F466990
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 262 | 575 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300042007|Ga0439449_0094886|Ga0439449_0094886_628_1017 |
| Length | 129 |
| Sequence | MSVPINRLTESFAVAPQLSPDDMAAVAAAGFKSVIINRPDYEGGPDQPTAAAVSEAALNAGLKVEYQPVVSGGMTAEDVALFGQLLEKLPQPVLAYCRTGTRCTNLFVASQQSASRSQRGPGPGIDPQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 5 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 8 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 9 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 10 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 11 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 12 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 13 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 14 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 139 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 140 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 145 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 146 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 166 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 175 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 176 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 177 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 178 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 179 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 180 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 186 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 187 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 188 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 217 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 218 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 219 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 220 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 221 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 222 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 223 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 224 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 225 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 226 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 227 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 228 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 233 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 234 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 235 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 236 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 237 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 241 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 245 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 247 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 248 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 249 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 250 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 251 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 252 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 253 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 254 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 256 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 257 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 258 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 259 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 261 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.46 |
| Metatranscriptomes | 0 |
| Isolates | 2.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.47 |
| Nodule | 0.34 |
| Rhizoplane | 2.88 |
| Rhizosphere | 80.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1008231 | 3300002773 | Bacteria | 2606 |
| 2 | JGI25153J46596_10000996 | 3300003215 | Bacteria | 17188 |
| 3 | JGI25153J46596_10003477 | 3300003215 | Bacteria | 8809 |
| 4 | Ga0055526_1014058 | 3300003771 | Bacteria | 3325 |
| 5 | Ga0055530_10003267 | 3300003791 | Bacteria | 9431 |
| 6 | Ga0065165_1000613 | 3300005262 | Bacteria | 51836 |
| 7 | Ga0065165_1002866 | 3300005262 | Bacteria | 13317 |
| 8 | Ga0070658_10715002 | 3300005327 | Bacteria | 870 |
| 9 | Ga0070658_11399790 | 3300005327 | Bacteria | 607 |
| 10 | Ga0070676_10012268 | 3300005328 | Bacteria | 4673 |
| 11 | Ga0070676_10027596 | 3300005328 | Bacteria | 3220 |
| 12 | Ga0070676_10085154 | 3300005328 | Bacteria | 1925 |
| 13 | Ga0070676_10176031 | 3300005328 | Bacteria | 1388 |
| 14 | Ga0070676_10274896 | 3300005328 | Bacteria | 1133 |
| 15 | Ga0070676_10349101 | 3300005328 | Bacteria | 1017 |
| 16 | Ga0070676_10731175 | 3300005328 | Bacteria | 725 |
| 17 | Ga0070690_101187444 | 3300005330 | Bacteria | 608 |
| 18 | Ga0070670_100013636 | 3300005331 | Bacteria | 6965 |
| 19 | Ga0070670_100049061 | 3300005331 | Bacteria | 3631 |
| 20 | Ga0070670_100051811 | 3300005331 | Bacteria | 3524 |
| 21 | Ga0070670_100094920 | 3300005331 | Bacteria | 2565 |
| 22 | Ga0070670_100100127 | 3300005331 | Bacteria | 2494 |
| 23 | Ga0070670_100347009 | 3300005331 | Bacteria | 1303 |
| 24 | Ga0070670_100524844 | 3300005331 | Bacteria | 1055 |
| 25 | Ga0070670_100843976 | 3300005331 | Bacteria | 829 |
| 26 | Ga0070670_101718009 | 3300005331 | Unclassified | 578 |
| 27 | Ga0070677_10001509 | 3300005333 | Bacteria | 7370 |
| 28 | Ga0070677_10047482 | 3300005333 | Bacteria | 1721 |
| 29 | Ga0070677_10059075 | 3300005333 | Bacteria | 1576 |
| 30 | Ga0070677_10069930 | 3300005333 | Bacteria | 1474 |
| 31 | Ga0070677_10645569 | 3300005333 | Bacteria | 591 |
| 32 | Ga0068869_100024693 | 3300005334 | Bacteria | 4165 |
| 33 | Ga0068869_101176350 | 3300005334 | Bacteria | 673 |
| 34 | Ga0068869_101385859 | 3300005334 | Bacteria | 622 |
| 35 | Ga0068869_101919934 | 3300005334 | Bacteria | 531 |
| 36 | Ga0070666_10158417 | 3300005335 | Bacteria | 1582 |
| 37 | Ga0070666_10409488 | 3300005335 | Bacteria | 975 |
| 38 | Ga0070666_11515148 | 3300005335 | Bacteria | 502 |
| 39 | Ga0068868_100034050 | 3300005338 | Bacteria | 3931 |
| 40 | Ga0068868_100186265 | 3300005338 | Bacteria | 1725 |
| 41 | Ga0068868_100214972 | 3300005338 | Bacteria | 1608 |
| 42 | Ga0068868_100422401 | 3300005338 | Bacteria | 1154 |
| 43 | Ga0068868_100751597 | 3300005338 | Bacteria | 876 |
| 44 | Ga0070660_100264192 | 3300005339 | Bacteria | 1406 |
| 45 | Ga0070689_100324720 | 3300005340 | Bacteria | 1286 |
| 46 | Ga0070661_100250424 | 3300005344 | Bacteria | 1367 |
| 47 | Ga0070661_100998872 | 3300005344 | Bacteria | 694 |
| 48 | Ga0070668_100004749 | 3300005347 | Bacteria | 10080 |
| 49 | Ga0070668_100252510 | 3300005347 | Bacteria | 1464 |
| 50 | Ga0070669_100004931 | 3300005353 | Bacteria | 9640 |
| 51 | Ga0070669_100005812 | 3300005353 | Bacteria | 8897 |
| 52 | Ga0070669_100260405 | 3300005353 | Bacteria | 1384 |
| 53 | Ga0070669_100378281 | 3300005353 | Bacteria | 1154 |
| 54 | Ga0070675_100060429 | 3300005354 | Bacteria | 3129 |
| 55 | Ga0070675_100107739 | 3300005354 | Bacteria | 2353 |
| 56 | Ga0070675_101533680 | 3300005354 | Bacteria | 615 |
| 57 | Ga0070671_100003667 | 3300005355 | Bacteria | 12035 |
| 58 | Ga0070671_100044017 | 3300005355 | Bacteria | 3709 |
| 59 | Ga0070671_100062955 | 3300005355 | Bacteria | 3089 |
| 60 | Ga0070671_100088819 | 3300005355 | Bacteria | 2587 |
| 61 | Ga0070671_100179923 | 3300005355 | Bacteria | 1790 |
| 62 | Ga0070674_100006142 | 3300005356 | Bacteria | 6982 |
| 63 | Ga0070674_100026379 | 3300005356 | Bacteria | 3794 |
| 64 | Ga0070674_100027028 | 3300005356 | Bacteria | 3756 |
| 65 | Ga0070674_100649309 | 3300005356 | Bacteria | 897 |
| 66 | Ga0070673_100009720 | 3300005364 | Bacteria | 6470 |
| 67 | Ga0070673_100046038 | 3300005364 | Bacteria | 3386 |
| 68 | Ga0070673_100223579 | 3300005364 | Bacteria | 1630 |
| 69 | Ga0070673_100359782 | 3300005364 | Bacteria | 1293 |
| 70 | Ga0070673_100483061 | 3300005364 | Bacteria | 1118 |
| 71 | Ga0070673_100770357 | 3300005364 | Bacteria | 887 |
| 72 | Ga0070673_100803485 | 3300005364 | Bacteria | 869 |
| 73 | Ga0070688_101101631 | 3300005365 | Bacteria | 635 |
| 74 | Ga0070667_100003317 | 3300005367 | Bacteria | 13761 |
| 75 | Ga0070667_100014226 | 3300005367 | Bacteria | 6573 |
| 76 | Ga0070667_100377070 | 3300005367 | Bacteria | 1288 |
| 77 | Ga0070667_100717114 | 3300005367 | Bacteria | 926 |
| 78 | Ga0070667_101135574 | 3300005367 | Bacteria | 731 |
| 79 | Ga0070701_10615094 | 3300005438 | Bacteria | 721 |
| 80 | Ga0070700_100408130 | 3300005441 | Bacteria | 1023 |
| 81 | Ga0070663_100161435 | 3300005455 | Bacteria | 1725 |
| 82 | Ga0070663_102022445 | 3300005455 | Bacteria | 519 |
| 83 | Ga0070663_102111821 | 3300005455 | Bacteria | 508 |
| 84 | Ga0070678_100072719 | 3300005456 | Bacteria | 2579 |
| 85 | Ga0070678_100123918 | 3300005456 | Bacteria | 2042 |
| 86 | Ga0070678_100335204 | 3300005456 | Bacteria | 1296 |
| 87 | Ga0070678_100429393 | 3300005456 | Bacteria | 1153 |
| 88 | Ga0070678_100490454 | 3300005456 | Bacteria | 1082 |
| 89 | Ga0070678_100531525 | 3300005456 | Bacteria | 1042 |
| 90 | Ga0070678_100938621 | 3300005456 | Bacteria | 793 |
| 91 | Ga0070678_101070796 | 3300005456 | Bacteria | 743 |
| 92 | Ga0070662_100028972 | 3300005457 | Bacteria | 3859 |
| 93 | Ga0070662_101168204 | 3300005457 | Unclassified | 661 |
| 94 | Ga0068867_100000085 | 3300005459 | Bacteria | 58473 |
| 95 | Ga0068867_100017886 | 3300005459 | Bacteria | 5035 |
| 96 | Ga0068867_100237600 | 3300005459 | Bacteria | 1476 |
| 97 | Ga0068867_100294488 | 3300005459 | Bacteria | 1335 |
| 98 | Ga0068867_100708892 | 3300005459 | Bacteria | 889 |
| 99 | Ga0068867_101700351 | 3300005459 | Bacteria | 592 |
| 100 | Ga0070685_10580770 | 3300005466 | Bacteria | 804 |
| 101 | Ga0070698_101132972 | 3300005471 | Bacteria | 731 |
| 102 | Ga0070672_100017990 | 3300005543 | Bacteria | 5099 |
| 103 | Ga0070672_100023511 | 3300005543 | Bacteria | 4544 |
| 104 | Ga0070672_100062850 | 3300005543 | Bacteria | 2931 |
| 105 | Ga0070672_100065940 | 3300005543 | Bacteria | 2865 |
| 106 | Ga0070672_100405307 | 3300005543 | Bacteria | 1169 |
| 107 | Ga0070672_100925897 | 3300005543 | Bacteria | 770 |
| 108 | Ga0070672_101054378 | 3300005543 | Bacteria | 722 |
| 109 | Ga0070686_100274335 | 3300005544 | Bacteria | 1241 |
| 110 | Ga0070665_100071010 | 3300005548 | Bacteria | 3488 |
| 111 | Ga0070665_100307537 | 3300005548 | Bacteria | 1588 |
| 112 | Ga0070665_100645562 | 3300005548 | Bacteria | 1071 |
| 113 | Ga0070665_101040022 | 3300005548 | Bacteria | 831 |
| 114 | Ga0068855_101140991 | 3300005563 | Bacteria | 813 |
| 115 | Ga0070664_100320722 | 3300005564 | Bacteria | 1404 |
| 116 | Ga0070664_100325278 | 3300005564 | Bacteria | 1394 |
| 117 | Ga0070664_100456573 | 3300005564 | Bacteria | 1173 |
| 118 | Ga0070664_100834613 | 3300005564 | Bacteria | 862 |
| 119 | Ga0068854_100178109 | 3300005578 | Bacteria | 1659 |
| 120 | Ga0068852_100046991 | 3300005616 | Bacteria | 3680 |
| 121 | Ga0068852_100363624 | 3300005616 | Bacteria | 1416 |
| 122 | Ga0068852_100657581 | 3300005616 | Unclassified | 1056 |
| 123 | Ga0068859_100050320 | 3300005617 | Bacteria | 4186 |
| 124 | Ga0068859_100183425 | 3300005617 | Bacteria | 2176 |
| 125 | Ga0068859_100516332 | 3300005617 | Bacteria | 1290 |
| 126 | Ga0068864_100023736 | 3300005618 | Bacteria | 5153 |
| 127 | Ga0068864_100035418 | 3300005618 | Bacteria | 4249 |
| 128 | Ga0068864_100487137 | 3300005618 | Bacteria | 1184 |
| 129 | Ga0068864_100619454 | 3300005618 | Bacteria | 1052 |
| 130 | Ga0068864_100654099 | 3300005618 | Bacteria | 1023 |
| 131 | Ga0068864_100695477 | 3300005618 | Bacteria | 993 |
| 132 | Ga0068866_10006663 | 3300005718 | Bacteria | 4817 |
| 133 | Ga0068866_10771229 | 3300005718 | Bacteria | 666 |
| 134 | Ga0068861_100254351 | 3300005719 | Bacteria | 1500 |
| 135 | Ga0068861_100938408 | 3300005719 | Bacteria | 822 |
| 136 | Ga0068851_10047765 | 3300005834 | Bacteria | 2169 |
| 137 | Ga0068851_10141868 | 3300005834 | Bacteria | 1307 |
| 138 | Ga0068851_10350278 | 3300005834 | Bacteria | 859 |
| 139 | Ga0068851_10380488 | 3300005834 | Bacteria | 827 |
| 140 | Ga0068870_10060960 | 3300005840 | Bacteria | 2027 |
| 141 | Ga0068863_100014193 | 3300005841 | Bacteria | 7674 |
| 142 | Ga0068863_100037925 | 3300005841 | Bacteria | 4586 |
| 143 | Ga0068863_100129756 | 3300005841 | Bacteria | 2406 |
| 144 | Ga0068863_100397394 | 3300005841 | Bacteria | 1348 |
| 145 | Ga0068863_101024468 | 3300005841 | Bacteria | 829 |
| 146 | Ga0068863_102485322 | 3300005841 | Bacteria | 527 |
| 147 | Ga0068858_100010943 | 3300005842 | Bacteria | 8575 |
| 148 | Ga0068860_100028165 | 3300005843 | Bacteria | 5408 |
| 149 | Ga0068860_100324206 | 3300005843 | Bacteria | 1512 |
| 150 | Ga0068860_101164481 | 3300005843 | Bacteria | 791 |
| 151 | Ga0068860_101179606 | 3300005843 | Bacteria | 786 |
| 152 | Ga0068862_100141087 | 3300005844 | Bacteria | 2139 |
| 153 | Ga0068862_102791602 | 3300005844 | Bacteria | 500 |
| 154 | Ga0097621_100081987 | 3300006237 | Bacteria | 2685 |
| 155 | Ga0097621_100756762 | 3300006237 | Bacteria | 898 |
| 156 | Ga0097621_102299376 | 3300006237 | Bacteria | 516 |
| 157 | Ga0075370_10001130 | 3300006353 | Bacteria | 11191 |
| 158 | Ga0075370_10306622 | 3300006353 | Bacteria | 945 |
| 159 | Ga0068871_100057992 | 3300006358 | Bacteria | 3152 |
| 160 | Ga0068871_100206018 | 3300006358 | Bacteria | 1700 |
| 161 | Ga0068871_100250229 | 3300006358 | Bacteria | 1543 |
| 162 | Ga0068871_100552836 | 3300006358 | Bacteria | 1043 |
| 163 | Ga0068871_101092957 | 3300006358 | Unclassified | 745 |
| 164 | Ga0068865_100021793 | 3300006881 | Bacteria | 4171 |
| 165 | Ga0068865_100185259 | 3300006881 | Bacteria | 1606 |
| 166 | Ga0068865_100434739 | 3300006881 | Bacteria | 1082 |
| 167 | Ga0068865_100486375 | 3300006881 | Bacteria | 1027 |
| 168 | Ga0068865_100794356 | 3300006881 | Bacteria | 816 |
| 169 | Ga0097620_100050319 | 3300006931 | Bacteria | 4186 |
| 170 | Ga0097620_100183432 | 3300006931 | Bacteria | 2176 |
| 171 | Ga0097620_100516313 | 3300006931 | Bacteria | 1290 |
| 172 | Ga0111539_10522078 | 3300009094 | Bacteria | 1383 |
| 173 | Ga0111539_11287014 | 3300009094 | Bacteria | 849 |
| 174 | Ga0105245_10091026 | 3300009098 | Bacteria | 2807 |
| 175 | Ga0105245_10197183 | 3300009098 | Bacteria | 1932 |
| 176 | Ga0105245_11780477 | 3300009098 | Bacteria | 669 |
| 177 | Ga0105245_12782977 | 3300009098 | Bacteria | 542 |
| 178 | Ga0105243_10046051 | 3300009148 | Bacteria | 3429 |
| 179 | Ga0105241_12102059 | 3300009174 | Bacteria | 558 |
| 180 | Ga0105242_10102944 | 3300009176 | Bacteria | 2422 |
| 181 | Ga0105242_13018297 | 3300009176 | Bacteria | 521 |
| 182 | Ga0105248_10008728 | 3300009177 | Bacteria | 11134 |
| 183 | Ga0105248_10152958 | 3300009177 | Bacteria | 2603 |
| 184 | Ga0105248_10217120 | 3300009177 | Bacteria | 2154 |
| 185 | Ga0105248_10403275 | 3300009177 | Bacteria | 1539 |
| 186 | Ga0105248_10406583 | 3300009177 | Bacteria | 1533 |
| 187 | Ga0105248_10433870 | 3300009177 | Bacteria | 1480 |
| 188 | Ga0105248_10437661 | 3300009177 | Bacteria | 1473 |
| 189 | Ga0105248_11665486 | 3300009177 | Bacteria | 723 |
| 190 | Ga0105237_10546956 | 3300009545 | Bacteria | 1164 |
| 191 | Ga0105249_10052344 | 3300009553 | Bacteria | 3728 |
| 192 | Ga0105239_10389954 | 3300010375 | Bacteria | 1575 |
| 193 | Ga0157374_10025500 | 3300013296 | Bacteria | 5309 |
| 194 | Ga0157374_10566869 | 3300013296 | Bacteria | 1144 |
| 195 | Ga0157374_10723401 | 3300013296 | Bacteria | 1009 |
| 196 | Ga0157378_10037022 | 3300013297 | Bacteria | 4320 |
| 197 | Ga0157378_10751674 | 3300013297 | Bacteria | 998 |
| 198 | Ga0157378_10989006 | 3300013297 | Bacteria | 875 |
| 199 | Ga0157378_11296375 | 3300013297 | Bacteria | 769 |
| 200 | Ga0157378_11873670 | 3300013297 | Bacteria | 648 |
| 201 | Ga0163162_10070427 | 3300013306 | Bacteria | 3548 |
| 202 | Ga0163162_10096444 | 3300013306 | Bacteria | 3045 |
| 203 | Ga0163162_10329941 | 3300013306 | Bacteria | 1658 |
| 204 | Ga0163162_10447357 | 3300013306 | Bacteria | 1424 |
| 205 | Ga0163162_11854613 | 3300013306 | Bacteria | 690 |
| 206 | Ga0157375_10034082 | 3300013308 | Bacteria | 4846 |
| 207 | Ga0157375_10070238 | 3300013308 | Bacteria | 3511 |
| 208 | Ga0157375_10117617 | 3300013308 | Bacteria | 2764 |
| 209 | Ga0157375_10380379 | 3300013308 | Bacteria | 1578 |
| 210 | Ga0157375_10737897 | 3300013308 | Bacteria | 1137 |
| 211 | Ga0163163_10124389 | 3300014325 | Bacteria | 2615 |
| 212 | Ga0163163_10347531 | 3300014325 | Bacteria | 1539 |
| 213 | Ga0163163_10379434 | 3300014325 | Bacteria | 1471 |
| 214 | Ga0163163_11278999 | 3300014325 | Bacteria | 796 |
| 215 | Ga0157380_10016562 | 3300014326 | Bacteria | 5438 |
| 216 | Ga0157380_10321458 | 3300014326 | Bacteria | 1435 |
| 217 | Ga0157380_11612673 | 3300014326 | Bacteria | 704 |
| 218 | Ga0157380_11618520 | 3300014326 | Bacteria | 703 |
| 219 | Ga0157377_10000028 | 3300014745 | Bacteria | 134810 |
| 220 | Ga0157379_10073383 | 3300014968 | Bacteria | 3063 |
| 221 | Ga0157379_10132738 | 3300014968 | Bacteria | 2242 |
| 222 | Ga0157379_10660248 | 3300014968 | Bacteria | 979 |
| 223 | Ga0157379_11259822 | 3300014968 | Bacteria | 713 |
| 224 | Ga0157379_11397789 | 3300014968 | Bacteria | 678 |
| 225 | Ga0157376_10216193 | 3300014969 | Bacteria | 1772 |
| 226 | Ga0157376_10353261 | 3300014969 | Bacteria | 1407 |
| 227 | Ga0157376_10471148 | 3300014969 | Bacteria | 1229 |
| 228 | Ga0157376_11062921 | 3300014969 | Bacteria | 834 |
| 229 | Ga0157376_11216848 | 3300014969 | Bacteria | 782 |
| 230 | Ga0157376_12219093 | 3300014969 | Bacteria | 588 |
| 231 | Ga0163161_10026997 | 3300017792 | Bacteria | 4071 |
| 232 | Ga0163161_10033682 | 3300017792 | Bacteria | 3661 |
| 233 | Ga0163161_10067370 | 3300017792 | Bacteria | 2615 |
| 234 | Ga0207425_1000519 | 3300025245 | Bacteria | 23496 |
| 235 | Ga0209129_1000075 | 3300025258 | Bacteria | 201273 |
| 236 | Ga0209565_1054691 | 3300025263 | Bacteria | 706 |
| 237 | Ga0209673_1003475 | 3300025273 | Bacteria | 9256 |
| 238 | Ga0209673_1006240 | 3300025273 | Bacteria | 5813 |
| 239 | Ga0209673_1029058 | 3300025273 | Bacteria | 1766 |
| 240 | Ga0209676_1013673 | 3300025292 | Bacteria | 3105 |
| 241 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 242 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 243 | Ga0209758_1000369 | 3300025297 | Bacteria | 79541 |
| 244 | Ga0209050_1000202 | 3300025298 | Bacteria | 133468 |
| 245 | Ga0209050_1005099 | 3300025298 | Bacteria | 8462 |
| 246 | Ga0209256_1013083 | 3300025299 | Bacteria | 3108 |
| 247 | Ga0209256_1031338 | 3300025299 | Bacteria | 1455 |
| 248 | Ga0209051_1007707 | 3300025303 | Bacteria | 5838 |
| 249 | Ga0207697_10170901 | 3300025315 | Bacteria | 951 |
| 250 | Ga0207656_10104221 | 3300025321 | Bacteria | 1304 |
| 251 | Ga0207656_10341611 | 3300025321 | Bacteria | 746 |
| 252 | Ga0207682_10002379 | 3300025893 | Bacteria | 8471 |
| 253 | Ga0207682_10005147 | 3300025893 | Bacteria | 5357 |
| 254 | Ga0207682_10117551 | 3300025893 | Bacteria | 1176 |
| 255 | Ga0207682_10578869 | 3300025893 | Bacteria | 530 |
| 256 | Ga0207642_10007496 | 3300025899 | Bacteria | 3690 |
| 257 | Ga0207642_10217534 | 3300025899 | Bacteria | 1066 |
| 258 | Ga0207688_10120375 | 3300025901 | Bacteria | 1531 |
| 259 | Ga0207688_10479570 | 3300025901 | Bacteria | 777 |
| 260 | Ga0207688_10900752 | 3300025901 | Bacteria | 560 |
| 261 | Ga0207680_10126619 | 3300025903 | Bacteria | 1678 |
| 262 | Ga0207680_10211636 | 3300025903 | Bacteria | 1326 |
| 263 | Ga0207680_10278073 | 3300025903 | Bacteria | 1163 |
| 264 | Ga0207645_10017366 | 3300025907 | Bacteria | 4750 |
| 265 | Ga0207645_10065530 | 3300025907 | Bacteria | 2322 |
| 266 | Ga0207645_10171202 | 3300025907 | Bacteria | 1423 |
| 267 | Ga0207643_10078138 | 3300025908 | Bacteria | 1914 |
| 268 | Ga0207649_10213642 | 3300025920 | Bacteria | 1370 |
| 269 | Ga0207649_10779845 | 3300025920 | Bacteria | 745 |
| 270 | Ga0207649_10899563 | 3300025920 | Bacteria | 694 |
| 271 | Ga0207681_10028924 | 3300025923 | Bacteria | 3593 |
| 272 | Ga0207681_10062019 | 3300025923 | Bacteria | 2572 |
| 273 | Ga0207681_10626196 | 3300025923 | Bacteria | 891 |
| 274 | Ga0207650_10001450 | 3300025925 | Bacteria | 17074 |
| 275 | Ga0207650_10006252 | 3300025925 | Bacteria | 8115 |
| 276 | Ga0207650_10094840 | 3300025925 | Bacteria | 2287 |
| 277 | Ga0207650_10452144 | 3300025925 | Bacteria | 1069 |
| 278 | Ga0207650_10540229 | 3300025925 | Bacteria | 977 |
| 279 | Ga0207650_10902911 | 3300025925 | Bacteria | 750 |
| 280 | Ga0207659_10037997 | 3300025926 | Bacteria | 3346 |
| 281 | Ga0207659_10045679 | 3300025926 | Bacteria | 3090 |
| 282 | Ga0207659_10124924 | 3300025926 | Bacteria | 1977 |
| 283 | Ga0207659_11063883 | 3300025926 | Bacteria | 696 |
| 284 | Ga0207687_10010456 | 3300025927 | Bacteria | 6059 |
| 285 | Ga0207687_10168888 | 3300025927 | Bacteria | 1685 |
| 286 | Ga0207687_10723387 | 3300025927 | Bacteria | 846 |
| 287 | Ga0207687_11043960 | 3300025927 | Bacteria | 701 |
| 288 | Ga0207687_11389816 | 3300025927 | Bacteria | 603 |
| 289 | Ga0207644_10009040 | 3300025931 | Bacteria | 6531 |
| 290 | Ga0207644_10022840 | 3300025931 | Bacteria | 4277 |
| 291 | Ga0207644_10171359 | 3300025931 | Bacteria | 1694 |
| 292 | Ga0207706_10052506 | 3300025933 | Bacteria | 3599 |
| 293 | Ga0207706_10384296 | 3300025933 | Bacteria | 1218 |
| 294 | Ga0207706_10945924 | 3300025933 | Bacteria | 726 |
| 295 | Ga0207686_10228519 | 3300025934 | Bacteria | 1347 |
| 296 | Ga0207709_10346432 | 3300025935 | Bacteria | 1120 |
| 297 | Ga0207670_10126568 | 3300025936 | Bacteria | 1865 |
| 298 | Ga0207669_10014175 | 3300025937 | Bacteria | 3988 |
| 299 | Ga0207669_10065172 | 3300025937 | Bacteria | 2258 |
| 300 | Ga0207669_10086912 | 3300025937 | Bacteria | 2023 |
| 301 | Ga0207669_10402379 | 3300025937 | Bacteria | 1073 |
| 302 | Ga0207704_10003573 | 3300025938 | Bacteria | 7066 |
| 303 | Ga0207704_10083915 | 3300025938 | Bacteria | 2069 |
| 304 | Ga0207704_10206759 | 3300025938 | Bacteria | 1441 |
| 305 | Ga0207704_10433843 | 3300025938 | Bacteria | 1045 |
| 306 | Ga0207691_10015818 | 3300025940 | Bacteria | 7170 |
| 307 | Ga0207691_10018444 | 3300025940 | Bacteria | 6613 |
| 308 | Ga0207691_10054934 | 3300025940 | Bacteria | 3632 |
| 309 | Ga0207691_10073621 | 3300025940 | Bacteria | 3081 |
| 310 | Ga0207691_10120371 | 3300025940 | Bacteria | 2327 |
| 311 | Ga0207691_10513520 | 3300025940 | Bacteria | 1017 |
| 312 | Ga0207691_10991036 | 3300025940 | Bacteria | 701 |
| 313 | Ga0207711_10010511 | 3300025941 | Bacteria | 7688 |
| 314 | Ga0207711_10013603 | 3300025941 | Bacteria | 6760 |
| 315 | Ga0207711_10236164 | 3300025941 | Bacteria | 1675 |
| 316 | Ga0207711_10388539 | 3300025941 | Bacteria | 1295 |
| 317 | Ga0207711_10428057 | 3300025941 | Bacteria | 1231 |
| 318 | Ga0207689_10020073 | 3300025942 | Bacteria | 5626 |
| 319 | Ga0207689_11083830 | 3300025942 | Bacteria | 675 |
| 320 | Ga0207679_10047544 | 3300025945 | Bacteria | 3118 |
| 321 | Ga0207679_10110106 | 3300025945 | Bacteria | 2172 |
| 322 | Ga0207679_10271438 | 3300025945 | Bacteria | 1451 |
| 323 | Ga0207679_10957504 | 3300025945 | Bacteria | 784 |
| 324 | Ga0207667_10781458 | 3300025949 | Bacteria | 953 |
| 325 | Ga0207651_10021817 | 3300025960 | Bacteria | 3901 |
| 326 | Ga0207651_10031277 | 3300025960 | Bacteria | 3400 |
| 327 | Ga0207651_10045261 | 3300025960 | Bacteria | 2950 |
| 328 | Ga0207651_10157750 | 3300025960 | Bacteria | 1775 |
| 329 | Ga0207712_10013145 | 3300025961 | Bacteria | 5304 |
| 330 | Ga0207668_10051620 | 3300025972 | Bacteria | 2841 |
| 331 | Ga0207668_10164748 | 3300025972 | Bacteria | 1731 |
| 332 | Ga0207640_10887244 | 3300025981 | Bacteria | 778 |
| 333 | Ga0207658_10003189 | 3300025986 | Bacteria | 11689 |
| 334 | Ga0207658_10006549 | 3300025986 | Bacteria | 7942 |
| 335 | Ga0207658_10118635 | 3300025986 | Bacteria | 2105 |
| 336 | Ga0207658_10145630 | 3300025986 | Bacteria | 1923 |
| 337 | Ga0207658_10697793 | 3300025986 | Bacteria | 917 |
| 338 | Ga0207658_11144940 | 3300025986 | Bacteria | 711 |
| 339 | Ga0207658_11262218 | 3300025986 | Bacteria | 675 |
| 340 | Ga0207677_10015594 | 3300026023 | Bacteria | 4476 |
| 341 | Ga0207677_10049686 | 3300026023 | Bacteria | 2832 |
| 342 | Ga0207677_10179612 | 3300026023 | Bacteria | 1664 |
| 343 | Ga0207677_10372637 | 3300026023 | Bacteria | 1203 |
| 344 | Ga0207677_10622818 | 3300026023 | Bacteria | 949 |
| 345 | Ga0207677_10681283 | 3300026023 | Bacteria | 910 |
| 346 | Ga0207703_10062899 | 3300026035 | Bacteria | 3041 |
| 347 | Ga0207678_10319364 | 3300026067 | Bacteria | 1336 |
| 348 | Ga0207708_10010592 | 3300026075 | Bacteria | 6847 |
| 349 | Ga0207641_10006217 | 3300026088 | Bacteria | 10101 |
| 350 | Ga0207641_10012361 | 3300026088 | Bacteria | 7003 |
| 351 | Ga0207641_10148927 | 3300026088 | Bacteria | 2118 |
| 352 | Ga0207641_10200863 | 3300026088 | Bacteria | 1838 |
| 353 | Ga0207641_10705541 | 3300026088 | Bacteria | 994 |
| 354 | Ga0207641_11031668 | 3300026088 | Bacteria | 820 |
| 355 | Ga0207648_10000146 | 3300026089 | Bacteria | 70573 |
| 356 | Ga0207648_10005079 | 3300026089 | Bacteria | 13337 |
| 357 | Ga0207648_10031809 | 3300026089 | Bacteria | 4663 |
| 358 | Ga0207648_10045581 | 3300026089 | Bacteria | 3846 |
| 359 | Ga0207648_10082049 | 3300026089 | Bacteria | 2812 |
| 360 | Ga0207648_10203297 | 3300026089 | Bacteria | 1757 |
| 361 | Ga0207648_10264334 | 3300026089 | Bacteria | 1536 |
| 362 | Ga0207648_10278213 | 3300026089 | Bacteria | 1496 |
| 363 | Ga0207648_10554974 | 3300026089 | Bacteria | 1055 |
| 364 | Ga0207676_10041792 | 3300026095 | Bacteria | 3522 |
| 365 | Ga0207676_10044926 | 3300026095 | Bacteria | 3410 |
| 366 | Ga0207676_10227127 | 3300026095 | Bacteria | 1666 |
| 367 | Ga0207676_11320480 | 3300026095 | Bacteria | 716 |
| 368 | Ga0207676_11799130 | 3300026095 | Bacteria | 611 |
| 369 | Ga0207675_100004297 | 3300026118 | Bacteria | 13767 |
| 370 | Ga0207675_101644906 | 3300026118 | Bacteria | 662 |
| 371 | Ga0207683_10013995 | 3300026121 | Bacteria | 6840 |
| 372 | Ga0207683_10025378 | 3300026121 | Bacteria | 5112 |
| 373 | Ga0207683_10100393 | 3300026121 | Bacteria | 2584 |
| 374 | Ga0207683_10109452 | 3300026121 | Bacteria | 2473 |
| 375 | Ga0207683_10226578 | 3300026121 | Bacteria | 1704 |
| 376 | Ga0207683_10234264 | 3300026121 | Bacteria | 1675 |
| 377 | Ga0207683_10267952 | 3300026121 | Bacteria | 1560 |
| 378 | Ga0207683_10800567 | 3300026121 | Bacteria | 875 |
| 379 | Ga0207683_10998049 | 3300026121 | Bacteria | 777 |
| 380 | Ga0207698_10563746 | 3300026142 | Bacteria | 1118 |
| 381 | Ga0209281_1026979 | 3300027111 | Bacteria | 1056 |
| 382 | Ga0209389_1024054 | 3300027296 | Bacteria | 5356 |
| 383 | Ga0209371_1025422 | 3300027312 | Bacteria | 1362 |
| 384 | Ga0268266_10099882 | 3300028379 | Bacteria | 2555 |
| 385 | Ga0268266_10422273 | 3300028379 | Bacteria | 1264 |
| 386 | Ga0268265_10128933 | 3300028380 | Bacteria | 2098 |
| 387 | Ga0268264_10068278 | 3300028381 | Bacteria | 3003 |
| 388 | Ga0268264_10083481 | 3300028381 | Bacteria | 2737 |
| 389 | Ga0268264_10217435 | 3300028381 | Bacteria | 1757 |
| 390 | Ga0268264_10391481 | 3300028381 | Bacteria | 1333 |
| 391 | Ga0268264_10512757 | 3300028381 | Bacteria | 1171 |
| 392 | Ga0268264_12694698 | 3300028381 | Bacteria | 501 |
| 393 | Ga0307517_10167594 | 3300028786 | Bacteria | 1454 |
| 394 | Ga0307515_10012290 | 3300028794 | Bacteria | 16114 |
| 395 | Ga0307515_10027144 | 3300028794 | Bacteria | 9806 |
| 396 | Ga0268256_1024468 | 3300030500 | Bacteria | 1549 |
| 397 | Ga0268256_1028922 | 3300030500 | Bacteria | 1362 |
| 398 | Ga0265328_10006677 | 3300031239 | Bacteria | 4858 |
| 399 | Ga0265328_10046030 | 3300031239 | Bacteria | 1604 |
| 400 | Ga0265327_10000184 | 3300031251 | Bacteria | 133023 |
| 401 | Ga0265316_10000115 | 3300031344 | Bacteria | 86934 |
| 402 | Ga0307513_10236577 | 3300031456 | Bacteria | 1635 |
| 403 | Ga0307513_10405874 | 3300031456 | Bacteria | 1096 |
| 404 | Ga0307408_100083242 | 3300031548 | Bacteria | 2397 |
| 405 | Ga0307408_100192225 | 3300031548 | Bacteria | 1645 |
| 406 | Ga0307408_101582587 | 3300031548 | Bacteria | 622 |
| 407 | Ga0307514_10227038 | 3300031649 | Bacteria | 1137 |
| 408 | Ga0307516_10402430 | 3300031730 | Bacteria | 1028 |
| 409 | Ga0307405_10004178 | 3300031731 | Bacteria | 6796 |
| 410 | Ga0307405_11821657 | 3300031731 | Bacteria | 541 |
| 411 | Ga0307413_10000382 | 3300031824 | Bacteria | 14204 |
| 412 | Ga0307413_10280659 | 3300031824 | Bacteria | 1253 |
| 413 | Ga0307413_10663488 | 3300031824 | Bacteria | 862 |
| 414 | Ga0307413_10825736 | 3300031824 | Bacteria | 781 |
| 415 | Ga0307410_10023271 | 3300031852 | Bacteria | 3848 |
| 416 | Ga0307410_10063639 | 3300031852 | Bacteria | 2531 |
| 417 | Ga0307410_10142693 | 3300031852 | Bacteria | 1774 |
| 418 | Ga0307410_10263405 | 3300031852 | Bacteria | 1345 |
| 419 | Ga0307406_10028686 | 3300031901 | Bacteria | 3364 |
| 420 | Ga0307406_10697564 | 3300031901 | Bacteria | 847 |
| 421 | Ga0307407_10740540 | 3300031903 | Bacteria | 743 |
| 422 | Ga0307412_10001248 | 3300031911 | Bacteria | 14402 |
| 423 | Ga0307412_10014839 | 3300031911 | Bacteria | 4605 |
| 424 | Ga0307412_10149333 | 3300031911 | Bacteria | 1722 |
| 425 | Ga0307412_10417928 | 3300031911 | Bacteria | 1096 |
| 426 | Ga0307409_100034041 | 3300031995 | Bacteria | 3716 |
| 427 | Ga0307409_100266732 | 3300031995 | Bacteria | 1575 |
| 428 | Ga0307409_101597123 | 3300031995 | Unclassified | 680 |
| 429 | Ga0307409_102721872 | 3300031995 | Bacteria | 523 |
| 430 | Ga0307416_100028719 | 3300032002 | Bacteria | 4142 |
| 431 | Ga0307416_100041838 | 3300032002 | Bacteria | 3572 |
| 432 | Ga0307416_100078096 | 3300032002 | Bacteria | 2784 |
| 433 | Ga0307416_100292283 | 3300032002 | Bacteria | 1614 |
| 434 | Ga0307414_10118315 | 3300032004 | Bacteria | 2032 |
| 435 | Ga0307414_10581199 | 3300032004 | Bacteria | 1002 |
| 436 | Ga0307411_10003562 | 3300032005 | Bacteria | 7250 |
| 437 | Ga0307411_10040610 | 3300032005 | Bacteria | 2953 |
| 438 | Ga0307411_10196799 | 3300032005 | Bacteria | 1544 |
| 439 | Ga0307411_10670025 | 3300032005 | Bacteria | 900 |
| 440 | Ga0307411_10714945 | 3300032005 | Bacteria | 874 |
| 441 | Ga0307411_10794084 | 3300032005 | Bacteria | 833 |
| 442 | Ga0307415_100078353 | 3300032126 | Bacteria | 2350 |
| 443 | Ga0307510_10001502 | 3300033180 | Bacteria | 25726 |
| 444 | Ga0373946_0110662 | 3300035171 | Bacteria | 1243 |
| 445 | Ga0373931_0907307 | 3300035691 | Bacteria | 592 |
| 446 | Ga0373925_0131292 | 3300037068 | Bacteria | 1953 |
| 447 | Ga0373925_0720811 | 3300037068 | Bacteria | 822 |
| 448 | Ga0395898_0376603 | 3300037466 | Bacteria | 1354 |
| 449 | Ga0395905_0003562 | 3300037471 | Bacteria | 16585 |
| 450 | Ga0395905_0027611 | 3300037471 | Bacteria | 5352 |
| 451 | Ga0436365_0636198 | 3300039437 | Bacteria | 614 |
| 452 | Ga0451795_1607973 | 3300041456 | Bacteria | 1676 |
| 453 | Ga0451800_1676192 | 3300041459 | Bacteria | 1877 |
| 454 | Ga0451833_0562403 | 3300041491 | Bacteria | 639 |
| 455 | Ga0439441_017973 | 3300042001 | Bacteria | 1275 |
| 456 | Ga0439449_0094886 | 3300042007 | Bacteria | 1102 |
| 457 | Ga0439450_002823 | 3300042008 | Bacteria | 2790 |
| 458 | Ga0439455_0020321 | 3300042012 | Bacteria | 1574 |
| 459 | Ga0439455_0025785 | 3300042012 | Bacteria | 1431 |
| 460 | Ga0450902_065066 | 3300042137 | Bacteria | 633 |
| 461 | Ga0439464_0015768 | 3300042439 | Bacteria | 2041 |
| 462 | Ga0466969_0058054 | 3300044656 | Bacteria | 1884 |
| 463 | Ga0466972_0030364 | 3300044658 | Bacteria | 2660 |
| 464 | Ga0466972_0262744 | 3300044658 | Bacteria | 807 |
| 465 | Ga0466965_0022645 | 3300044683 | Bacteria | 3029 |
| 466 | Ga0466965_0127947 | 3300044683 | Bacteria | 1315 |
| 467 | Ga0466965_0238955 | 3300044683 | Bacteria | 972 |
| 468 | Ga0466966_0114503 | 3300044684 | Bacteria | 1660 |
| 469 | Ga0466961_0560862 | 3300044693 | Bacteria | 687 |
| 470 | Ga0466961_0600584 | 3300044693 | Bacteria | 662 |
| 471 | Ga0466963_0037912 | 3300044694 | Bacteria | 3150 |
| 472 | Ga0466964_0004724 | 3300044706 | Bacteria | 5032 |
| 473 | Ga0466964_0254815 | 3300044706 | Bacteria | 867 |
| 474 | Ga0466971_0083046 | 3300044719 | Bacteria | 1462 |
| 475 | Ga0466970_0006015 | 3300044765 | Bacteria | 6049 |
| 476 | Ga0466957_0008708 | 3300044842 | Bacteria | 5780 |
| 477 | Ga0466960_0026574 | 3300044901 | Bacteria | 2631 |
| 478 | Ga0466959_0000371 | 3300045049 | Bacteria | 26505 |
| 479 | Ga0451576_0256394 | 3300045051 | Bacteria | 1828 |
| 480 | Ga0466958_0035526 | 3300045836 | Bacteria | 2977 |
| 481 | Ga0466967_0029942 | 3300045976 | Bacteria | 4562 |
| 482 | Ga0495638_0049265 | 3300046460 | Bacteria | 2634 |
| 483 | Ga0495653_0812535 | 3300046463 | Bacteria | 561 |
| 484 | Ga0495582_0488385 | 3300046473 | Bacteria | 712 |
| 485 | Ga0495632_0003371 | 3300046519 | Bacteria | 11383 |
| 486 | Ga0495597_0288816 | 3300046542 | Bacteria | 638 |
| 487 | Ga0495668_0045224 | 3300046616 | Bacteria | 2447 |
| 488 | Ga0495635_0187047 | 3300046663 | Bacteria | 1407 |
| 489 | Ga0495647_0106307 | 3300046681 | Bacteria | 1167 |
| 490 | Ga0495670_0044270 | 3300046691 | Bacteria | 2222 |
| 491 | Ga0495671_0037139 | 3300046692 | Bacteria | 2465 |
| 492 | Ga0495686_0485619 | 3300047472 | Bacteria | 652 |
| 493 | Ga0495686_0637678 | 3300047472 | Bacteria | 549 |
| 494 | Ga0496100_1296563 | 3300048903 | Bacteria | 575 |
| 495 | Ga0496102_0418951 | 3300048905 | Bacteria | 1258 |
| 496 | Ga0496104_0664428 | 3300048907 | Bacteria | 951 |
| 497 | Ga0496104_1517025 | 3300048907 | Bacteria | 573 |
| 498 | Ga0496108_0341169 | 3300048911 | Bacteria | 1307 |
| 499 | Ga0496108_1190219 | 3300048911 | Bacteria | 645 |
| 500 | Ga0496109_0168653 | 3300048912 | Bacteria | 2053 |
| 501 | Ga0496110_0051053 | 3300048913 | Bacteria | 3634 |
| 502 | Ga0496110_0999927 | 3300048913 | Bacteria | 744 |
| 503 | Ga0496110_1062157 | 3300048913 | Bacteria | 718 |
| 504 | Ga0496112_0017310 | 3300048915 | Bacteria | 6769 |
| 505 | Ga0496112_0889644 | 3300048915 | Bacteria | 813 |
| 506 | Ga0496113_0642871 | 3300048916 | Bacteria | 848 |
| 507 | Ga0496114_1127872 | 3300048917 | Bacteria | 669 |
| 508 | Ga0496116_0062807 | 3300048919 | Bacteria | 2396 |
| 509 | Ga0496116_0214846 | 3300048919 | Bacteria | 992 |
| 510 | Ga0496117_0056563 | 3300048920 | Bacteria | 2731 |
| 511 | Ga0496117_0058316 | 3300048920 | Bacteria | 2675 |
| 512 | Ga0496118_0007262 | 3300048921 | Bacteria | 11811 |
| 513 | Ga0496118_0035536 | 3300048921 | Bacteria | 4044 |
| 514 | Ga0496118_0280743 | 3300048921 | Bacteria | 927 |
| 515 | Ga0496119_0014412 | 3300048922 | Bacteria | 6191 |
| 516 | Ga0496119_0107698 | 3300048922 | Bacteria | 1553 |
| 517 | Ga0496120_0019231 | 3300048923 | Bacteria | 4375 |
| 518 | Ga0496121_0000748 | 3300048924 | Bacteria | 59722 |
| 519 | Ga0496121_0021987 | 3300048924 | Bacteria | 6215 |
| 520 | Ga0496121_0030262 | 3300048924 | Bacteria | 4975 |
| 521 | Ga0496122_0001323 | 3300048925 | Bacteria | 40594 |
| 522 | Ga0496122_0320601 | 3300048925 | Bacteria | 824 |
| 523 | Ga0496123_0000568 | 3300048926 | Bacteria | 63015 |
| 524 | Ga0496123_0083369 | 3300048926 | Bacteria | 1933 |
| 525 | Ga0496124_0000317 | 3300048927 | Bacteria | 89188 |
| 526 | Ga0496124_0028462 | 3300048927 | Bacteria | 4998 |
| 527 | Ga0496124_0367269 | 3300048927 | Bacteria | 1011 |
| 528 | Ga0496125_0000096 | 3300048928 | Bacteria | 205618 |
| 529 | Ga0496125_0014868 | 3300048928 | Bacteria | 7558 |
| 530 | Ga0496125_0070327 | 3300048928 | Bacteria | 2740 |
| 531 | Ga0496125_0712742 | 3300048928 | Bacteria | 531 |
| 532 | Ga0496126_0090143 | 3300048929 | Bacteria | 2698 |
| 533 | Ga0496126_0091471 | 3300048929 | Bacteria | 2675 |
| 534 | Ga0496126_0123004 | 3300048929 | Bacteria | 2248 |
| 535 | Ga0501292_000588 | 3300049515 | Bacteria | 4474 |
| 536 | Ga0501302_031871 | 3300049525 | Bacteria | 505 |
| 537 | Ga0501036_1573485 | 3300049572 | Bacteria | 531 |
| 538 | Ga0501038_0021274 | 3300049574 | Bacteria | 5825 |
| 539 | Ga0501047_0508078 | 3300049581 | Bacteria | 1031 |
| 540 | Ga0501198_000006 | 3300049649 | Bacteria | 129954 |
| 541 | Ga0501206_030296 | 3300049653 | Bacteria | 802 |
| 542 | Ga0501222_000007 | 3300049662 | Bacteria | 126703 |
| 543 | Ga0501246_043466 | 3300049676 | Bacteria | 544 |
| 544 | Ga0501262_023176 | 3300049759 | Bacteria | 862 |
| 545 | Ga0501265_003337 | 3300049762 | Bacteria | 1825 |
| 546 | Ga0501035_0022705 | 3300049822 | Bacteria | 5763 |
| 547 | Ga0501044_0011058 | 3300049823 | Bacteria | 9788 |
| 548 | nmdc:mga0k408_54542_c1 | 3300050493 | Bacteria | 2317 |
| 549 | nmdc:mga06z11_110842_c1 | 3300050494 | Bacteria | 1519 |
| 550 | nmdc:mga07m45_13125_c1 | 3300050496 | Bacteria | 3558 |
| 551 | nmdc:mga07m45_18526_c1 | 3300050496 | Bacteria | 3760 |
| 552 | nmdc:mga08y16_695277_c1 | 3300050511 | Bacteria | 1017 |
| 553 | Ga0500635_0439137 | 3300053080 | Bacteria | 517 |
| 554 | Ga0495655_0128863 | 3300053083 | Bacteria | 777 |
| 555 | Ga0500578_0001398 | 3300053086 | Bacteria | 24361 |
| 556 | Ga0500578_0059651 | 3300053086 | Bacteria | 2438 |
| 557 | Ga0500646_0050429 | 3300053090 | Bacteria | 1199 |
| 558 | Ga0500651_0041492 | 3300053093 | Bacteria | 2900 |
| 559 | Ga0500651_0122739 | 3300053093 | Bacteria | 1576 |
| 560 | Ga0500650_0076887 | 3300053098 | Bacteria | 1560 |
| 561 | Ga0500607_152417 | 3300053121 | Bacteria | 1069 |
| 562 | Ga0500628_006474 | 3300053129 | Bacteria | 1982 |
| 563 | Ga0500642_0000935 | 3300053130 | Bacteria | 8467 |
| 564 | Ga0500652_000807 | 3300053131 | Bacteria | 10505 |
| 565 | Ga0500652_074004 | 3300053131 | Bacteria | 1414 |
| 566 | Ga0500561_0149788 | 3300053137 | Bacteria | 726 |
| 567 | Ga0500568_0032786 | 3300053139 | Bacteria | 2134 |
| 568 | Ga0500577_0005790 | 3300053142 | Bacteria | 3363 |
| 569 | Ga0500604_0089754 | 3300053151 | Bacteria | 1002 |
| 570 | Ga0500622_0000599 | 3300053156 | Bacteria | 32760 |
| 571 | Ga0500622_0001554 | 3300053156 | Bacteria | 18138 |
| 572 | Ga0500636_0301964 | 3300053177 | Bacteria | 788 |
| 573 | Ga0500584_145099 | 3300053726 | Bacteria | 897 |
| 574 | Ga0500645_001454 | 3300053730 | Bacteria | 11959 |
| 575 | Ga0500587_018414 | 3300053739 | Bacteria | 899 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_1517025 | Ga0496104_1517025_13_294 | 91 |
| 2 | 3300048913 | Ga0496110_0999927 | Ga0496110_0999927_58_339 | 91 |
| 3 | 3300005334 | Ga0068869_101176350 | Ga0068869_1011763501 | 106 |
| 4 | 3300013296 | Ga0157374_10025500 | Ga0157374_100255003 | 106 |
| 5 | 3300013297 | Ga0157378_11296375 | Ga0157378_112963752 | 106 |
| 6 | iso_pu_bacteria | 2599185292 | 2599904513 | 109 |
| 7 | iso_pu_bacteria | 2643221569 | 2643861102 | 109 |
| 8 | iso_pu_bacteria | 2643221594 | 2643983447 | 109 |
| 9 | iso_pu_bacteria | 2643221621 | 2644124403 | 109 |
| 10 | iso_pu_bacteria | 2808606395 | 2809032640 | 109 |
| 11 | iso_pu_bacteria | 2857537821 | 2857542328 | 109 |
| 12 | iso_pu_bacteria | 2858950400 | 2858951238 | 109 |
| 13 | iso_pu_bacteria | 2941479691 | 2941485430 | 109 |
| 14 | iso_pu_bacteria | 2585428057 | 2587726733 | 110 |
| 15 | iso_pu_bacteria | 2585428058 | 2587733229 | 110 |
| 16 | iso_pu_bacteria | 2588253510 | 2588294349 | 110 |
| 17 | iso_pu_bacteria | 2643221592 | 2643969030 | 110 |
| 18 | iso_pu_bacteria | 2643221625 | 2644144161 | 110 |
| 19 | iso_pu_bacteria | 2643221648 | 2644273281 | 110 |
| 20 | iso_pu_bacteria | 2643221654 | 2644304289 | 110 |
| 21 | 3300005330 | Ga0070690_101187444 | Ga0070690_1011874441 | 112 |
| 22 | 3300005331 | Ga0070670_100094920 | Ga0070670_1000949203 | 112 |
| 23 | 3300005364 | Ga0070673_100359782 | Ga0070673_1003597823 | 112 |
| 24 | 3300005618 | Ga0068864_100619454 | Ga0068864_1006194541 | 112 |
| 25 | 3300009177 | Ga0105248_10437661 | Ga0105248_104376612 | 112 |
| 26 | 3300010375 | Ga0105239_10389954 | Ga0105239_103899542 | 112 |
| 27 | 3300013296 | Ga0157374_10723401 | Ga0157374_107234012 | 112 |
| 28 | 3300013306 | Ga0163162_11854613 | Ga0163162_118546132 | 112 |
| 29 | 3300025925 | Ga0207650_10006252 | Ga0207650_100062524 | 112 |
| 30 | 3300025926 | Ga0207659_10037997 | Ga0207659_100379974 | 112 |
| 31 | 3300025960 | Ga0207651_10021817 | Ga0207651_100218174 | 112 |
| 32 | 3300026088 | Ga0207641_11031668 | Ga0207641_110316682 | 112 |
| 33 | 3300048903 | Ga0496100_1296563 | Ga0496100_1296563_94_438 | 112 |
| 34 | 3300005262 | Ga0065165_1000613 | Ga0065165_100061324 | 113 |
| 35 | 3300005327 | Ga0070658_10715002 | Ga0070658_107150022 | 113 |
| 36 | 3300005328 | Ga0070676_10012268 | Ga0070676_100122683 | 113 |
| 37 | 3300005328 | Ga0070676_10176031 | Ga0070676_101760311 | 113 |
| 38 | 3300005328 | Ga0070676_10349101 | Ga0070676_103491012 | 113 |
| 39 | 3300005328 | Ga0070676_10731175 | Ga0070676_107311751 | 113 |
| 40 | 3300005331 | Ga0070670_100049061 | Ga0070670_1000490613 | 113 |
| 41 | 3300005331 | Ga0070670_100051811 | Ga0070670_1000518114 | 113 |
| 42 | 3300005331 | Ga0070670_100347009 | Ga0070670_1003470092 | 113 |
| 43 | 3300005331 | Ga0070670_100524844 | Ga0070670_1005248441 | 113 |
| 44 | 3300005331 | Ga0070670_100843976 | Ga0070670_1008439761 | 113 |
| 45 | 3300005331 | Ga0070670_101718009 | Ga0070670_1017180091 | 113 |
| 46 | 3300005333 | Ga0070677_10001509 | Ga0070677_100015097 | 113 |
| 47 | 3300005333 | Ga0070677_10059075 | Ga0070677_100590752 | 113 |
| 48 | 3300005333 | Ga0070677_10069930 | Ga0070677_100699302 | 113 |
| 49 | 3300005333 | Ga0070677_10645569 | Ga0070677_106455691 | 113 |
| 50 | 3300005334 | Ga0068869_100024693 | Ga0068869_1000246934 | 113 |
| 51 | 3300005334 | Ga0068869_101385859 | Ga0068869_1013858591 | 113 |
| 52 | 3300005335 | Ga0070666_10409488 | Ga0070666_104094882 | 113 |
| 53 | 3300005335 | Ga0070666_11515148 | Ga0070666_115151481 | 113 |
| 54 | 3300005338 | Ga0068868_100186265 | Ga0068868_1001862652 | 113 |
| 55 | 3300005338 | Ga0068868_100422401 | Ga0068868_1004224012 | 113 |
| 56 | 3300005338 | Ga0068868_100751597 | Ga0068868_1007515972 | 113 |
| 57 | 3300005339 | Ga0070660_100264192 | Ga0070660_1002641922 | 113 |
| 58 | 3300005344 | Ga0070661_100250424 | Ga0070661_1002504241 | 113 |
| 59 | 3300005344 | Ga0070661_100998872 | Ga0070661_1009988721 | 113 |
| 60 | 3300005347 | Ga0070668_100004749 | Ga0070668_1000047494 | 113 |
| 61 | 3300005353 | Ga0070669_100005812 | Ga0070669_1000058126 | 113 |
| 62 | 3300005353 | Ga0070669_100378281 | Ga0070669_1003782811 | 113 |
| 63 | 3300005354 | Ga0070675_100060429 | Ga0070675_1000604293 | 113 |
| 64 | 3300005354 | Ga0070675_100107739 | Ga0070675_1001077392 | 113 |
| 65 | 3300005354 | Ga0070675_101533680 | Ga0070675_1015336801 | 113 |
| 66 | 3300005355 | Ga0070671_100044017 | Ga0070671_1000440173 | 113 |
| 67 | 3300005355 | Ga0070671_100179923 | Ga0070671_1001799231 | 113 |
| 68 | 3300005356 | Ga0070674_100027028 | Ga0070674_1000270284 | 113 |
| 69 | 3300005356 | Ga0070674_100649309 | Ga0070674_1006493092 | 113 |
| 70 | 3300005364 | Ga0070673_100046038 | Ga0070673_1000460382 | 113 |
| 71 | 3300005364 | Ga0070673_100223579 | Ga0070673_1002235793 | 113 |
| 72 | 3300005364 | Ga0070673_100483061 | Ga0070673_1004830612 | 113 |
| 73 | 3300005364 | Ga0070673_100803485 | Ga0070673_1008034851 | 113 |
| 74 | 3300005365 | Ga0070688_101101631 | Ga0070688_1011016311 | 113 |
| 75 | 3300005367 | Ga0070667_100014226 | Ga0070667_1000142262 | 113 |
| 76 | 3300005367 | Ga0070667_101135574 | Ga0070667_1011355741 | 113 |
| 77 | 3300005438 | Ga0070701_10615094 | Ga0070701_106150941 | 113 |
| 78 | 3300005455 | Ga0070663_100161435 | Ga0070663_1001614351 | 113 |
| 79 | 3300005455 | Ga0070663_102022445 | Ga0070663_1020224451 | 113 |
| 80 | 3300005455 | Ga0070663_102111821 | Ga0070663_1021118211 | 113 |
| 81 | 3300005456 | Ga0070678_100123918 | Ga0070678_1001239183 | 113 |
| 82 | 3300005456 | Ga0070678_100335204 | Ga0070678_1003352042 | 113 |
| 83 | 3300005456 | Ga0070678_100429393 | Ga0070678_1004293932 | 113 |
| 84 | 3300005456 | Ga0070678_100490454 | Ga0070678_1004904542 | 113 |
| 85 | 3300005456 | Ga0070678_101070796 | Ga0070678_1010707961 | 113 |
| 86 | 3300005457 | Ga0070662_100028972 | Ga0070662_1000289724 | 113 |
| 87 | 3300005459 | Ga0068867_100000085 | Ga0068867_10000008550 | 113 |
| 88 | 3300005459 | Ga0068867_100017886 | Ga0068867_1000178864 | 113 |
| 89 | 3300005459 | Ga0068867_100708892 | Ga0068867_1007088922 | 113 |
| 90 | 3300005459 | Ga0068867_101700351 | Ga0068867_1017003511 | 113 |
| 91 | 3300005471 | Ga0070698_101132972 | Ga0070698_1011329721 | 113 |
| 92 | 3300005543 | Ga0070672_100023511 | Ga0070672_1000235114 | 113 |
| 93 | 3300005543 | Ga0070672_100062850 | Ga0070672_1000628502 | 113 |
| 94 | 3300005543 | Ga0070672_100065940 | Ga0070672_1000659403 | 113 |
| 95 | 3300005543 | Ga0070672_100405307 | Ga0070672_1004053072 | 113 |
| 96 | 3300005544 | Ga0070686_100274335 | Ga0070686_1002743352 | 113 |
| 97 | 3300005548 | Ga0070665_100307537 | Ga0070665_1003075371 | 113 |
| 98 | 3300005548 | Ga0070665_101040022 | Ga0070665_1010400222 | 113 |
| 99 | 3300005563 | Ga0068855_101140991 | Ga0068855_1011409912 | 113 |
| 100 | 3300005564 | Ga0070664_100325278 | Ga0070664_1003252781 | 113 |
| 101 | 3300005564 | Ga0070664_100456573 | Ga0070664_1004565732 | 113 |
| 102 | 3300005564 | Ga0070664_100834613 | Ga0070664_1008346132 | 113 |
| 103 | 3300005616 | Ga0068852_100046991 | Ga0068852_1000469912 | 113 |
| 104 | 3300005616 | Ga0068852_100363624 | Ga0068852_1003636242 | 113 |
| 105 | 3300005616 | Ga0068852_100657581 | Ga0068852_1006575811 | 113 |
| 106 | 3300005617 | Ga0068859_100050320 | Ga0068859_1000503202 | 113 |
| 107 | 3300005618 | Ga0068864_100035418 | Ga0068864_1000354184 | 113 |
| 108 | 3300005618 | Ga0068864_100487137 | Ga0068864_1004871373 | 113 |
| 109 | 3300005618 | Ga0068864_100654099 | Ga0068864_1006540992 | 113 |
| 110 | 3300005618 | Ga0068864_100695477 | Ga0068864_1006954772 | 113 |
| 111 | 3300005718 | Ga0068866_10006663 | Ga0068866_100066634 | 113 |
| 112 | 3300005719 | Ga0068861_100254351 | Ga0068861_1002543514 | 113 |
| 113 | 3300005834 | Ga0068851_10047765 | Ga0068851_100477653 | 113 |
| 114 | 3300005834 | Ga0068851_10380488 | Ga0068851_103804882 | 113 |
| 115 | 3300005841 | Ga0068863_100037925 | Ga0068863_1000379253 | 113 |
| 116 | 3300005841 | Ga0068863_100129756 | Ga0068863_1001297562 | 113 |
| 117 | 3300005841 | Ga0068863_100397394 | Ga0068863_1003973943 | 113 |
| 118 | 3300005841 | Ga0068863_102485322 | Ga0068863_1024853222 | 113 |
| 119 | 3300005842 | Ga0068858_100010943 | Ga0068858_1000109435 | 113 |
| 120 | 3300005843 | Ga0068860_100028165 | Ga0068860_1000281655 | 113 |
| 121 | 3300005843 | Ga0068860_101164481 | Ga0068860_1011644812 | 113 |
| 122 | 3300005844 | Ga0068862_100141087 | Ga0068862_1001410872 | 113 |
| 123 | 3300005844 | Ga0068862_102791602 | Ga0068862_1027916021 | 113 |
| 124 | 3300006237 | Ga0097621_100081987 | Ga0097621_1000819872 | 113 |
| 125 | 3300006237 | Ga0097621_102299376 | Ga0097621_1022993761 | 113 |
| 126 | 3300006353 | Ga0075370_10306622 | Ga0075370_103066222 | 113 |
| 127 | 3300006358 | Ga0068871_100250229 | Ga0068871_1002502292 | 113 |
| 128 | 3300006358 | Ga0068871_100552836 | Ga0068871_1005528362 | 113 |
| 129 | 3300006358 | Ga0068871_101092957 | Ga0068871_1010929572 | 113 |
| 130 | 3300006881 | Ga0068865_100021793 | Ga0068865_1000217934 | 113 |
| 131 | 3300006881 | Ga0068865_100434739 | Ga0068865_1004347392 | 113 |
| 132 | 3300006881 | Ga0068865_100486375 | Ga0068865_1004863752 | 113 |
| 133 | 3300006881 | Ga0068865_100794356 | Ga0068865_1007943562 | 113 |
| 134 | 3300006931 | Ga0097620_100050319 | Ga0097620_1000503192 | 113 |
| 135 | 3300009094 | Ga0111539_10522078 | Ga0111539_105220782 | 113 |
| 136 | 3300009094 | Ga0111539_11287014 | Ga0111539_112870142 | 113 |
| 137 | 3300009098 | Ga0105245_10197183 | Ga0105245_101971834 | 113 |
| 138 | 3300009098 | Ga0105245_11780477 | Ga0105245_117804772 | 113 |
| 139 | 3300009148 | Ga0105243_10046051 | Ga0105243_100460514 | 113 |
| 140 | 3300009176 | Ga0105242_10102944 | Ga0105242_101029444 | 113 |
| 141 | 3300009177 | Ga0105248_10008728 | Ga0105248_100087284 | 113 |
| 142 | 3300009177 | Ga0105248_10152958 | Ga0105248_101529583 | 113 |
| 143 | 3300009177 | Ga0105248_10217120 | Ga0105248_102171203 | 113 |
| 144 | 3300009177 | Ga0105248_10403275 | Ga0105248_104032752 | 113 |
| 145 | 3300009177 | Ga0105248_10406583 | Ga0105248_104065832 | 113 |
| 146 | 3300009177 | Ga0105248_10433870 | Ga0105248_104338702 | 113 |
| 147 | 3300009553 | Ga0105249_10052344 | Ga0105249_100523443 | 113 |
| 148 | 3300013297 | Ga0157378_10751674 | Ga0157378_107516741 | 113 |
| 149 | 3300013297 | Ga0157378_10989006 | Ga0157378_109890061 | 113 |
| 150 | 3300013306 | Ga0163162_10096444 | Ga0163162_100964443 | 113 |
| 151 | 3300013306 | Ga0163162_10447357 | Ga0163162_104473574 | 113 |
| 152 | 3300013308 | Ga0157375_10117617 | Ga0157375_101176173 | 113 |
| 153 | 3300013308 | Ga0157375_10380379 | Ga0157375_103803792 | 113 |
| 154 | 3300014325 | Ga0163163_10124389 | Ga0163163_101243893 | 113 |
| 155 | 3300014325 | Ga0163163_10379434 | Ga0163163_103794343 | 113 |
| 156 | 3300014326 | Ga0157380_10016562 | Ga0157380_100165623 | 113 |
| 157 | 3300014326 | Ga0157380_11612673 | Ga0157380_116126732 | 113 |
| 158 | 3300014326 | Ga0157380_11618520 | Ga0157380_116185201 | 113 |
| 159 | 3300014745 | Ga0157377_10000028 | Ga0157377_1000002813 | 113 |
| 160 | 3300014968 | Ga0157379_10073383 | Ga0157379_100733833 | 113 |
| 161 | 3300014969 | Ga0157376_10216193 | Ga0157376_102161932 | 113 |
| 162 | 3300014969 | Ga0157376_10471148 | Ga0157376_104711482 | 113 |
| 163 | 3300017792 | Ga0163161_10033682 | Ga0163161_100336822 | 113 |
| 164 | 3300017792 | Ga0163161_10067370 | Ga0163161_100673701 | 113 |
| 165 | 3300025273 | Ga0209673_1006240 | Ga0209673_10062408 | 113 |
| 166 | 3300025292 | Ga0209676_1013673 | Ga0209676_10136732 | 113 |
| 167 | 3300025298 | Ga0209050_1005099 | Ga0209050_10050993 | 113 |
| 168 | 3300025299 | Ga0209256_1013083 | Ga0209256_10130834 | 113 |
| 169 | 3300025315 | Ga0207697_10170901 | Ga0207697_101709012 | 113 |
| 170 | 3300025893 | Ga0207682_10005147 | Ga0207682_100051474 | 113 |
| 171 | 3300025893 | Ga0207682_10117551 | Ga0207682_101175512 | 113 |
| 172 | 3300025893 | Ga0207682_10578869 | Ga0207682_105788691 | 113 |
| 173 | 3300025899 | Ga0207642_10007496 | Ga0207642_100074964 | 113 |
| 174 | 3300025901 | Ga0207688_10479570 | Ga0207688_104795702 | 113 |
| 175 | 3300025901 | Ga0207688_10900752 | Ga0207688_109007522 | 113 |
| 176 | 3300025903 | Ga0207680_10278073 | Ga0207680_102780732 | 113 |
| 177 | 3300025907 | Ga0207645_10017366 | Ga0207645_100173663 | 113 |
| 178 | 3300025907 | Ga0207645_10065530 | Ga0207645_100655301 | 113 |
| 179 | 3300025920 | Ga0207649_10213642 | Ga0207649_102136423 | 113 |
| 180 | 3300025920 | Ga0207649_10779845 | Ga0207649_107798452 | 113 |
| 181 | 3300025920 | Ga0207649_10899563 | Ga0207649_108995631 | 113 |
| 182 | 3300025923 | Ga0207681_10028924 | Ga0207681_100289242 | 113 |
| 183 | 3300025925 | Ga0207650_10452144 | Ga0207650_104521443 | 113 |
| 184 | 3300025925 | Ga0207650_10902911 | Ga0207650_109029111 | 113 |
| 185 | 3300025926 | Ga0207659_10045679 | Ga0207659_100456793 | 113 |
| 186 | 3300025927 | Ga0207687_10168888 | Ga0207687_101688883 | 113 |
| 187 | 3300025927 | Ga0207687_10723387 | Ga0207687_107233872 | 113 |
| 188 | 3300025927 | Ga0207687_11389816 | Ga0207687_113898161 | 113 |
| 189 | 3300025931 | Ga0207644_10171359 | Ga0207644_101713593 | 113 |
| 190 | 3300025933 | Ga0207706_10052506 | Ga0207706_100525064 | 113 |
| 191 | 3300025933 | Ga0207706_10945924 | Ga0207706_109459241 | 113 |
| 192 | 3300025934 | Ga0207686_10228519 | Ga0207686_102285192 | 113 |
| 193 | 3300025935 | Ga0207709_10346432 | Ga0207709_103464323 | 113 |
| 194 | 3300025937 | Ga0207669_10014175 | Ga0207669_100141752 | 113 |
| 195 | 3300025937 | Ga0207669_10402379 | Ga0207669_104023792 | 113 |
| 196 | 3300025938 | Ga0207704_10003573 | Ga0207704_100035733 | 113 |
| 197 | 3300025938 | Ga0207704_10083915 | Ga0207704_100839152 | 113 |
| 198 | 3300025938 | Ga0207704_10206759 | Ga0207704_102067592 | 113 |
| 199 | 3300025940 | Ga0207691_10018444 | Ga0207691_100184446 | 113 |
| 200 | 3300025940 | Ga0207691_10054934 | Ga0207691_100549344 | 113 |
| 201 | 3300025940 | Ga0207691_10073621 | Ga0207691_100736213 | 113 |
| 202 | 3300025940 | Ga0207691_10120371 | Ga0207691_101203712 | 113 |
| 203 | 3300025940 | Ga0207691_10991036 | Ga0207691_109910362 | 113 |
| 204 | 3300025941 | Ga0207711_10010511 | Ga0207711_100105117 | 113 |
| 205 | 3300025941 | Ga0207711_10013603 | Ga0207711_100136034 | 113 |
| 206 | 3300025941 | Ga0207711_10236164 | Ga0207711_102361642 | 113 |
| 207 | 3300025941 | Ga0207711_10388539 | Ga0207711_103885392 | 113 |
| 208 | 3300025941 | Ga0207711_10428057 | Ga0207711_104280572 | 113 |
| 209 | 3300025942 | Ga0207689_10020073 | Ga0207689_100200735 | 113 |
| 210 | 3300025945 | Ga0207679_10047544 | Ga0207679_100475443 | 113 |
| 211 | 3300025945 | Ga0207679_10271438 | Ga0207679_102714382 | 113 |
| 212 | 3300025945 | Ga0207679_10957504 | Ga0207679_109575041 | 113 |
| 213 | 3300025949 | Ga0207667_10781458 | Ga0207667_107814582 | 113 |
| 214 | 3300025960 | Ga0207651_10031277 | Ga0207651_100312772 | 113 |
| 215 | 3300025960 | Ga0207651_10157750 | Ga0207651_101577503 | 113 |
| 216 | 3300025961 | Ga0207712_10013145 | Ga0207712_100131454 | 113 |
| 217 | 3300025972 | Ga0207668_10051620 | Ga0207668_100516202 | 113 |
| 218 | 3300025972 | Ga0207668_10164748 | Ga0207668_101647483 | 113 |
| 219 | 3300025986 | Ga0207658_10006549 | Ga0207658_100065494 | 113 |
| 220 | 3300025986 | Ga0207658_10118635 | Ga0207658_101186351 | 113 |
| 221 | 3300025986 | Ga0207658_11262218 | Ga0207658_112622182 | 113 |
| 222 | 3300026023 | Ga0207677_10049686 | Ga0207677_100496862 | 113 |
| 223 | 3300026023 | Ga0207677_10179612 | Ga0207677_101796123 | 113 |
| 224 | 3300026023 | Ga0207677_10622818 | Ga0207677_106228181 | 113 |
| 225 | 3300026023 | Ga0207677_10681283 | Ga0207677_106812832 | 113 |
| 226 | 3300026035 | Ga0207703_10062899 | Ga0207703_100628993 | 113 |
| 227 | 3300026067 | Ga0207678_10319364 | Ga0207678_103193643 | 113 |
| 228 | 3300026075 | Ga0207708_10010592 | Ga0207708_100105929 | 113 |
| 229 | 3300026088 | Ga0207641_10006217 | Ga0207641_100062177 | 113 |
| 230 | 3300026088 | Ga0207641_10012361 | Ga0207641_100123615 | 113 |
| 231 | 3300026088 | Ga0207641_10705541 | Ga0207641_107055411 | 113 |
| 232 | 3300026089 | Ga0207648_10000146 | Ga0207648_1000014659 | 113 |
| 233 | 3300026089 | Ga0207648_10005079 | Ga0207648_100050794 | 113 |
| 234 | 3300026089 | Ga0207648_10082049 | Ga0207648_100820493 | 113 |
| 235 | 3300026089 | Ga0207648_10278213 | Ga0207648_102782132 | 113 |
| 236 | 3300026089 | Ga0207648_10554974 | Ga0207648_105549742 | 113 |
| 237 | 3300026095 | Ga0207676_10041792 | Ga0207676_100417924 | 113 |
| 238 | 3300026095 | Ga0207676_10044926 | Ga0207676_100449262 | 113 |
| 239 | 3300026095 | Ga0207676_10227127 | Ga0207676_102271271 | 113 |
| 240 | 3300026095 | Ga0207676_11320480 | Ga0207676_113204802 | 113 |
| 241 | 3300026118 | Ga0207675_100004297 | Ga0207675_1000042974 | 113 |
| 242 | 3300026121 | Ga0207683_10013995 | Ga0207683_100139956 | 113 |
| 243 | 3300026121 | Ga0207683_10100393 | Ga0207683_101003932 | 113 |
| 244 | 3300026121 | Ga0207683_10226578 | Ga0207683_102265782 | 113 |
| 245 | 3300026121 | Ga0207683_10234264 | Ga0207683_102342642 | 113 |
| 246 | 3300026121 | Ga0207683_10267952 | Ga0207683_102679523 | 113 |
| 247 | 3300026121 | Ga0207683_10998049 | Ga0207683_109980492 | 113 |
| 248 | 3300026142 | Ga0207698_10563746 | Ga0207698_105637462 | 113 |
| 249 | 3300027111 | Ga0209281_1026979 | Ga0209281_10269792 | 113 |
| 250 | 3300027296 | Ga0209389_1024054 | Ga0209389_10240542 | 113 |
| 251 | 3300027312 | Ga0209371_1025422 | Ga0209371_10254222 | 113 |
| 252 | 3300028379 | Ga0268266_10422273 | Ga0268266_104222731 | 113 |
| 253 | 3300028380 | Ga0268265_10128933 | Ga0268265_101289332 | 113 |
| 254 | 3300028381 | Ga0268264_10068278 | Ga0268264_100682782 | 113 |
| 255 | 3300028381 | Ga0268264_10083481 | Ga0268264_100834814 | 113 |
| 256 | 3300028381 | Ga0268264_10391481 | Ga0268264_103914812 | 113 |
| 257 | 3300028381 | Ga0268264_10512757 | Ga0268264_105127572 | 113 |
| 258 | 3300030500 | Ga0268256_1024468 | Ga0268256_10244682 | 113 |
| 259 | 3300030500 | Ga0268256_1028922 | Ga0268256_10289222 | 113 |
| 260 | 3300031239 | Ga0265328_10006677 | Ga0265328_100066773 | 113 |
| 261 | 3300031239 | Ga0265328_10046030 | Ga0265328_100460302 | 113 |
| 262 | 3300031251 | Ga0265327_10000184 | Ga0265327_1000018490 | 113 |
| 263 | 3300031344 | Ga0265316_10000115 | Ga0265316_1000011542 | 113 |
| 264 | 3300031730 | Ga0307516_10402430 | Ga0307516_104024302 | 113 |
| 265 | 3300031824 | Ga0307413_10663488 | Ga0307413_106634881 | 113 |
| 266 | 3300031852 | Ga0307410_10023271 | Ga0307410_100232715 | 113 |
| 267 | 3300031901 | Ga0307406_10697564 | Ga0307406_106975642 | 113 |
| 268 | 3300031911 | Ga0307412_10001248 | Ga0307412_1000124813 | 113 |
| 269 | 3300031911 | Ga0307412_10149333 | Ga0307412_101493333 | 113 |
| 270 | 3300031911 | Ga0307412_10417928 | Ga0307412_104179283 | 113 |
| 271 | 3300031995 | Ga0307409_100266732 | Ga0307409_1002667321 | 113 |
| 272 | 3300032002 | Ga0307416_100041838 | Ga0307416_1000418383 | 113 |
| 273 | 3300032004 | Ga0307414_10581199 | Ga0307414_105811992 | 113 |
| 274 | 3300032005 | Ga0307411_10670025 | Ga0307411_106700252 | 113 |
| 275 | 3300032005 | Ga0307411_10714945 | Ga0307411_107149452 | 113 |
| 276 | 3300037068 | Ga0373925_0720811 | Ga0373925_0720811_242_589 | 113 |
| 277 | 3300037471 | Ga0395905_0003562 | Ga0395905_0003562_15957_16310 | 113 |
| 278 | 3300037471 | Ga0395905_0027611 | Ga0395905_0027611_3724_4068 | 113 |
| 279 | 3300039437 | Ga0436365_0636198 | Ga0436365_0636198_131_478 | 113 |
| 280 | 3300042001 | Ga0439441_017973 | Ga0439441_017973_287_628 | 113 |
| 281 | 3300042007 | Ga0439449_0094886 | Ga0439449_0094886_628_1017 | 113 |
| 282 | 3300042008 | Ga0439450_002823 | Ga0439450_002823_766_1107 | 113 |
| 283 | 3300042012 | Ga0439455_0020321 | Ga0439455_0020321_102_449 | 113 |
| 284 | 3300042012 | Ga0439455_0025785 | Ga0439455_0025785_270_611 | 113 |
| 285 | 3300042137 | Ga0450902_065066 | Ga0450902_065066_73_417 | 113 |
| 286 | 3300042439 | Ga0439464_0015768 | Ga0439464_0015768_1179_1520 | 113 |
| 287 | 3300044656 | Ga0466969_0058054 | Ga0466969_0058054_816_1163 | 113 |
| 288 | 3300044658 | Ga0466972_0030364 | Ga0466972_0030364_1418_1762 | 113 |
| 289 | 3300044658 | Ga0466972_0262744 | Ga0466972_0262744_109_453 | 113 |
| 290 | 3300044683 | Ga0466965_0022645 | Ga0466965_0022645_1767_2111 | 113 |
| 291 | 3300044683 | Ga0466965_0127947 | Ga0466965_0127947_885_1232 | 113 |
| 292 | 3300044683 | Ga0466965_0238955 | Ga0466965_0238955_161_505 | 113 |
| 293 | 3300044684 | Ga0466966_0114503 | Ga0466966_0114503_622_969 | 113 |
| 294 | 3300044693 | Ga0466961_0560862 | Ga0466961_0560862_232_579 | 113 |
| 295 | 3300044693 | Ga0466961_0600584 | Ga0466961_0600584_131_475 | 113 |
| 296 | 3300044694 | Ga0466963_0037912 | Ga0466963_0037912_2523_2870 | 113 |
| 297 | 3300044706 | Ga0466964_0004724 | Ga0466964_0004724_3443_3790 | 113 |
| 298 | 3300044706 | Ga0466964_0254815 | Ga0466964_0254815_482_826 | 113 |
| 299 | 3300044719 | Ga0466971_0083046 | Ga0466971_0083046_622_969 | 113 |
| 300 | 3300044765 | Ga0466970_0006015 | Ga0466970_0006015_2201_2548 | 113 |
| 301 | 3300044842 | Ga0466957_0008708 | Ga0466957_0008708_5400_5747 | 113 |
| 302 | 3300044901 | Ga0466960_0026574 | Ga0466960_0026574_1107_1451 | 113 |
| 303 | 3300045049 | Ga0466959_0000371 | Ga0466959_0000371_17085_17432 | 113 |
| 304 | 3300045051 | Ga0451576_0256394 | Ga0451576_0256394_763_1116 | 113 |
| 305 | 3300045836 | Ga0466958_0035526 | Ga0466958_0035526_109_456 | 113 |
| 306 | 3300045976 | Ga0466967_0029942 | Ga0466967_0029942_628_975 | 113 |
| 307 | 3300046463 | Ga0495653_0812535 | Ga0495653_0812535_95_436 | 113 |
| 308 | 3300046473 | Ga0495582_0488385 | Ga0495582_0488385_71_418 | 113 |
| 309 | 3300046663 | Ga0495635_0187047 | Ga0495635_0187047_996_1337 | 113 |
| 310 | 3300046681 | Ga0495647_0106307 | Ga0495647_0106307_473_820 | 113 |
| 311 | 3300046691 | Ga0495670_0044270 | Ga0495670_0044270_1642_1983 | 113 |
| 312 | 3300048905 | Ga0496102_0418951 | Ga0496102_0418951_622_969 | 113 |
| 313 | 3300048907 | Ga0496104_0664428 | Ga0496104_0664428_317_661 | 113 |
| 314 | 3300048911 | Ga0496108_0341169 | Ga0496108_0341169_567_914 | 113 |
| 315 | 3300048911 | Ga0496108_1190219 | Ga0496108_1190219_21_368 | 113 |
| 316 | 3300048912 | Ga0496109_0168653 | Ga0496109_0168653_777_1124 | 113 |
| 317 | 3300048913 | Ga0496110_0051053 | Ga0496110_0051053_266_619 | 113 |
| 318 | 3300048913 | Ga0496110_1062157 | Ga0496110_1062157_352_693 | 113 |
| 319 | 3300048915 | Ga0496112_0017310 | Ga0496112_0017310_95_442 | 113 |
| 320 | 3300048916 | Ga0496113_0642871 | Ga0496113_0642871_42_389 | 113 |
| 321 | 3300048919 | Ga0496116_0062807 | Ga0496116_0062807_1636_1980 | 113 |
| 322 | 3300048919 | Ga0496116_0214846 | Ga0496116_0214846_596_940 | 113 |
| 323 | 3300048920 | Ga0496117_0056563 | Ga0496117_0056563_1160_1504 | 113 |
| 324 | 3300048920 | Ga0496117_0058316 | Ga0496117_0058316_1895_2239 | 113 |
| 325 | 3300048921 | Ga0496118_0007262 | Ga0496118_0007262_10210_10554 | 113 |
| 326 | 3300048921 | Ga0496118_0035536 | Ga0496118_0035536_1527_1871 | 113 |
| 327 | 3300048921 | Ga0496118_0280743 | Ga0496118_0280743_323_667 | 113 |
| 328 | 3300048922 | Ga0496119_0014412 | Ga0496119_0014412_4085_4429 | 113 |
| 329 | 3300048922 | Ga0496119_0107698 | Ga0496119_0107698_527_871 | 113 |
| 330 | 3300048923 | Ga0496120_0019231 | Ga0496120_0019231_1413_1757 | 113 |
| 331 | 3300048924 | Ga0496121_0000748 | Ga0496121_0000748_23115_23459 | 113 |
| 332 | 3300048924 | Ga0496121_0021987 | Ga0496121_0021987_1315_1659 | 113 |
| 333 | 3300048924 | Ga0496121_0030262 | Ga0496121_0030262_2298_2642 | 113 |
| 334 | 3300048925 | Ga0496122_0001323 | Ga0496122_0001323_30607_30951 | 113 |
| 335 | 3300048925 | Ga0496122_0320601 | Ga0496122_0320601_28_372 | 113 |
| 336 | 3300048926 | Ga0496123_0000568 | Ga0496123_0000568_53678_54022 | 113 |
| 337 | 3300048926 | Ga0496123_0083369 | Ga0496123_0083369_1139_1483 | 113 |
| 338 | 3300048927 | Ga0496124_0000317 | Ga0496124_0000317_7733_8077 | 113 |
| 339 | 3300048927 | Ga0496124_0028462 | Ga0496124_0028462_3987_4331 | 113 |
| 340 | 3300048927 | Ga0496124_0367269 | Ga0496124_0367269_461_805 | 113 |
| 341 | 3300048928 | Ga0496125_0000096 | Ga0496125_0000096_168725_169069 | 113 |
| 342 | 3300048928 | Ga0496125_0014868 | Ga0496125_0014868_7006_7350 | 113 |
| 343 | 3300048928 | Ga0496125_0070327 | Ga0496125_0070327_985_1329 | 113 |
| 344 | 3300048928 | Ga0496125_0712742 | Ga0496125_0712742_165_509 | 113 |
| 345 | 3300048929 | Ga0496126_0090143 | Ga0496126_0090143_1373_1717 | 113 |
| 346 | 3300048929 | Ga0496126_0091471 | Ga0496126_0091471_1331_1675 | 113 |
| 347 | 3300048929 | Ga0496126_0123004 | Ga0496126_0123004_1163_1504 | 113 |
| 348 | 3300049515 | Ga0501292_000588 | Ga0501292_000588_291_632 | 113 |
| 349 | 3300049525 | Ga0501302_031871 | Ga0501302_031871_17_358 | 113 |
| 350 | 3300049572 | Ga0501036_1573485 | Ga0501036_1573485_50_391 | 113 |
| 351 | 3300049574 | Ga0501038_0021274 | Ga0501038_0021274_957_1337 | 113 |
| 352 | 3300049581 | Ga0501047_0508078 | Ga0501047_0508078_92_472 | 113 |
| 353 | 3300049649 | Ga0501198_000006 | Ga0501198_000006_123274_123615 | 113 |
| 354 | 3300049653 | Ga0501206_030296 | Ga0501206_030296_440_781 | 113 |
| 355 | 3300049662 | Ga0501222_000007 | Ga0501222_000007_83249_83590 | 113 |
| 356 | 3300049676 | Ga0501246_043466 | Ga0501246_043466_138_479 | 113 |
| 357 | 3300049759 | Ga0501262_023176 | Ga0501262_023176_300_641 | 113 |
| 358 | 3300049762 | Ga0501265_003337 | Ga0501265_003337_474_815 | 113 |
| 359 | 3300049822 | Ga0501035_0022705 | Ga0501035_0022705_1538_1918 | 113 |
| 360 | 3300049823 | Ga0501044_0011058 | Ga0501044_0011058_6321_6701 | 113 |
| 361 | 3300050511 | nmdc:mga08y16_695277_c1 | nmdc:mga08y16_695277_c1_173_520 | 113 |
| 362 | 3300053156 | Ga0500622_0001554 | Ga0500622_0001554_10608_10973 | 113 |
| 363 | 3300002773 | JGI25152J39213_1008231 | JGI25152J39213_10082312 | 114 |
| 364 | 3300003215 | JGI25153J46596_10000996 | JGI25153J46596_100009965 | 114 |
| 365 | 3300003215 | JGI25153J46596_10003477 | JGI25153J46596_100034776 | 114 |
| 366 | 3300003771 | Ga0055526_1014058 | Ga0055526_10140585 | 114 |
| 367 | 3300003791 | Ga0055530_10003267 | Ga0055530_100032674 | 114 |
| 368 | 3300005262 | Ga0065165_1002866 | Ga0065165_10028661 | 114 |
| 369 | 3300005327 | Ga0070658_11399790 | Ga0070658_113997901 | 114 |
| 370 | 3300005328 | Ga0070676_10027596 | Ga0070676_100275963 | 114 |
| 371 | 3300005328 | Ga0070676_10085154 | Ga0070676_100851543 | 114 |
| 372 | 3300005328 | Ga0070676_10274896 | Ga0070676_102748963 | 114 |
| 373 | 3300005331 | Ga0070670_100013636 | Ga0070670_1000136362 | 114 |
| 374 | 3300005331 | Ga0070670_100100127 | Ga0070670_1001001272 | 114 |
| 375 | 3300005333 | Ga0070677_10047482 | Ga0070677_100474822 | 114 |
| 376 | 3300005334 | Ga0068869_101919934 | Ga0068869_1019199341 | 114 |
| 377 | 3300005335 | Ga0070666_10158417 | Ga0070666_101584172 | 114 |
| 378 | 3300005338 | Ga0068868_100034050 | Ga0068868_1000340502 | 114 |
| 379 | 3300005338 | Ga0068868_100214972 | Ga0068868_1002149722 | 114 |
| 380 | 3300005340 | Ga0070689_100324720 | Ga0070689_1003247202 | 114 |
| 381 | 3300005347 | Ga0070668_100252510 | Ga0070668_1002525102 | 114 |
| 382 | 3300005353 | Ga0070669_100004931 | Ga0070669_1000049313 | 114 |
| 383 | 3300005353 | Ga0070669_100260405 | Ga0070669_1002604053 | 114 |
| 384 | 3300005355 | Ga0070671_100003667 | Ga0070671_10000366711 | 114 |
| 385 | 3300005355 | Ga0070671_100062955 | Ga0070671_1000629554 | 114 |
| 386 | 3300005355 | Ga0070671_100088819 | Ga0070671_1000888194 | 114 |
| 387 | 3300005356 | Ga0070674_100006142 | Ga0070674_1000061423 | 114 |
| 388 | 3300005356 | Ga0070674_100026379 | Ga0070674_1000263795 | 114 |
| 389 | 3300005364 | Ga0070673_100009720 | Ga0070673_1000097204 | 114 |
| 390 | 3300005364 | Ga0070673_100770357 | Ga0070673_1007703572 | 114 |
| 391 | 3300005367 | Ga0070667_100003317 | Ga0070667_10000331711 | 114 |
| 392 | 3300005367 | Ga0070667_100377070 | Ga0070667_1003770702 | 114 |
| 393 | 3300005367 | Ga0070667_100717114 | Ga0070667_1007171141 | 114 |
| 394 | 3300005441 | Ga0070700_100408130 | Ga0070700_1004081302 | 114 |
| 395 | 3300005456 | Ga0070678_100072719 | Ga0070678_1000727192 | 114 |
| 396 | 3300005456 | Ga0070678_100531525 | Ga0070678_1005315251 | 114 |
| 397 | 3300005456 | Ga0070678_100938621 | Ga0070678_1009386212 | 114 |
| 398 | 3300005457 | Ga0070662_101168204 | Ga0070662_1011682041 | 114 |
| 399 | 3300005459 | Ga0068867_100237600 | Ga0068867_1002376002 | 114 |
| 400 | 3300005459 | Ga0068867_100294488 | Ga0068867_1002944883 | 114 |
| 401 | 3300005466 | Ga0070685_10580770 | Ga0070685_105807702 | 114 |
| 402 | 3300005543 | Ga0070672_100017990 | Ga0070672_1000179906 | 114 |
| 403 | 3300005543 | Ga0070672_100925897 | Ga0070672_1009258972 | 114 |
| 404 | 3300005543 | Ga0070672_101054378 | Ga0070672_1010543781 | 114 |
| 405 | 3300005548 | Ga0070665_100071010 | Ga0070665_1000710104 | 114 |
| 406 | 3300005548 | Ga0070665_100645562 | Ga0070665_1006455622 | 114 |
| 407 | 3300005564 | Ga0070664_100320722 | Ga0070664_1003207221 | 114 |
| 408 | 3300005578 | Ga0068854_100178109 | Ga0068854_1001781094 | 114 |
| 409 | 3300005617 | Ga0068859_100183425 | Ga0068859_1001834252 | 114 |
| 410 | 3300005617 | Ga0068859_100516332 | Ga0068859_1005163322 | 114 |
| 411 | 3300005618 | Ga0068864_100023736 | Ga0068864_1000237365 | 114 |
| 412 | 3300005718 | Ga0068866_10771229 | Ga0068866_107712291 | 114 |
| 413 | 3300005719 | Ga0068861_100938408 | Ga0068861_1009384081 | 114 |
| 414 | 3300005834 | Ga0068851_10141868 | Ga0068851_101418682 | 114 |
| 415 | 3300005834 | Ga0068851_10350278 | Ga0068851_103502782 | 114 |
| 416 | 3300005840 | Ga0068870_10060960 | Ga0068870_100609603 | 114 |
| 417 | 3300005841 | Ga0068863_100014193 | Ga0068863_1000141932 | 114 |
| 418 | 3300005841 | Ga0068863_101024468 | Ga0068863_1010244682 | 114 |
| 419 | 3300005843 | Ga0068860_100324206 | Ga0068860_1003242063 | 114 |
| 420 | 3300005843 | Ga0068860_101179606 | Ga0068860_1011796062 | 114 |
| 421 | 3300006237 | Ga0097621_100756762 | Ga0097621_1007567621 | 114 |
| 422 | 3300006353 | Ga0075370_10001130 | Ga0075370_100011304 | 114 |
| 423 | 3300006358 | Ga0068871_100057992 | Ga0068871_1000579923 | 114 |
| 424 | 3300006358 | Ga0068871_100206018 | Ga0068871_1002060184 | 114 |
| 425 | 3300006881 | Ga0068865_100185259 | Ga0068865_1001852592 | 114 |
| 426 | 3300006931 | Ga0097620_100183432 | Ga0097620_1001834322 | 114 |
| 427 | 3300006931 | Ga0097620_100516313 | Ga0097620_1005163132 | 114 |
| 428 | 3300009098 | Ga0105245_10091026 | Ga0105245_100910264 | 114 |
| 429 | 3300009098 | Ga0105245_12782977 | Ga0105245_127829771 | 114 |
| 430 | 3300009174 | Ga0105241_12102059 | Ga0105241_121020592 | 114 |
| 431 | 3300009176 | Ga0105242_13018297 | Ga0105242_130182972 | 114 |
| 432 | 3300009177 | Ga0105248_11665486 | Ga0105248_116654862 | 114 |
| 433 | 3300009545 | Ga0105237_10546956 | Ga0105237_105469562 | 114 |
| 434 | 3300013296 | Ga0157374_10566869 | Ga0157374_105668692 | 114 |
| 435 | 3300013297 | Ga0157378_10037022 | Ga0157378_100370223 | 114 |
| 436 | 3300013297 | Ga0157378_11873670 | Ga0157378_118736702 | 114 |
| 437 | 3300013306 | Ga0163162_10070427 | Ga0163162_100704273 | 114 |
| 438 | 3300013306 | Ga0163162_10329941 | Ga0163162_103299412 | 114 |
| 439 | 3300013308 | Ga0157375_10034082 | Ga0157375_100340825 | 114 |
| 440 | 3300013308 | Ga0157375_10070238 | Ga0157375_100702383 | 114 |
| 441 | 3300013308 | Ga0157375_10737897 | Ga0157375_107378971 | 114 |
| 442 | 3300014325 | Ga0163163_10347531 | Ga0163163_103475311 | 114 |
| 443 | 3300014325 | Ga0163163_11278999 | Ga0163163_112789992 | 114 |
| 444 | 3300014326 | Ga0157380_10321458 | Ga0157380_103214582 | 114 |
| 445 | 3300014968 | Ga0157379_10132738 | Ga0157379_101327384 | 114 |
| 446 | 3300014968 | Ga0157379_10660248 | Ga0157379_106602482 | 114 |
| 447 | 3300014968 | Ga0157379_11259822 | Ga0157379_112598222 | 114 |
| 448 | 3300014968 | Ga0157379_11397789 | Ga0157379_113977892 | 114 |
| 449 | 3300014969 | Ga0157376_10353261 | Ga0157376_103532611 | 114 |
| 450 | 3300014969 | Ga0157376_11062921 | Ga0157376_110629212 | 114 |
| 451 | 3300014969 | Ga0157376_11216848 | Ga0157376_112168482 | 114 |
| 452 | 3300014969 | Ga0157376_12219093 | Ga0157376_122190932 | 114 |
| 453 | 3300017792 | Ga0163161_10026997 | Ga0163161_100269974 | 114 |
| 454 | 3300025245 | Ga0207425_1000519 | Ga0207425_100051923 | 114 |
| 455 | 3300025258 | Ga0209129_1000075 | Ga0209129_100007510 | 114 |
| 456 | 3300025263 | Ga0209565_1054691 | Ga0209565_10546912 | 114 |
| 457 | 3300025273 | Ga0209673_1003475 | Ga0209673_10034752 | 114 |
| 458 | 3300025273 | Ga0209673_1029058 | Ga0209673_10290582 | 114 |
| 459 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046174 | 114 |
| 460 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052289 | 114 |
| 461 | 3300025297 | Ga0209758_1000369 | Ga0209758_100036976 | 114 |
| 462 | 3300025298 | Ga0209050_1000202 | Ga0209050_100020298 | 114 |
| 463 | 3300025299 | Ga0209256_1031338 | Ga0209256_10313382 | 114 |
| 464 | 3300025303 | Ga0209051_1007707 | Ga0209051_10077074 | 114 |
| 465 | 3300025321 | Ga0207656_10104221 | Ga0207656_101042212 | 114 |
| 466 | 3300025321 | Ga0207656_10341611 | Ga0207656_103416111 | 114 |
| 467 | 3300025893 | Ga0207682_10002379 | Ga0207682_100023796 | 114 |
| 468 | 3300025899 | Ga0207642_10217534 | Ga0207642_102175342 | 114 |
| 469 | 3300025901 | Ga0207688_10120375 | Ga0207688_101203753 | 114 |
| 470 | 3300025903 | Ga0207680_10126619 | Ga0207680_101266193 | 114 |
| 471 | 3300025903 | Ga0207680_10211636 | Ga0207680_102116362 | 114 |
| 472 | 3300025907 | Ga0207645_10171202 | Ga0207645_101712024 | 114 |
| 473 | 3300025908 | Ga0207643_10078138 | Ga0207643_100781383 | 114 |
| 474 | 3300025923 | Ga0207681_10062019 | Ga0207681_100620193 | 114 |
| 475 | 3300025923 | Ga0207681_10626196 | Ga0207681_106261962 | 114 |
| 476 | 3300025925 | Ga0207650_10001450 | Ga0207650_100014503 | 114 |
| 477 | 3300025925 | Ga0207650_10094840 | Ga0207650_100948403 | 114 |
| 478 | 3300025925 | Ga0207650_10540229 | Ga0207650_105402292 | 114 |
| 479 | 3300025926 | Ga0207659_10124924 | Ga0207659_101249242 | 114 |
| 480 | 3300025926 | Ga0207659_11063883 | Ga0207659_110638831 | 114 |
| 481 | 3300025927 | Ga0207687_10010456 | Ga0207687_100104563 | 114 |
| 482 | 3300025927 | Ga0207687_11043960 | Ga0207687_110439602 | 114 |
| 483 | 3300025931 | Ga0207644_10009040 | Ga0207644_100090403 | 114 |
| 484 | 3300025931 | Ga0207644_10022840 | Ga0207644_100228403 | 114 |
| 485 | 3300025933 | Ga0207706_10384296 | Ga0207706_103842962 | 114 |
| 486 | 3300025936 | Ga0207670_10126568 | Ga0207670_101265683 | 114 |
| 487 | 3300025937 | Ga0207669_10065172 | Ga0207669_100651721 | 114 |
| 488 | 3300025937 | Ga0207669_10086912 | Ga0207669_100869123 | 114 |
| 489 | 3300025938 | Ga0207704_10433843 | Ga0207704_104338431 | 114 |
| 490 | 3300025940 | Ga0207691_10015818 | Ga0207691_100158183 | 114 |
| 491 | 3300025940 | Ga0207691_10513520 | Ga0207691_105135201 | 114 |
| 492 | 3300025942 | Ga0207689_11083830 | Ga0207689_110838302 | 114 |
| 493 | 3300025945 | Ga0207679_10110106 | Ga0207679_101101063 | 114 |
| 494 | 3300025960 | Ga0207651_10045261 | Ga0207651_100452613 | 114 |
| 495 | 3300025981 | Ga0207640_10887244 | Ga0207640_108872442 | 114 |
| 496 | 3300025986 | Ga0207658_10003189 | Ga0207658_100031895 | 114 |
| 497 | 3300025986 | Ga0207658_10145630 | Ga0207658_101456302 | 114 |
| 498 | 3300025986 | Ga0207658_10697793 | Ga0207658_106977932 | 114 |
| 499 | 3300025986 | Ga0207658_11144940 | Ga0207658_111449402 | 114 |
| 500 | 3300026023 | Ga0207677_10015594 | Ga0207677_100155942 | 114 |
| 501 | 3300026023 | Ga0207677_10372637 | Ga0207677_103726371 | 114 |
| 502 | 3300026088 | Ga0207641_10148927 | Ga0207641_101489272 | 114 |
| 503 | 3300026088 | Ga0207641_10200863 | Ga0207641_102008632 | 114 |
| 504 | 3300026089 | Ga0207648_10031809 | Ga0207648_100318093 | 114 |
| 505 | 3300026089 | Ga0207648_10045581 | Ga0207648_100455813 | 114 |
| 506 | 3300026089 | Ga0207648_10203297 | Ga0207648_102032973 | 114 |
| 507 | 3300026089 | Ga0207648_10264334 | Ga0207648_102643342 | 114 |
| 508 | 3300026095 | Ga0207676_11799130 | Ga0207676_117991302 | 114 |
| 509 | 3300026118 | Ga0207675_101644906 | Ga0207675_1016449061 | 114 |
| 510 | 3300026121 | Ga0207683_10025378 | Ga0207683_100253785 | 114 |
| 511 | 3300026121 | Ga0207683_10109452 | Ga0207683_101094522 | 114 |
| 512 | 3300026121 | Ga0207683_10800567 | Ga0207683_108005672 | 114 |
| 513 | 3300028379 | Ga0268266_10099882 | Ga0268266_100998823 | 114 |
| 514 | 3300028381 | Ga0268264_10217435 | Ga0268264_102174352 | 114 |
| 515 | 3300028381 | Ga0268264_12694698 | Ga0268264_126946981 | 114 |
| 516 | 3300028786 | Ga0307517_10167594 | Ga0307517_101675944 | 114 |
| 517 | 3300028794 | Ga0307515_10012290 | Ga0307515_100122905 | 114 |
| 518 | 3300028794 | Ga0307515_10027144 | Ga0307515_100271446 | 114 |
| 519 | 3300031456 | Ga0307513_10236577 | Ga0307513_102365772 | 114 |
| 520 | 3300031456 | Ga0307513_10405874 | Ga0307513_104058742 | 114 |
| 521 | 3300031548 | Ga0307408_100083242 | Ga0307408_1000832423 | 114 |
| 522 | 3300031548 | Ga0307408_100192225 | Ga0307408_1001922253 | 114 |
| 523 | 3300031548 | Ga0307408_101582587 | Ga0307408_1015825872 | 114 |
| 524 | 3300031649 | Ga0307514_10227038 | Ga0307514_102270382 | 114 |
| 525 | 3300031731 | Ga0307405_10004178 | Ga0307405_100041784 | 114 |
| 526 | 3300031731 | Ga0307405_11821657 | Ga0307405_118216571 | 114 |
| 527 | 3300031824 | Ga0307413_10000382 | Ga0307413_100003828 | 114 |
| 528 | 3300031824 | Ga0307413_10280659 | Ga0307413_102806591 | 114 |
| 529 | 3300031824 | Ga0307413_10825736 | Ga0307413_108257362 | 114 |
| 530 | 3300031852 | Ga0307410_10063639 | Ga0307410_100636394 | 114 |
| 531 | 3300031852 | Ga0307410_10142693 | Ga0307410_101426934 | 114 |
| 532 | 3300031852 | Ga0307410_10263405 | Ga0307410_102634051 | 114 |
| 533 | 3300031901 | Ga0307406_10028686 | Ga0307406_100286862 | 114 |
| 534 | 3300031903 | Ga0307407_10740540 | Ga0307407_107405401 | 114 |
| 535 | 3300031911 | Ga0307412_10014839 | Ga0307412_100148395 | 114 |
| 536 | 3300031995 | Ga0307409_100034041 | Ga0307409_1000340415 | 114 |
| 537 | 3300031995 | Ga0307409_101597123 | Ga0307409_1015971232 | 114 |
| 538 | 3300031995 | Ga0307409_102721872 | Ga0307409_1027218721 | 114 |
| 539 | 3300032002 | Ga0307416_100028719 | Ga0307416_1000287193 | 114 |
| 540 | 3300032002 | Ga0307416_100078096 | Ga0307416_1000780963 | 114 |
| 541 | 3300032002 | Ga0307416_100292283 | Ga0307416_1002922831 | 114 |
| 542 | 3300032004 | Ga0307414_10118315 | Ga0307414_101183153 | 114 |
| 543 | 3300032005 | Ga0307411_10003562 | Ga0307411_100035624 | 114 |
| 544 | 3300032005 | Ga0307411_10040610 | Ga0307411_100406104 | 114 |
| 545 | 3300032005 | Ga0307411_10196799 | Ga0307411_101967993 | 114 |
| 546 | 3300032005 | Ga0307411_10794084 | Ga0307411_107940842 | 114 |
| 547 | 3300032126 | Ga0307415_100078353 | Ga0307415_1000783533 | 114 |
| 548 | 3300033180 | Ga0307510_10001502 | Ga0307510_1000150211 | 114 |
| 549 | 3300035171 | Ga0373946_0110662 | Ga0373946_0110662_378_722 | 114 |
| 550 | 3300035691 | Ga0373931_0907307 | Ga0373931_0907307_176_520 | 114 |
| 551 | 3300037068 | Ga0373925_0131292 | Ga0373925_0131292_1091_1435 | 114 |
| 552 | 3300037466 | Ga0395898_0376603 | Ga0395898_0376603_438_800 | 114 |
| 553 | 3300041456 | Ga0451795_1607973 | Ga0451795_1607973_681_1028 | 114 |
| 554 | 3300041459 | Ga0451800_1676192 | Ga0451800_1676192_1243_1590 | 114 |
| 555 | 3300041491 | Ga0451833_0562403 | Ga0451833_0562403_35_379 | 114 |
| 556 | 3300046460 | Ga0495638_0049265 | Ga0495638_0049265_1485_1832 | 114 |
| 557 | 3300046519 | Ga0495632_0003371 | Ga0495632_0003371_7317_7664 | 114 |
| 558 | 3300046542 | Ga0495597_0288816 | Ga0495597_0288816_244_588 | 114 |
| 559 | 3300046616 | Ga0495668_0045224 | Ga0495668_0045224_1960_2304 | 114 |
| 560 | 3300046692 | Ga0495671_0037139 | Ga0495671_0037139_581_925 | 114 |
| 561 | 3300047472 | Ga0495686_0485619 | Ga0495686_0485619_160_504 | 114 |
| 562 | 3300047472 | Ga0495686_0637678 | Ga0495686_0637678_173_517 | 114 |
| 563 | 3300048915 | Ga0496112_0889644 | Ga0496112_0889644_192_536 | 114 |
| 564 | 3300048917 | Ga0496114_1127872 | Ga0496114_1127872_252_596 | 114 |
| 565 | 3300050493 | nmdc:mga0k408_54542_c1 | nmdc:mga0k408_54542_c1_1533_1880 | 114 |
| 566 | 3300050494 | nmdc:mga06z11_110842_c1 | nmdc:mga06z11_110842_c1_1042_1389 | 114 |
| 567 | 3300050496 | nmdc:mga07m45_13125_c1 | nmdc:mga07m45_13125_c1_1528_1875 | 114 |
| 568 | 3300050496 | nmdc:mga07m45_18526_c1 | nmdc:mga07m45_18526_c1_1066_1410 | 114 |
| 569 | 3300053080 | Ga0500635_0439137 | Ga0500635_0439137_70_414 | 114 |
| 570 | 3300053083 | Ga0495655_0128863 | Ga0495655_0128863_135_479 | 114 |
| 571 | 3300053086 | Ga0500578_0001398 | Ga0500578_0001398_3133_3480 | 114 |
| 572 | 3300053086 | Ga0500578_0059651 | Ga0500578_0059651_1061_1405 | 114 |
| 573 | 3300053090 | Ga0500646_0050429 | Ga0500646_0050429_69_416 | 114 |
| 574 | 3300053093 | Ga0500651_0041492 | Ga0500651_0041492_1904_2251 | 114 |
| 575 | 3300053093 | Ga0500651_0122739 | Ga0500651_0122739_326_673 | 114 |
| 576 | 3300053098 | Ga0500650_0076887 | Ga0500650_0076887_866_1213 | 114 |
| 577 | 3300053121 | Ga0500607_152417 | Ga0500607_152417_701_1045 | 114 |
| 578 | 3300053129 | Ga0500628_006474 | Ga0500628_006474_974_1321 | 114 |
| 579 | 3300053130 | Ga0500642_0000935 | Ga0500642_0000935_1507_1854 | 114 |
| 580 | 3300053131 | Ga0500652_000807 | Ga0500652_000807_1320_1667 | 114 |
| 581 | 3300053131 | Ga0500652_074004 | Ga0500652_074004_1047_1391 | 114 |
| 582 | 3300053137 | Ga0500561_0149788 | Ga0500561_0149788_189_536 | 114 |
| 583 | 3300053139 | Ga0500568_0032786 | Ga0500568_0032786_1433_1780 | 114 |
| 584 | 3300053142 | Ga0500577_0005790 | Ga0500577_0005790_2233_2580 | 114 |
| 585 | 3300053151 | Ga0500604_0089754 | Ga0500604_0089754_123_470 | 114 |
| 586 | 3300053156 | Ga0500622_0000599 | Ga0500622_0000599_18297_18644 | 114 |
| 587 | 3300053177 | Ga0500636_0301964 | Ga0500636_0301964_268_612 | 114 |
| 588 | 3300053726 | Ga0500584_145099 | Ga0500584_145099_44_391 | 114 |
| 589 | 3300053730 | Ga0500645_001454 | Ga0500645_001454_1210_1554 | 114 |
| 590 | 3300053739 | Ga0500587_018414 | Ga0500587_018414_40_384 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f46-assembly2.cif.gz_B | crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution | 0.8908 | 7 | 114 |
| 3gxg-assembly1.cif.gz_A | crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution | 0.868 | 6 | 112 |
| 2f46-assembly2.cif.gz_B | crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution | 0.8403 | 7 | 114 |
| 3gxh-assembly3.cif.gz_B | crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.40 a resolution | 0.8223 | 6 | 113 |
| 3gxg-assembly1.cif.gz_A | crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution | 0.791 | 6 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f46B00 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8904 | 5 | 114 | 3.90.190.10 |
| 2f46B00 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8542 | 5 | 114 | 3.90.190.10 |
| af_A4HTV6_250_347_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8511 | 21 | 87 | 3.90.190.10 |
| 3gxhB00 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8268 | 6 | 113 | 3.90.190.10 |
| af_Q7EYM9_283_443_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8176 | 4 | 101 | 3.90.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A254NFZ4-F1-model_v4 | TIGR01244 family protein | 1.001 | 6 | 112 |
GO:0016787
|
| AF-A0A5C0ASX7-F1-model_v4 | TIGR01244 family phosphatase | 0.9953 | 5 | 112 |
GO:0016787
|
| AF-A0A2U8FRR3-F1-model_v4 | TIGR01244 family phosphatase | 0.9936 | 2 | 113 |
GO:0016787
|
| AF-A0A257FQY4-F1-model_v4 | deleted | 0.9918 | 6 | 114 |
|
| AF-A0A7H4K0P0-F1-model_v4 | deleted | 0.9916 | 27 | 113 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar