073 3300005327 Bacteria 4224
6 Ga0070658_10044961 3300005327 Bacteria 3569
7 Ga0070683_100015121 3300005329 Bacteria 6773
8 Ga0070683_100025792 3300005329 Bacteria 5285
9 Ga0070683_100077584 3300005329 Bacteria 3107
10 Ga0070683_100140866 3300005329 Bacteria 2285
11 Ga0070690_100003569 3300005330 Bacteria 8537
12 Ga0070690_100079409 3300005330 Bacteria 2145
13 Ga0070670_100001357 3300005331 Bacteria 19624
14 Ga0070670_100022193 3300005331 Bacteria 5463
15 Ga0070670_100034974 3300005331 Bacteria 4324
16 Ga0070670_100092795 3300005331 Bacteria 2596
17 Ga0070670_100219445 3300005331 Bacteria 1654
18 Ga0068869_100047018 3300005334 Bacteria 3114
19 Ga0070666_10011040 3300005335 Bacteria 5661
20 Ga0070666_10114311 3300005335 Bacteria 1868
21 Ga0070666_10126446 3300005335 Bacteria 1774
22 Ga0070680_100083046 3300005336 Bacteria 2645
23 Ga0070682_100186862 3300005337 Bacteria 1452
24 Ga0068868_100016809 3300005338 Bacteria 5441
25 Ga0070660_100024210 3300005339 Bacteria 4503
26 Ga0070660_100111640 3300005339 Bacteria 2175
27 Ga0070660_100254099 3300005339 Bacteria 1434
28 Ga0070689_100051068 3300005340 Bacteria 3195
29 Ga0070661_100003414 3300005344 Bacteria 10969
30 Ga0070661_100004272 3300005344 Bacteria 9853
31 Ga0070661_100058057 3300005344 Bacteria 2836
32 Ga0070661_100125577 3300005344 Bacteria 1924
33 Ga0070661_100155421 3300005344 Bacteria 1730
34 Ga0070661_100234329 3300005344 Bacteria 1412
35 Ga0070661_100333047 3300005344 Bacteria 1188
36 Ga0070692_10041785 3300005345 Bacteria 2351
37 Ga0070668_100004012 3300005347 Bacteria 10887
38 Ga0070668_100007230 3300005347 Bacteria 8233
39 Ga0070668_100035423 3300005347 Bacteria 3805
40 Ga0070668_100222361 3300005347 Bacteria 1558
41 Ga0070668_100314643 3300005347 Bacteria 1316
42 Ga0070668_100473303 3300005347 Bacteria 1081
43 Ga0070669_100093601 3300005353 Bacteria 2257
44 Ga0070675_100028044 3300005354 Bacteria 4528
45 Ga0070675_100029419 3300005354 Bacteria 4431
46 Ga0070671_100008842 3300005355 Bacteria 8082
47 Ga0070671_100013306 3300005355 Bacteria 6633
48 Ga0070671_100100523 3300005355 Bacteria 2426
49 Ga0070674_100003849 3300005356 Bacteria 8493
50 Ga0070674_100070657 3300005356 Bacteria 2467
51 Ga0070674_100180669 3300005356 Bacteria 1616
52 Ga0070673_100072751 3300005364 Bacteria 2765
53 Ga0070673_100227227 3300005364 Bacteria 1618
54 Ga0070688_100001381 3300005365 Bacteria 12063
55 Ga0070659_100001024 3300005366 Bacteria 20502
56 Ga0070659_100064294 3300005366 Bacteria 2904
57 Ga0070659_100235555 3300005366 Bacteria 1513
58 Ga0070667_100031755 3300005367 Bacteria 4402
59 Ga0070667_100081128 3300005367 Bacteria 2775
60 Ga0070667_100135499 3300005367 Bacteria 2153
61 Ga0070667_100382428 3300005367 Bacteria 1279
62 Ga0070667_100461460 3300005367 Bacteria 1161
63 Ga0070709_10001537 3300005434 Bacteria 12459
64 Ga0070709_10287570 3300005434 Bacteria 1197
65 Ga0070709_10317150 3300005434 Bacteria 1143
66 Ga0070714_100007228 3300005435 Bacteria 8623
67 Ga0070714_100011883 3300005435 Bacteria 6922
68 Ga0070714_100025967 3300005435 Bacteria 4838
69 Ga0070714_100041927 3300005435 Bacteria 3864
70 Ga0070714_100253641 3300005435 Bacteria 1627
71 Ga0070713_100006114 3300005436 Bacteria 8305
72 Ga0070713_100006522 3300005436 Bacteria 8102
73 Ga0070713_100171530 3300005436 Bacteria 1944
74 Ga0070710_10004419 3300005437 Bacteria 6648
75 Ga0070710_10205558 3300005437 Bacteria 1245
76 Ga0070711_100012264 3300005439 Bacteria 5348
77 Ga0070711_100034524 3300005439 Bacteria 3374
78 Ga0070705_100007352 3300005440 Bacteria 5421
79 Ga0070700_100086077 3300005441 Bacteria 2040
80 Ga0070708_100183766 3300005445 Bacteria 1955
81 Ga0070663_100006694 3300005455 Bacteria 6950
82 Ga0070663_100027085 3300005455 Bacteria 3887
83 Ga0070663_100028880 3300005455 Bacteria 3782
84 Ga0070678_100246527 3300005456 Bacteria 1496
85 Ga0070662_100000907 3300005457 Bacteria 18094
86 Ga0070662_100014165 3300005457 Bacteria 5321
87 Ga0070662_100047379 3300005457 Bacteria 3092
88 Ga0070662_100136388 3300005457 Bacteria 1898
89 Ga0070662_100258752 3300005457 Bacteria 1402
90 Ga0070681_10002650 3300005458 Bacteria 16433
91 Ga0070681_10121970 3300005458 Bacteria 2540
92 Ga0068867_100005656 3300005459 Bacteria 8863
93 Ga0068867_100453656 3300005459 Bacteria 1093
94 Ga0070685_10004420 3300005466 Bacteria 7100
95 Ga0070706_100112707 3300005467 Bacteria 2532
96 Ga0070706_100119240 3300005467 Bacteria 2459
97 Ga0070706_100176832 3300005467 Bacteria 1993
98 Ga0070706_100177140 3300005467 Bacteria 1991
99 Ga0070707_100019681 3300005468 Bacteria 6362
100 Ga0070707_100068280 3300005468 Bacteria 3421
101 Ga0070707_100213744 3300005468 Bacteria 1879
102 Ga0070698_100077819 3300005471 Bacteria 3316
103 Ga0070698_100096520 3300005471 Bacteria 2933
104 Ga0070699_100044793 3300005518 Bacteria 3830
105 Ga0070679_100003190 3300005530 Bacteria 14983
106 Ga0070679_100050486 3300005530 Bacteria 4144
107 Ga0070679_100119130 3300005530 Bacteria 2624
108 Ga0070679_100237187 3300005530 Bacteria 1782
109 Ga0070679_100437710 3300005530 Bacteria 1252
110 Ga0070684_100002779 3300005535 Bacteria 12960
111 Ga0070684_100003996 3300005535 Bacteria 11163
112 Ga0070697_100017968 3300005536 Bacteria 5572
113 Ga0068853_100017495 3300005539 Bacteria 5916
114 Ga0068853_100249998 3300005539 Bacteria 1626
115 Ga0070672_100006329 3300005543 Bacteria 7944
116 Ga0070672_100145852 3300005543 Bacteria 1956
117 Ga0070672_100276601 3300005543 Bacteria 1418
118 Ga0070672_100411852 3300005543 Bacteria 1160
119 Ga0070695_100009019 3300005545 Bacteria 5930
120 Ga0070696_100004002 3300005546 Bacteria 9822
121 Ga0070696_100295189 3300005546 Bacteria 1239
122 Ga0070665_100001378 3300005548 Bacteria 28614
123 Ga0070665_100017516 3300005548 Bacteria 7194
124 Ga0070665_100540887 3300005548 Bacteria 1177
125 Ga0070704_100034772 3300005549 Bacteria 3420
126 Ga0068855_100000852 3300005563 Bacteria 37837
127 Ga0068855_100002157 3300005563 Bacteria 24326
128 Ga0068855_100055477 3300005563 Bacteria 4654
129 Ga0068855_100100334 3300005563 Bacteria 3334
130 Ga0068855_100463460 3300005563 Bacteria 1382
131 Ga0068855_100626423 3300005563 Bacteria 1158
132 Ga0070664_100001435 3300005564 Bacteria 19005
133 Ga0070664_100030377 3300005564 Bacteria 4508
134 Ga0070664_100051442 3300005564 Bacteria 3488
135 Ga0070664_100075687 3300005564 Bacteria 2891
136 Ga0070664_100257240 3300005564 Bacteria 1570
137 Ga0070664_100351556 3300005564 Bacteria 1341
138 Ga0068857_100000326 3300005577 Bacteria 32742
139 Ga0068857_100039110 3300005577 Bacteria 4201
140 Ga0068857_100048437 3300005577 Bacteria 3773
141 Ga0068857_100208506 3300005577 Bacteria 1783
142 Ga0068857_100350784 3300005577 Bacteria 1366
143 Ga0068854_100001495 3300005578 Bacteria 14165
144 Ga0068854_100096122 3300005578 Bacteria 2213
145 Ga0068854_100132787 3300005578 Bacteria 1903
146 Ga0068854_100245414 3300005578 Bacteria 1428
147 Ga0068856_100000664 3300005614 Bacteria 37278
148 Ga0068856_100040565 3300005614 Bacteria 4573
149 Ga0068856_100093569 3300005614 Bacteria 2991
150 Ga0068856_100093806 3300005614 Bacteria 2987
151 Ga0068856_100277375 3300005614 Bacteria 1693
152 Ga0068856_100582765 3300005614 Bacteria 1140
153 Ga0070702_100024702 3300005615 Bacteria 3209
154 Ga0068852_100031925 3300005616 Bacteria 4354
155 Ga0068852_100044062 3300005616 Bacteria 3787
156 Ga0068852_100050839 3300005616 Bacteria 3554
157 Ga0068852_100152455 3300005616 Bacteria 2151
158 Ga0068852_100374515 3300005616 Bacteria 1395
159 Ga0068859_100198156 3300005617 Bacteria 2092
160 Ga0068864_100000221 3300005618 Bacteria 51532
161 Ga0068864_100002525 3300005618 Bacteria 15118
162 Ga0068864_100049509 3300005618 Bacteria 3615
163 Ga0068864_100104212 3300005618 Bacteria 2519
164 Ga0068864_100416297 3300005618 Bacteria 1280
165 Ga0068866_10002008 3300005718 Bacteria 8468
166 Ga0068866_10029218 3300005718 Bacteria 2635
167 Ga0068866_10201551 3300005718 Bacteria 1189
168 Ga0068861_100074498 3300005719 Bacteria 2640
169 Ga0068861_100119639 3300005719 Bacteria 2122
170 Ga0068861_100122947 3300005719 Bacteria 2096
171 Ga0068861_100187613 3300005719 Bacteria 1726
172 Ga0068851_10001475 3300005834 Bacteria 10317
173 Ga0068870_10019909 3300005840 Bacteria 3260
174 Ga0068863_100000366 3300005841 Bacteria 45953
175 Ga0068863_100002529 3300005841 Bacteria 18145
176 Ga0068863_100173378 3300005841 Bacteria 2069
177 Ga0068863_100220694 3300005841 Bacteria 1826
178 Ga0068858_100004035 3300005842 Bacteria 14489
179 Ga0068858_100008616 3300005842 Bacteria 9798
180 Ga0068858_100033471 3300005842 Bacteria 4768
181 Ga0068860_100002003 3300005843 Bacteria 21485
182 Ga0068860_100075439 3300005843 Bacteria 3207
183 Ga0068860_100151477 3300005843 Bacteria 2233
184 Ga0068860_100238272 3300005843 Bacteria 1769
185 Ga0070712_100002168 3300006175 Bacteria 12074
186 Ga0070712_100047648 3300006175 Bacteria 2967
187 Ga0070712_100317018 3300006175 Bacteria 1267
188 Ga0097621_100010473 3300006237 Bacteria 6789
189 Ga0097621_100169567 3300006237 Bacteria 1881
190 Ga0097621_100216890 3300006237 Bacteria 1666
191 Ga0097621_100784816 3300006237 Bacteria 882
192 Ga0068871_100011074 3300006358 Bacteria 6610
193 Ga0068871_100311282 3300006358 Bacteria 1384
194 Ga0075434_100055090 3300006871 Bacteria 3951
195 Ga0075434_100370722 3300006871 Bacteria 1453
196 Ga0075434_100378778 3300006871 Bacteria 1436
197 Ga0068865_100059930 3300006881 Bacteria 2663
198 Ga0068865_100112277 3300006881 Bacteria 2013
199 Ga0097620_100198159 3300006931 Bacteria 2092
200 Ga0105240_10023857 3300009093 Bacteria 8079
201 Ga0105240_10036275 3300009093 Bacteria 6344
202 Ga0105240_10792527 3300009093 Bacteria 1027
203 Ga0111539_10097714 3300009094 Bacteria 3450
204 Ga0105245_10054742 3300009098 Bacteria 3583
205 Ga0105245_10089098 3300009098 Bacteria 2836
206 Ga0105245_10236982 3300009098 Bacteria 1767
207 Ga0114129_10458322 3300009147 Bacteria 1671
208 Ga0114129_10987461 3300009147 Bacteria 1061
209 Ga0105243_10175284 3300009148 Bacteria 1861
210 Ga0105241_10011819 3300009174 Bacteria 6412
211 Ga0105241_10039343 3300009174 Bacteria 3567
212 Ga0105241_10049950 3300009174 Bacteria 3187
213 Ga0105241_10128793 3300009174 Bacteria 2047
214 Ga0105242_10005949 3300009176 Bacteria 9408
215 Ga0105242_10013861 3300009176 Bacteria 6237
216 Ga0105248_10071446 3300009177 Bacteria 3899
217 Ga0105248_10098500 3300009177 Bacteria 3294
218 Ga0105248_10152640 3300009177 Bacteria 2606
219 Ga0105248_10436659 3300009177 Bacteria 1475
220 Ga0105248_10800780 3300009177 Bacteria 1063
221 Ga0105238_10000556 3300009551 Bacteria 39015
222 Ga0105238_10036136 3300009551 Bacteria 5021
223 Ga0105238_10661970 3300009551 Bacteria 1055
224 Ga0105238_10742157 3300009551 Bacteria 995
225 Ga0105239_10032530 3300010375 Bacteria 5730
226 Ga0105239_10612416 3300010375 Bacteria 1242
227 Ga0105239_10748444 3300010375 Bacteria 1118
228 Ga0157373_10000524 3300013100 Bacteria 30046
229 Ga0157373_10165805 3300013100 Bacteria 1555
230 Ga0157373_10442709 3300013100 Bacteria 934
231 Ga0157371_10007017 3300013102 Bacteria 9166
232 Ga0157371_10023516 3300013102 Bacteria 4506
233 Ga0157371_10083620 3300013102 Bacteria 2260
234 Ga0157371_10151122 3300013102 Bacteria 1656
235 Ga0157370_10015030 3300013104 Bacteria 7890
236 Ga0157370_10044920 3300013104 Bacteria 4242
237 Ga0157370_10045045 3300013104 Bacteria 4235
238 Ga0157370_10052750 3300013104 Bacteria 3882
239 Ga0157370_10224932 3300013104 Bacteria 1737
240 Ga0157369_10002003 3300013105 Bacteria 24533
241 Ga0157369_10069729 3300013105 Bacteria 3777
242 Ga0157369_10165723 3300013105 Bacteria 2331
243 Ga0157369_10260702 3300013105 Bacteria 1808
244 Ga0157374_10007595 3300013296 Bacteria 9253
245 Ga0157374_10181908 3300013296 Bacteria 2054
246 Ga0157378_10017983 3300013297 Bacteria 6205
247 Ga0157378_10028289 3300013297 Bacteria 4944
248 Ga0163162_10123798 3300013306 Bacteria 2691
249 Ga0163162_10525548 3300013306 Bacteria 1312
250 Ga0163162_10666504 3300013306 Bacteria 1163
251 Ga0163162_10715381 3300013306 Bacteria 1122
252 Ga0157372_10002597 3300013307 Bacteria 19548
253 Ga0157372_10019154 3300013307 Bacteria 7369
254 Ga0157372_10049528 3300013307 Bacteria 4671
255 Ga0157372_10064414 3300013307 Bacteria 4113
256 Ga0157372_10084274 3300013307 Bacteria 3602
257 Ga0157372_10109676 3300013307 Bacteria 3161
258 Ga0157372_10334242 3300013307 Bacteria 1764
259 Ga0157372_10648913 3300013307 Bacteria 1229
260 Ga0157375_10008960 3300013308 Bacteria 8756
261 Ga0157375_10010810 3300013308 Bacteria 8041
262 Ga0157375_10306406 3300013308 Bacteria 1752
263 Ga0157375_10353896 3300013308 Bacteria 1634
264 Ga0163163_10012877 3300014325 Bacteria 7637
265 Ga0163163_10016705 3300014325 Bacteria 6826
266 Ga0163163_10049049 3300014325 Bacteria 4154
267 Ga0163163_10403894 3300014325 Bacteria 1424
268 Ga0163163_10588635 3300014325 Bacteria 1176
269 Ga0157380_10018326 3300014326 Bacteria 5195
270 Ga0157380_10036173 3300014326 Bacteria 3819
271 Ga0157380_10201637 3300014326 Bacteria 1765
272 Ga0182008_10088563 3300014497 Bacteria 1525
273 Ga0157379_10046159 3300014968 Bacteria 3888
274 Ga0157379_10054562 3300014968 Bacteria 3571
275 Ga0157379_10357673 3300014968 Bacteria 1338
276 Ga0157376_10039178 3300014969 Bacteria 3863
277 Ga0157376_10332706 3300014969 Bacteria 1448
278 Ga0157376_10374692 3300014969 Bacteria 1369
279 Ga0163161_10009300 3300017792 Bacteria 6799
280 Ga0206353_10186902 3300020082 Bacteria 2899
281 Ga0213872_10000955 3300021361 Bacteria 20223
282 Ga0213872_10026420 3300021361 Bacteria 2666
283 Ga0207697_10191923 3300025315 Bacteria 897
284 Ga0207656_10060524 3300025321 Bacteria 1660
285 Ga0207682_10024574 3300025893 Bacteria 2386
286 Ga0207692_10198132 3300025898 Bacteria 1179
287 Ga0207642_10032924 3300025899 Bacteria 2188
288 Ga0207642_10212792 3300025899 Bacteria 1075
289 Ga0207688_10166865 3300025901 Bacteria 1308
290 Ga0207688_10319345 3300025901 Bacteria 952
291 Ga0207680_10005392 3300025903 Bacteria 6110
292 Ga0207685_10141340 3300025905 Bacteria 1080
293 Ga0207699_10278253 3300025906 Bacteria 1162
294 Ga0207699_10287502 3300025906 Bacteria 1144
295 Ga0207699_10346120 3300025906 Bacteria 1048
296 Ga0207645_10052198 3300025907 Bacteria 2612
297 Ga0207705_10061805 3300025909 Bacteria 2706
298 Ga0207705_10129552 3300025909 Bacteria 1877
299 Ga0207684_10127446 3300025910 Bacteria 2185
300 Ga0207684_10145445 3300025910 Bacteria 2039
301 Ga0207684_10195702 3300025910 Bacteria 1744
302 Ga0207654_10008869 3300025911 Bacteria 5100
303 Ga0207654_10010966 3300025911 Bacteria 4615
304 Ga0207654_10090138 3300025911 Bacteria 1867
305 Ga0207707_10004820 3300025912 Bacteria 11831
306 Ga0207707_10006977 3300025912 Bacteria 9853
307 Ga0207707_10016589 3300025912 Bacteria 6421
308 Ga0207695_10027063 3300025913 Bacteria 6389
309 Ga0207695_10034713 3300025913 Bacteria 5480
310 Ga0207695_10062439 3300025913 Bacteria 3846
311 Ga0207693_10000364 3300025915 Bacteria 41420
312 Ga0207663_10008165 3300025916 Bacteria 5458
313 Ga0207663_10035559 3300025916 Bacteria 2989
314 Ga0207660_10025690 3300025917 Bacteria 4001
315 Ga0207662_10012895 3300025918 Bacteria 4664
316 Ga0207657_10000315 3300025919 Bacteria 51211
317 Ga0207657_10000469 3300025919 Bacteria 42688
318 Ga0207657_10002076 3300025919 Bacteria 21674
319 Ga0207657_10036278 3300025919 Bacteria 4414
320 Ga0207649_10004554 3300025920 Bacteria 7526
321 Ga0207649_10019311 3300025920 Bacteria 3893
322 Ga0207649_10038912 3300025920 Bacteria 2882
323 Ga0207649_10178435 3300025920 Bacteria 1485
324 Ga0207652_10040586 3300025921 Bacteria 3952
325 Ga0207652_10187943 3300025921 Bacteria 1857
326 Ga0207652_10242046 3300025921 Bacteria 1626
327 Ga0207646_10015263 3300025922 Bacteria 7264
328 Ga0207681_10026058 3300025923 Bacteria 3768
329 Ga0207681_10066694 3300025923 Bacteria 2492
330 Ga0207694_10005605 3300025924 Bacteria 9620
331 Ga0207694_10031879 3300025924 Bacteria 4029
332 Ga0207694_10684749 3300025924 Bacteria 864
333 Ga0207650_10000403 3300025925 Bacteria 38821
334 Ga0207650_10033642 3300025925 Bacteria 3714
335 Ga0207650_10035471 3300025925 Bacteria 3622
336 Ga0207650_10057502 3300025925 Bacteria 2892
337 Ga0207650_10374807 3300025925 Bacteria 1174
338 Ga0207659_10045808 3300025926 Bacteria 3086
339 Ga0207659_10093552 3300025926 Bacteria 2250
340 Ga0207687_10088790 3300025927 Bacteria 2250
341 Ga0207687_10308023 3300025927 Bacteria 1278
342 Ga0207700_10039357 3300025928 Bacteria 3441
343 Ga0207700_10138754 3300025928 Bacteria 1995
344 Ga0207700_10464229 3300025928 Bacteria 1117
345 Ga0207664_10011014 3300025929 Bacteria 6406
346 Ga0207664_10012346 3300025929 Bacteria 6104
347 Ga0207664_10020690 3300025929 Bacteria 4883
348 Ga0207664_10143149 3300025929 Bacteria 2025
349 Ga0207644_10008318 3300025931 Bacteria 6798
350 Ga0207644_10030492 3300025931 Bacteria 3751
351 Ga0207644_10045195 3300025931 Bacteria 3132
352 Ga0207644_10060810 3300025931 Bacteria 2734
353 Ga0207644_10128455 3300025931 Bacteria 1937
354 Ga0207690_10000570 3300025932 Bacteria 24099
355 Ga0207690_10034706 3300025932 Bacteria 3252
356 Ga0207690_10049094 3300025932 Bacteria 2811
357 Ga0207690_10121982 3300025932 Bacteria 1895
358 Ga0207690_10304430 3300025932 Bacteria 1248
359 Ga0207706_10002869 3300025933 Bacteria 16715
360 Ga0207706_10023910 3300025933 Bacteria 5482
361 Ga0207706_10043165 3300025933 Bacteria 3996
362 Ga0207706_10099897 3300025933 Bacteria 2553
363 Ga0207706_10178458 3300025933 Bacteria 1865
364 Ga0207706_10315834 3300025933 Bacteria 1360
365 Ga0207686_10001274 3300025934 Bacteria 14490
366 Ga0207669_10215454 3300025937 Bacteria 1405
367 Ga0207704_10042277 3300025938 Bacteria 2681
368 Ga0207704_10109244 3300025938 Bacteria 1865
369 Ga0207665_10023021 3300025939 Bacteria 4102
370 Ga0207691_10022361 3300025940 Bacteria 5964
371 Ga0207691_10061285 3300025940 Bacteria 3418
372 Ga0207691_10076461 3300025940 Bacteria 3017
373 Ga0207691_10114709 3300025940 Bacteria 2393
374 Ga0207691_10224715 3300025940 Bacteria 1627
375 Ga0207711_10000185 3300025941 Bacteria 66575
376 Ga0207711_10052991 3300025941 Bacteria 3479
377 Ga0207711_10162532 3300025941 Bacteria 2022
378 Ga0207689_10018027 3300025942 Bacteria 5962
379 Ga0207679_10001351 3300025945 Bacteria 15480
380 Ga0207679_10006923 3300025945 Bacteria 7184
381 Ga0207679_10018895 3300025945 Bacteria 4624
382 Ga0207679_10061794 3300025945 Bacteria 2789
383 Ga0207679_10359370 3300025945 Bacteria 1271
384 Ga0207667_10001296 3300025949 Bacteria 31332
385 Ga0207667_10011272 3300025949 Bacteria 10397
386 Ga0207667_10027194 3300025949 Bacteria 6233
387 Ga0207667_10042620 3300025949 Bacteria 4823
388 Ga0207667_10061305 3300025949 Bacteria 3935
389 Ga0207667_10332064 3300025949 Bacteria 1552
390 Ga0207651_10021776 3300025960 Bacteria 3903
391 Ga0207651_10164937 3300025960 Bacteria 1741
392 Ga0207651_10167871 3300025960 Bacteria 1727
393 Ga0207651_10226743 3300025960 Bacteria 1514
394 Ga0207668_10037038 3300025972 Bacteria 3261
395 Ga0207668_10241277 3300025972 Bacteria 1462
396 Ga0207640_10101492 3300025981 Bacteria 2019
397 Ga0207640_10111971 3300025981 Bacteria 1937
398 Ga0207658_10059358 3300025986 Bacteria 2850
399 Ga0207658_10089112 3300025986 Bacteria 2387
400 Ga0207658_10178235 3300025986 Bacteria 1757
401 Ga0207658_10201314 3300025986 Bacteria 1663
402 Ga0207658_10201431 3300025986 Bacteria 1662
403 Ga0207658_10251758 3300025986 Bacteria 1501
404 Ga0207677_10000148 3300026023 Bacteria 56316
405 Ga0207677_10103738 3300026023 Bacteria 2100
406 Ga0207703_10001265 3300026035 Bacteria 23535
407 Ga0207639_10007621 3300026041 Bacteria 7383
408 Ga0207639_10236968 3300026041 Bacteria 1585
409 Ga0207678_10007326 3300026067 Bacteria 9771
410 Ga0207678_10021175 3300026067 Bacteria 5699
411 Ga0207678_10022857 3300026067 Bacteria 5474
412 Ga0207678_10098624 3300026067 Bacteria 2496
413 Ga0207708_10081910 3300026075 Bacteria 2481
414 Ga0207708_10106218 3300026075 Bacteria 2177
415 Ga0207702_10000248 3300026078 Bacteria 62667
416 Ga0207702_10014304 3300026078 Bacteria 6588
417 Ga0207702_10023342 3300026078 Bacteria 5129
418 Ga0207702_10270943 3300026078 Bacteria 1601
419 Ga0207702_10487627 3300026078 Bacteria 1200
420 Ga0207702_10655218 3300026078 Bacteria 1033
421 Ga0207702_10888588 3300026078 Bacteria 883
422 Ga0207641_10001602 3300026088 Bacteria 22081
423 Ga0207641_10132051 3300026088 Bacteria 2243
424 Ga0207641_10562765 3300026088 Bacteria 1113
425 Ga0207648_10157838 3300026089 Bacteria 2003
426 Ga0207648_10199291 3300026089 Bacteria 1775
427 Ga0207676_10003750 3300026095 Bacteria 10737
428 Ga0207676_10005043 3300026095 Bacteria 9344
429 Ga0207676_10075795 3300026095 Bacteria 2715
430 Ga0207676_10093106 3300026095 Bacteria 2480
431 Ga0207676_10483158 3300026095 Bacteria 1173
432 Ga0207674_10000180 3300026116 Bacteria 77710
433 Ga0207674_10000446 3300026116 Bacteria 53731
434 Ga0207674_10005309 3300026116 Bacteria 15327
435 Ga0207674_10082860 3300026116 Bacteria 3208
436 Ga0207675_100032077 3300026118 Bacteria 4893
437 Ga0207675_100074444 3300026118 Bacteria 3178
438 Ga0207675_100102657 3300026118 Bacteria 2695
439 Ga0207683_10001594 3300026121 Bacteria 20407
440 Ga0207683_10003833 3300026121 Bacteria 13030
441 Ga0207683_10044209 3300026121 Bacteria 3894
442 Ga0207683_10050131 3300026121 Bacteria 3656
443 Ga0207698_10016941 3300026142 Bacteria 4930
444 Ga0207698_10168068 3300026142 Bacteria 1928
445 Ga0207698_10618641 3300026142 Bacteria 1069
446 Ga0209968_1008793 3300027526 Bacteria 1541
447 Ga0209982_1026594 3300027552 Bacteria 903
448 Ga0209970_1013496 3300027614 Bacteria 1355
449 Ga0210002_1017229 3300027617 Bacteria 1148
450 Ga0209983_1001872 3300027665 Bacteria 4676
451 Ga0209983_1002117 3300027665 Bacteria 4377
452 Ga0209971_1005136 3300027682 Bacteria 3108
453 Ga0209966_1026053 3300027695 Bacteria 1163
454 Ga0209974_10004034 3300027876 Bacteria 5250
455 Ga0209974_10005633 3300027876 Bacteria 4397
456 Ga0268266_10011410 3300028379 Bacteria 7726
457 Ga0268266_10023660 3300028379 Bacteria 5228
458 Ga0268266_10103838 3300028379 Bacteria 2509
459 Ga0268265_10067325 3300028380 Bacteria 2772
460 Ga0268265_10154830 3300028380 Bacteria 1938
461 Ga0268265_10311872 3300028380 Bacteria 1421
462 Ga0268264_10143705 3300028381 Bacteria 2131
463 Ga0268264_10223172 3300028381 Bacteria 1736
464 Ga0307408_100025978 3300031548 Bacteria 4015
465 Ga0316579_10029264 3300031691 Bacteria 2512
466 Ga0316578_10005681 3300031728 Bacteria 6074
467 Ga0307405_10004498 3300031731 Bacteria 6598
468 Ga0307405_10010332 3300031731 Bacteria 4829
469 Ga0307413_10006415 3300031824 Bacteria 5367
470 Ga0307413_10017018 3300031824 Bacteria 3776
471 Ga0307410_10026171 3300031852 Bacteria 3669
472 Ga0307410_10027922 3300031852 Bacteria 3572
473 Ga0307410_10044036 3300031852 Bacteria 2962
474 Ga0307406_10009779 3300031901 Bacteria 5393
475 Ga0307406_10036912 3300031901 Bacteria 3014
476 Ga0307406_10226743 3300031901 Bacteria 1392
477 Ga0307412_10024781 3300031911 Bacteria 3707
478 Ga0307409_100027275 3300031995 Bacteria 4045
479 Ga0307409_100076768 3300031995 Bacteria 2680
480 Ga0307409_100151575 3300031995 Bacteria 2013
481 Ga0307416_100019100 3300032002 Bacteria 4850
482 Ga0307416_100119194 3300032002 Bacteria 2347
483 Ga0307414_10079030 3300032004 Bacteria 2400
484 Ga0307414_10129382 3300032004 Bacteria 1957
485 Ga0307411_10027531 3300032005 Bacteria 3441
486 Ga0307411_10252049 3300032005 Bacteria 1388
487 Ga0307415_100001525 3300032126 Bacteria 11110
488 Ga0307415_100007295 3300032126 Bacteria 6037
489 Ga0316583_10028813 3300032133 Bacteria 1980
490 Ga0373926_0035295 3300035083 Bacteria 1773
491 Ga0373928_0044586 3300035084 Bacteria 1030
492 Ga0373934_0061614 3300035086 Bacteria 1495
493 Ga0373923_0001887 3300035111 Bacteria 6250
494 Ga0373936_0054554 3300035113 Bacteria 1621
495 Ga0373939_0034570 3300035114 Bacteria 1484
496 Ga0373945_0021395 3300035116 Bacteria 2222
497 Ga0373953_0018860 3300035117 Bacteria 2558
498 Ga0373954_0002327 3300035118 Bacteria 7927
499 Ga0373943_0329920 3300035170 Bacteria 871
500 Ga0373946_0043796 3300035171 Bacteria 1845
501 Ga0373931_0275508 3300035691 Bacteria 1031
502 Ga0373931_0329766 3300035691 Bacteria 950
503 Ga0373935_0104966 3300035692 Bacteria 1868
504 Ga0373935_0106272 3300035692 Bacteria 1857
505 Ga0373927_0008580 3300035695 Bacteria 6866
506 Ga0373933_0008512 3300035724 Bacteria 5597
507 Ga0373933_0201346 3300035724 Bacteria 1274
508 Ga0373947_0007437 3300035725 Bacteria 6342
509 Ga0373947_0086043 3300035725 Bacteria 1953
510 Ga0373947_0221153 3300035725 Bacteria 1245
511 Ga0373937_0312931 3300036401 Bacteria 1485
512 Ga0373937_0340981 3300036401 Bacteria 1419
513 Ga0373937_0513402 3300036401 Bacteria 1138
514 Ga0316582_0046022 3300036647 Bacteria 2749
515 Ga0316584_0273513 3300036712 Bacteria 1229
516 Ga0373925_0019995 3300037068 Bacteria 4871
517 Ga0373925_0040194 3300037068 Bacteria 3462
518 Ga0395899_0135339 3300037312 Bacteria 1756
519 Ga0395898_0429765 3300037466 Bacteria 1258
520 Ga0395905_0130781 3300037471 Bacteria 2361
521 Ga0395901_0101617 3300038443 Bacteria 3017
522 Ga0436361_0632156 3300039447 Bacteria 31235
523 Ga0436361_1004314 3300039447 Bacteria 2797
524 Ga0439446_0037087 3300042156 Bacteria 1426
525 Ga0450893_0019074 3300042532 Bacteria 1172
526 Ga0466967_0854158 3300045976 Bacteria 905
527 Ga0495592_0390647 3300046454 Bacteria 883
528 Ga0495629_0010501 3300046459 Bacteria 6736
529 Ga0495653_0106873 3300046463 Bacteria 2017
530 Ga0495580_0026568 3300046472 Bacteria 4220
531 Ga0495580_0314673 3300046472 Bacteria 1064
532 Ga0495582_0078841 3300046473 Bacteria 1827
533 Ga0495639_0061393 3300046475 Bacteria 1723
534 Ga0495662_0011204 3300046476 Bacteria 4383
535 Ga0495594_0100017 3300046499 Bacteria 1631
536 Ga0495630_0107849 3300046517 Bacteria 2109
537 Ga0495665_0004127 3300046531 Bacteria 7831
538 Ga0495640_0110276 3300046533 Bacteria 1799
539 Ga0495587_0038102 3300046536 Bacteria 2884
540 Ga0495634_0095810 3300046642 Bacteria 1922
541 Ga0495635_0100722 3300046663 Bacteria 1974
542 Ga0495588_0121661 3300046674 Bacteria 1376
543 Ga0495623_0097911 3300046679 Bacteria 1791
544 Ga0495647_0031500 3300046681 Bacteria 1972
545 Ga0495669_0057367 3300046684 Bacteria 1757
546 Ga0495613_0010482 3300046689 Bacteria 6881
547 Ga0495600_0051536 3300046809 Bacteria 2686
548 Ga0495604_0045696 3300047317 Bacteria 3417
549 Ga0495674_0307014 3300047319 Bacteria 1295
550 Ga0495680_0025519 3300047322 Bacteria 4889
551 Ga0495684_0044936 3300047471 Bacteria 3380
552 Ga0495593_0019516 3300047673 Bacteria 3800
553 Ga0495602_0102769 3300048088 Bacteria 2341
554 Ga0496101_0032087 3300048904 Bacteria 3695
555 Ga0496101_0037668 3300048904 Bacteria 3432
556 Ga0496102_0003428 3300048905 Bacteria 13442
557 Ga0496102_0357176 3300048905 Bacteria 1375
558 Ga0496104_0008812 3300048907 Bacteria 8969
559 Ga0496105_0002462 3300048908 Bacteria 13400
560 Ga0496106_0000938 3300048909 Bacteria 21249
561 Ga0496106_0020440 3300048909 Bacteria 4913
562 Ga0496106_0119945 3300048909 Bacteria 2055
563 Ga0496108_0073133 3300048911 Bacteria 2895
564 Ga0496108_0278354 3300048911 Bacteria 1457
565 Ga0496108_0285301 3300048911 Bacteria 1437
566 Ga0496109_0004526 3300048912 Bacteria 11617
567 Ga0496109_0260089 3300048912 Bacteria 1635
568 Ga0496110_0149004 3300048913 Bacteria 2118
569 Ga0496110_0283661 3300048913 Bacteria 1508
570 Ga0496111_0148559 3300048914 Bacteria 1738
571 Ga0496112_0001578 3300048915 Bacteria 17624
572 Ga0496112_0003046 3300048915 Bacteria 13716
573 Ga0496112_0209099 3300048915 Bacteria 1909
574 Ga0496114_0600093 3300048917 Bacteria 971
575 Ga0496115_0293815 3300048918 Bacteria 1332
576 Ga0501042_0071185 3300049578 Bacteria 2488
577 Ga0501048_0160561 3300049582 Bacteria 1591
578 Ga0501067_0142981 3300049583 Bacteria 1333
579 Ga0501068_0261444 3300049584 Bacteria 1104
580 Ga0501072_0497539 3300049588 Bacteria 964
581 Ga0501045_0064548 3300049824 Bacteria 2688
582 nmdc:mga0n895_103232_c1 3300050512 Bacteria 2862
583 nmdc:mga0n895_117546_c1 3300050512 Bacteria 2678
584 nmdc:mga0n895_212724_c1 3300050512 Bacteria 1963
585 nmdc:mga0rr50_219798_c1 3300050513 Bacteria 1568
586 nmdc:mga08x19_129465_c1 3300050514 Bacteria 1696
587 Ga0495601_0132960 3300053077 Bacteria 1621
588 Ga0495612_0086103 3300053078 Bacteria 1325
589 Ga0495595_0041664 3300053084 Bacteria 2102
590 Ga0495619_0004965 3300053085 Bacteria 8451
591 Ga0495619_0232645 3300053085 Bacteria 1277
592 Ga0070678_100002693
593 JGI24738J21930_10027976
594 rootL2_10004552
595 Ga0070658_10021731
596 Ga0070658_10032073
597 Ga0070658_10044961
598 Ga0070683_100015121
599 Ga0070683_100025792
600 Ga0070683_100077584
601 Ga0070683_100140866
602 Ga0070690_100003569
603 Ga0070690_100079409
604 Ga0070670_100001357
605 Ga0070670_100022193
606 Ga0070670_100034974
607 Ga0070670_100092795
608 Ga0070670_100219445
609 Ga0068869_100047018
610 Ga0070666_10011040
611 Ga0070666_10114311
612 Ga0070666_10126446
613 Ga0070680_100083046
614 Ga0070682_100186862
615 Ga0068868_100016809
616 Ga0070660_100024210
617 Ga0070660_100111640
618 Ga0070660_100254099
619 Ga0070689_100051068
620 Ga0070661_100003414
621 Ga0070661_100004272
622 Ga0070661_100058057
623 Ga0070661_100125577
624 Ga0070661_100155421
625 Ga0070661_100234329
626 Ga0070661_100333047
627 Ga0070692_10041785
628 Ga0070668_100004012
629 Ga0070668_100007230
630 Ga0070668_100035423
631 Ga0070668_100222361
632 Ga0070668_100314643
633 Ga0070668_100473303
634 Ga0070669_100093601
635 Ga0070675_100028044
636 Ga0070675_100029419
637 Ga0070671_100008842
638 Ga0070671_100013306
639 Ga0070671_100100523
640 Ga0070674_100003849
641 Ga0070674_100070657
642 Ga0070674_100180669
643 Ga0070673_100072751
644 Ga0070673_100227227
645 Ga0070688_100001381
646 Ga0070659_100001024
647 Ga0070659_100064294
648 Ga0070659_100235555
649 Ga0070667_100031755
650 Ga0070667_100081128
651 Ga0070667_100135499
652 Ga0070667_100382428
653 Ga0070667_100461460
654 Ga0070709_10001537
655 Ga0070709_10287570
656 Ga0070709_10317150
657 Ga0070714_100007228
658 Ga0070714_100011883
659 Ga0070714_100025967
660 Ga0070714_100041927
661 Ga0070714_100253641
662 Ga0070713_100006114
663 Ga0070713_100006522
664 Ga0070713_100171530
665 Ga0070710_10004419
666 Ga0070710_10205558
667 Ga0070711_100012264
668 Ga0070711_100034524
669 Ga0070705_100007352
670 Ga0070700_100086077
671 Ga0070708_100183766
672 Ga0070663_100006694
673 Ga0070663_100027085
674 Ga0070663_100028880
675 Ga0070678_100246527
676 Ga0070662_100000907
677 Ga0070662_100014165
678 Ga0070662_100047379
679 Ga0070662_100136388
680 Ga0070662_100258752
681 Ga0070681_10002650
682 Ga0070681_10121970
683 Ga0068867_100005656
684 Ga0068867_100453656
685 Ga0070685_10004420
686 Ga0070706_100112707
687 Ga0070706_100119240
688 Ga0070706_100176832
689 Ga0070706_100177140
690 Ga0070707_100019681
691 Ga0070707_100068280
692 Ga0070707_100213744
693 Ga0070698_100077819
694 Ga0070698_100096520
695 Ga0070699_100044793
696 Ga0070679_100003190
697 Ga0070679_100050486
698 Ga0070679_100119130
699 Ga0070679_100237187
700 Ga0070679_100437710
701 Ga0070684_100002779
702 Ga0070684_100003996
703 Ga0070697_100017968
704 Ga0068853_100017495
705 Ga0068853_100249998
706 Ga0070672_100006329
707 Ga0070672_100145852
708 Ga0070672_100276601
709 Ga0070672_100411852
710 Ga0070695_100009019
711 Ga0070696_100004002
712 Ga0070696_100295189
713 Ga0070665_100001378
714 Ga0070665_100017516
715 Ga0070665_100540887
716 Ga0070704_100034772
717 Ga0068855_100000852
718 Ga0068855_100002157
719 Ga0068855_100055477
720 Ga0068855_100100334
721 Ga0068855_100463460
722 Ga0068855_100626423
723 Ga0070664_100001435
724 Ga0070664_100030377
725 Ga0070664_100051442
726 Ga0070664_100075687
727 Ga0070664_100257240
728 Ga0070664_100351556
729 Ga0068857_100000326
730 Ga0068857_100039110
731 Ga0068857_100048437
732 Ga0068857_100208506
733 Ga0068857_100350784
734 Ga0068854_100001495
735 Ga0068854_100096122
736 Ga0068854_100132787
737 Ga0068854_100245414
738 Ga0068856_100000664
739 Ga0068856_100040565
740 Ga0068856_100093569
741 Ga0068856_100093806
742 Ga0068856_100277375
743 Ga0068856_100582765
744 Ga0070702_100024702
745 Ga0068852_100031925
746 Ga0068852_100044062
747 Ga0068852_100050839
748 Ga0068852_100152455
749 Ga0068852_100374515
750 Ga0068859_100198156
751 Ga0068864_100000221
752 Ga0068864_100002525
753 Ga0068864_100049509
754 Ga0068864_100104212
755 Ga0068864_100416297
756 Ga0068866_10002008
757 Ga0068866_10029218
758 Ga0068866_10201551
759 Ga0068861_100074498
760 Ga0068861_100119639
761 Ga0068861_100122947
762 Ga0068861_100187613
763 Ga0068851_10001475
764 Ga0068870_10019909
765 Ga0068863_100000366
766 Ga0068863_100002529
767 Ga0068863_100173378
768 Ga0068863_100220694
769 Ga0068858_100004035
770 Ga0068858_100008616
771 Ga0068858_100033471
772 Ga0068860_100002003
773 Ga0068860_100075439
774 Ga0068860_100151477
775 Ga0068860_100238272
776 Ga0070712_100002168
777 Ga0070712_100047648
778 Ga0070712_100317018
779 Ga0097621_100010473
780 Ga0097621_100169567
781 Ga0097621_100216890
782 Ga0097621_100784816
783 Ga0068871_100011074
784 Ga0068871_100311282
785 Ga0075434_100055090
786 Ga0075434_100370722
787 Ga0075434_100378778
788 Ga0068865_100059930
789 Ga0068865_100112277
790 Ga0097620_100198159
791 Ga0105240_10023857
792 Ga0105240_10036275
793 Ga0105240_10792527
794 Ga0111539_10097714
795 Ga0105245_10054742
796 Ga0105245_10089098
797 Ga0105245_10236982
798 Ga0114129_10458322
799 Ga0114129_10987461
800 Ga0105243_10175284
801 Ga0105241_10011819
802 Ga0105241_10039343
803 Ga0105241_10049950
804 Ga0105241_10128793
805 Ga0105242_10005949
806 Ga0105242_10013861
807 Ga0105248_10071446
808 Ga0105248_10098500
809 Ga0105248_10152640
810 Ga0105248_10436659
811 Ga0105248_10800780
812 Ga0105238_10000556
813 Ga0105238_10036136
814 Ga0105238_10661970
815 Ga0105238_10742157
816 Ga0105239_10032530
817 Ga0105239_10612416
818 Ga0105239_10748444
819 Ga0157373_10000524
820 Ga0157373_10165805
821 Ga0157373_10442709
822 Ga0157371_10007017
823 Ga0157371_10023516
824 Ga0157371_10083620
825 Ga0157371_10151122
826 Ga0157370_10015030
827 Ga0157370_10044920
828 Ga0157370_10045045
829 Ga0157370_10052750
830 Ga0157370_10224932
831 Ga0157369_10002003
832 Ga0157369_10069729
833 Ga0157369_10165723
834 Ga0157369_10260702
835 Ga0157374_10007595
836 Ga0157374_10181908
837 Ga0157378_10017983
838 Ga0157378_10028289
839 Ga0163162_10123798
840 Ga0163162_10525548
841 Ga0163162_10666504
842 Ga0163162_10715381
843 Ga0157372_10002597
844 Ga0157372_10019154
845 Ga0157372_10049528
846 Ga0157372_10064414
847 Ga0157372_10084274
848 Ga0157372_10109676
849 Ga0157372_10334242
850 Ga0157372_10648913
851 Ga0157375_10008960
852 Ga0157375_10010810
853 Ga0157375_10306406
854 Ga0157375_10353896
855 Ga0163163_10012877
856 Ga0163163_10016705
857 Ga0163163_10049049
858 Ga0163163_10403894
859 Ga0163163_10588635
860 Ga0157380_10018326
861 Ga0157380_10036173
862 Ga0157380_10201637
863 Ga0182008_10088563
864 Ga0157379_10046159
865 Ga0157379_10054562
866 Ga0157379_10357673
867 Ga0157376_10039178
868 Ga0157376_10332706
869 Ga0157376_10374692
870 Ga0163161_10009300
871 Ga0206353_10186902
872 Ga0213872_10000955
873 Ga0213872_10026420
874 Ga0207697_10191923
875 Ga0207656_10060524
876 Ga0207682_10024574
877 Ga0207692_10198132
878 Ga0207642_10032924
879 Ga0207642_10212792
880 Ga0207688_10166865
881 Ga0207688_10319345
882 Ga0207680_10005392
883 Ga0207685_10141340
884 Ga0207699_10278253
885 Ga0207699_10287502
886 Ga0207699_10346120
887 Ga0207645_10052198
888 Ga0207705_10061805
889 Ga0207705_10129552
890 Ga0207684_10127446
891 Ga0207684_10145445
892 Ga0207684_10195702
893 Ga0207654_10008869
894 Ga0207654_10010966
895 Ga0207654_10090138
896 Ga0207707_10004820
897 Ga0207707_10006977
898 Ga0207707_10016589
899 Ga0207695_10027063
900 Ga0207695_10034713
901 Ga0207695_10062439
902 Ga0207693_10000364
903 Ga0207663_10008165
904 Ga0207663_10035559
905 Ga0207660_10025690
906 Ga0207662_10012895
907 Ga0207657_10000315
908 Ga0207657_10000469
909 Ga0207657_10002076
910 Ga0207657_10036278
911 Ga0207649_10004554
912 Ga0207649_10019311
913 Ga0207649_10038912
914 Ga0207649_10178435
915 Ga0207652_10040586
916 Ga0207652_10187943
917 Ga0207652_10242046
918 Ga0207646_10015263
919 Ga0207681_10026058
920 Ga0207681_10066694
921 Ga0207694_10005605
922 Ga0207694_10031879
923 Ga0207694_10684749
924 Ga0207650_10000403
925 Ga0207650_10033642
926 Ga0207650_10035471
927 Ga0207650_10057502
928 Ga0207650_10374807
929 Ga0207659_10045808
930 Ga0207659_10093552
931 Ga0207687_10088790
932 Ga0207687_10308023
933 Ga0207700_10039357
934 Ga0207700_10138754
935 Ga0207700_10464229
936 Ga0207664_10011014
937 Ga0207664_10012346
938 Ga0207664_10020690
939 Ga0207664_10143149
940 Ga0207644_10008318
941 Ga0207644_10030492
942 Ga0207644_10045195
943 Ga0207644_10060810
944 Ga0207644_10128455
945 Ga0207690_10000570
946 Ga0207690_10034706
947 Ga0207690_10049094
948 Ga0207690_10121982
949 Ga0207690_10304430
950 Ga0207706_10002869
951 Ga0207706_10023910
952 Ga0207706_10043165
953 Ga0207706_10099897
954 Ga0207706_10178458
955 Ga0207706_10315834
956 Ga0207686_10001274
957 Ga0207669_10215454
958 Ga0207704_10042277
959 Ga0207704_10109244
960 Ga0207665_10023021
961 Ga0207691_10022361
962 Ga0207691_10061285
963 Ga0207691_10076461
964 Ga0207691_10114709
965 Ga0207691_10224715
966 Ga0207711_10000185
967 Ga0207711_10052991
968 Ga0207711_10162532
969 Ga0207689_10018027
970 Ga0207679_10001351
971 Ga0207679_10006923
972 Ga0207679_10018895
973 Ga0207679_10061794
974 Ga0207679_10359370
975 Ga0207667_10001296
976 Ga0207667_10011272
977 Ga0207667_10027194
978 Ga0207667_10042620
979 Ga0207667_10061305
980 Ga0207667_10332064
981 Ga0207651_10021776
982 Ga0207651_10164937
983 Ga0207651_10167871
984 Ga0207651_10226743
985 Ga0207668_10037038
986 Ga0207668_10241277
987 Ga0207640_10101492
988 Ga0207640_10111971
989 Ga0207658_10059358
990 Ga0207658_10089112
991 Ga0207658_10178235
992 Ga0207658_10201314
993 Ga0207658_10201431
994 Ga0207658_10251758
995 Ga0207677_10000148
996 Ga0207677_10103738
997 Ga0207703_10001265
998 Ga0207639_10007621
999 Ga0207639_10236968
1000 Ga0207678_10007326
1001 Ga0207678_10021175
1002 Ga0207678_10022857
1003 Ga0207678_10098624
1004 Ga0207708_10081910
1005 Ga0207708_10106218
1006 Ga0207702_10000248
1007 Ga0207702_10014304
1008 Ga0207702_10023342
1009 Ga0207702_10270943
1010 Ga0207702_10487627
1011 Ga0207702_10655218
1012 Ga0207702_10888588
1013 Ga0207641_10001602
1014 Ga0207641_10132051
1015 Ga0207641_10562765
1016 Ga0207648_10157838
1017 Ga0207648_10199291
1018 Ga0207676_10003750
1019 Ga0207676_10005043
1020 Ga0207676_10075795
1021 Ga0207676_10093106
1022 Ga0207676_10483158
1023 Ga0207674_10000180
1024 Ga0207674_10000446
1025 Ga0207674_10005309
1026 Ga0207674_10082860
1027 Ga0207675_100032077
1028 Ga0207675_100074444
1029 Ga0207675_100102657
1030 Ga0207683_10001594
1031 Ga0207683_10003833
1032 Ga0207683_10044209
1033 Ga0207683_10050131
1034 Ga0207698_10016941
1035 Ga0207698_10168068
1036 Ga0207698_10618641
1037 Ga0209968_1008793
1038 Ga0209982_1026594
1039 Ga0209970_1013496
1040 Ga0210002_1017229
1041 Ga0209983_1001872
1042 Ga0209983_1002117
1043 Ga0209971_1005136
1044 Ga0209966_1026053
1045 Ga0209974_10004034
1046 Ga0209974_10005633
1047 Ga0268266_10011410
1048 Ga0268266_10023660
1049 Ga0268266_10103838
1050 Ga0268265_10067325
1051 Ga0268265_10154830
1052 Ga0268265_10311872
1053 Ga0268264_10143705
1054 Ga0268264_10223172
1055 Ga0307408_100025978
1056 Ga0316579_10029264
1057 Ga0316578_10005681
1058 Ga0307405_10004498
1059 Ga0307405_10010332
1060 Ga0307413_10006415
1061 Ga0307413_10017018
1062 Ga0307410_10026171
1063 Ga0307410_10027922
1064 Ga0307410_10044036
1065 Ga0307406_10009779
1066 Ga0307406_10036912
1067 Ga0307406_10226743
1068 Ga0307412_10024781
1069 Ga0307409_100027275
1070 Ga0307409_100076768
1071 Ga0307409_100151575
1072 Ga0307416_100019100
1073 Ga0307416_100119194
1074 Ga0307414_10079030
1075 Ga0307414_10129382
1076 Ga0307411_10027531
1077 Ga0307411_10252049
1078 Ga0307415_100001525
1079 Ga0307415_100007295
1080 Ga0316583_10028813
1081 Ga0373926_0035295
1082 Ga0373928_0044586
1083 Ga0373934_0061614
1084 Ga0373923_0001887
1085 Ga0373936_0054554
1086 Ga0373939_0034570
1087 Ga0373945_0021395
1088 Ga0373953_0018860
1089 Ga0373954_0002327
1090 Ga0373943_0329920
1091 Ga0373946_0043796
1092 Ga0373931_0275508
1093 Ga0373931_0329766
1094 Ga0373935_0104966
1095 Ga0373935_0106272
1096 Ga0373927_0008580
1097 Ga0373933_0008512
1098 Ga0373933_0201346
1099 Ga0373947_0007437
1100 Ga0373947_0086043
1101 Ga0373947_0221153
1102 Ga0373937_0312931
1103 Ga0373937_0340981
1104 Ga0373937_0513402
1105 Ga0316582_0046022
1106 Ga0316584_0273513
1107 Ga0373925_0019995
1108 Ga0373925_0040194
1109 Ga0395899_0135339
1110 Ga0395898_0429765
1111 Ga0395905_0130781
1112 Ga0395901_0101617
1113 Ga0436361_0632156
1114 Ga0436361_1004314
1115 Ga0439446_0037087
1116 Ga0450893_0019074
1117 Ga0466967_0854158
1118 Ga0495592_0390647
1119 Ga0495629_0010501
1120 Ga0495653_0106873
1121 Ga0495580_0026568
1122 Ga0495580_0314673
1123 Ga0495582_0078841
1124 Ga0495639_0061393
1125 Ga0495662_0011204
1126 Ga0495594_0100017
1127 Ga0495630_0107849
1128 Ga0495665_0004127
1129 Ga0495640_0110276
1130 Ga0495587_0038102
1131 Ga0495634_0095810
1132 Ga0495635_0100722
1133 Ga0495588_0121661
1134 Ga0495623_0097911
1135 Ga0495647_0031500
1136 Ga0495669_0057367
1137 Ga0495613_0010482
1138 Ga0495600_0051536
1139 Ga0495604_0045696
1140 Ga0495674_0307014
1141 Ga0495680_0025519
1142 Ga0495684_0044936
1143 Ga0495593_0019516
1144 Ga0495602_0102769
1145 Ga0496101_0032087
1146 Ga0496101_0037668
1147 Ga0496102_0003428
1148 Ga0496102_0357176
1149 Ga0496104_0008812
1150 Ga0496105_0002462
1151 Ga0496106_0000938
1152 Ga0496106_0020440
1153 Ga0496106_0119945
1154 Ga0496108_0073133
1155 Ga0496108_0278354
1156 Ga0496108_0285301
1157 Ga0496109_0004526
1158 Ga0496109_0260089
1159 Ga0496110_0149004
1160 Ga0496110_0283661
1161 Ga0496111_0148559
1162 Ga0496112_0001578
1163 Ga0496112_0003046
1164 Ga0496112_0209099
1165 Ga0496114_0600093
1166 Ga0496115_0293815
1167 Ga0501042_0071185
1168 Ga0501048_0160561
1169 Ga0501067_0142981
1170 Ga0501068_0261444
1171 Ga0501072_0497539
1172 Ga0501045_0064548
1173 nmdc:mga0n895_103232_c1
1174 nmdc:mga0n895_117546_c1
1175 nmdc:mga0n895_212724_c1
1176 nmdc:mga0rr50_219798_c1
1177 nmdc:mga08x19_129465_c1
1178 Ga0495601_0132960
1179 Ga0495612_0086103
1180 Ga0495595_0041664
1181 Ga0495619_0004965
1182 Ga0495619_0232645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

29

239

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7701 3 218
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.7487 3 214
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7327 3 218
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.7104 3 214
8scx-assembly1.cif.gz_B cryo-em structure of the core tim23 complex from s. cerevisiae 0.4164 101 217
ID Description Score Start End Superfamily
af_B3WFV1_75_234_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4788 111 219 1.10.490.10
af_P0AG93_119_318_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4331 56 224 1.20.1640.10
af_Q09934_632_831_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.392 29 227 1.20.1640.10
af_Q09934_632_831_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3892 29 227 1.20.1640.10
af_P0AG93_119_318_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3833 56 224 1.20.1640.10
ID Description Score Start End GO Terms
AF-A1YH70-F1-model_v4 TatC 0.8778 2 112 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A536U6W8-F1-model_v4 Twin-arginine translocase subunit TatC 0.8715 2 131 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A840MKX8-F1-model_v4 Sec-independent protein translocase protein TatC 0.8696 2 217 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A2X3FQ92-F1-model_v4 Twin-arginine translocation protein TatC 0.8692 2 121 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A520S556-F1-model_v4 Sec-independent protein translocase subunit TatC 0.8679 2 116 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Map