F466990

General Info

Members Datasets Scaffolds Average Seq Length
590 262 575 114

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0094886|Ga0439449_0094886_628_1017
Length 129
Sequence MSVPINRLTESFAVAPQLSPDDMAAVAAAGFKSVIINRPDYEGGPDQPTAAAVSEAALNAGLKVEYQPVVSGGMTAEDVALFGQLLEKLPQPVLAYCRTGTRCTNLFVASQQSASRSQRGPGPGIDPQG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221621 Achromobacter sp. Root83 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
12 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
13 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
14 2858950400 Achromobacter sp. K91 Isolate Unclassified
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
139 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
228 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
233 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
234 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
235 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
236 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
237 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
251 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
252 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 0.34
Rhizoplane 2.88
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1008231 3300002773 Bacteria 2606
2 JGI25153J46596_10000996 3300003215 Bacteria 17188
3 JGI25153J46596_10003477 3300003215 Bacteria 8809
4 Ga0055526_1014058 3300003771 Bacteria 3325
5 Ga0055530_10003267 3300003791 Bacteria 9431
6 Ga0065165_1000613 3300005262 Bacteria 51836
7 Ga0065165_1002866 3300005262 Bacteria 13317
8 Ga0070658_10715002 3300005327 Bacteria 870
9 Ga0070658_11399790 3300005327 Bacteria 607
10 Ga0070676_10012268 3300005328 Bacteria 4673
11 Ga0070676_10027596 3300005328 Bacteria 3220
12 Ga0070676_10085154 3300005328 Bacteria 1925
13 Ga0070676_10176031 3300005328 Bacteria 1388
14 Ga0070676_10274896 3300005328 Bacteria 1133
15 Ga0070676_10349101 3300005328 Bacteria 1017
16 Ga0070676_10731175 3300005328 Bacteria 725
17 Ga0070690_101187444 3300005330 Bacteria 608
18 Ga0070670_100013636 3300005331 Bacteria 6965
19 Ga0070670_100049061 3300005331 Bacteria 3631
20 Ga0070670_100051811 3300005331 Bacteria 3524
21 Ga0070670_100094920 3300005331 Bacteria 2565
22 Ga0070670_100100127 3300005331 Bacteria 2494
23 Ga0070670_100347009 3300005331 Bacteria 1303
24 Ga0070670_100524844 3300005331 Bacteria 1055
25 Ga0070670_100843976 3300005331 Bacteria 829
26 Ga0070670_101718009 3300005331 Unclassified 578
27 Ga0070677_10001509 3300005333 Bacteria 7370
28 Ga0070677_10047482 3300005333 Bacteria 1721
29 Ga0070677_10059075 3300005333 Bacteria 1576
30 Ga0070677_10069930 3300005333 Bacteria 1474
31 Ga0070677_10645569 3300005333 Bacteria 591
32 Ga0068869_100024693 3300005334 Bacteria 4165
33 Ga0068869_101176350 3300005334 Bacteria 673
34 Ga0068869_101385859 3300005334 Bacteria 622
35 Ga0068869_101919934 3300005334 Bacteria 531
36 Ga0070666_10158417 3300005335 Bacteria 1582
37 Ga0070666_10409488 3300005335 Bacteria 975
38 Ga0070666_11515148 3300005335 Bacteria 502
39 Ga0068868_100034050 3300005338 Bacteria 3931
40 Ga0068868_100186265 3300005338 Bacteria 1725
41 Ga0068868_100214972 3300005338 Bacteria 1608
42 Ga0068868_100422401 3300005338 Bacteria 1154
43 Ga0068868_100751597 3300005338 Bacteria 876
44 Ga0070660_100264192 3300005339 Bacteria 1406
45 Ga0070689_100324720 3300005340 Bacteria 1286
46 Ga0070661_100250424 3300005344 Bacteria 1367
47 Ga0070661_100998872 3300005344 Bacteria 694
48 Ga0070668_100004749 3300005347 Bacteria 10080
49 Ga0070668_100252510 3300005347 Bacteria 1464
50 Ga0070669_100004931 3300005353 Bacteria 9640
51 Ga0070669_100005812 3300005353 Bacteria 8897
52 Ga0070669_100260405 3300005353 Bacteria 1384
53 Ga0070669_100378281 3300005353 Bacteria 1154
54 Ga0070675_100060429 3300005354 Bacteria 3129
55 Ga0070675_100107739 3300005354 Bacteria 2353
56 Ga0070675_101533680 3300005354 Bacteria 615
57 Ga0070671_100003667 3300005355 Bacteria 12035
58 Ga0070671_100044017 3300005355 Bacteria 3709
59 Ga0070671_100062955 3300005355 Bacteria 3089
60 Ga0070671_100088819 3300005355 Bacteria 2587
61 Ga0070671_100179923 3300005355 Bacteria 1790
62 Ga0070674_100006142 3300005356 Bacteria 6982
63 Ga0070674_100026379 3300005356 Bacteria 3794
64 Ga0070674_100027028 3300005356 Bacteria 3756
65 Ga0070674_100649309 3300005356 Bacteria 897
66 Ga0070673_100009720 3300005364 Bacteria 6470
67 Ga0070673_100046038 3300005364 Bacteria 3386
68 Ga0070673_100223579 3300005364 Bacteria 1630
69 Ga0070673_100359782 3300005364 Bacteria 1293
70 Ga0070673_100483061 3300005364 Bacteria 1118
71 Ga0070673_100770357 3300005364 Bacteria 887
72 Ga0070673_100803485 3300005364 Bacteria 869
73 Ga0070688_101101631 3300005365 Bacteria 635
74 Ga0070667_100003317 3300005367 Bacteria 13761
75 Ga0070667_100014226 3300005367 Bacteria 6573
76 Ga0070667_100377070 3300005367 Bacteria 1288
77 Ga0070667_100717114 3300005367 Bacteria 926
78 Ga0070667_101135574 3300005367 Bacteria 731
79 Ga0070701_10615094 3300005438 Bacteria 721
80 Ga0070700_100408130 3300005441 Bacteria 1023
81 Ga0070663_100161435 3300005455 Bacteria 1725
82 Ga0070663_102022445 3300005455 Bacteria 519
83 Ga0070663_102111821 3300005455 Bacteria 508
84 Ga0070678_100072719 3300005456 Bacteria 2579
85 Ga0070678_100123918 3300005456 Bacteria 2042
86 Ga0070678_100335204 3300005456 Bacteria 1296
87 Ga0070678_100429393 3300005456 Bacteria 1153
88 Ga0070678_100490454 3300005456 Bacteria 1082
89 Ga0070678_100531525 3300005456 Bacteria 1042
90 Ga0070678_100938621 3300005456 Bacteria 793
91 Ga0070678_101070796 3300005456 Bacteria 743
92 Ga0070662_100028972 3300005457 Bacteria 3859
93 Ga0070662_101168204 3300005457 Unclassified 661
94 Ga0068867_100000085 3300005459 Bacteria 58473
95 Ga0068867_100017886 3300005459 Bacteria 5035
96 Ga0068867_100237600 3300005459 Bacteria 1476
97 Ga0068867_100294488 3300005459 Bacteria 1335
98 Ga0068867_100708892 3300005459 Bacteria 889
99 Ga0068867_101700351 3300005459 Bacteria 592
100 Ga0070685_10580770 3300005466 Bacteria 804
101 Ga0070698_101132972 3300005471 Bacteria 731
102 Ga0070672_100017990 3300005543 Bacteria 5099
103 Ga0070672_100023511 3300005543 Bacteria 4544
104 Ga0070672_100062850 3300005543 Bacteria 2931
105 Ga0070672_100065940 3300005543 Bacteria 2865
106 Ga0070672_100405307 3300005543 Bacteria 1169
107 Ga0070672_100925897 3300005543 Bacteria 770
108 Ga0070672_101054378 3300005543 Bacteria 722
109 Ga0070686_100274335 3300005544 Bacteria 1241
110 Ga0070665_100071010 3300005548 Bacteria 3488
111 Ga0070665_100307537 3300005548 Bacteria 1588
112 Ga0070665_100645562 3300005548 Bacteria 1071
113 Ga0070665_101040022 3300005548 Bacteria 831
114 Ga0068855_101140991 3300005563 Bacteria 813
115 Ga0070664_100320722 3300005564 Bacteria 1404
116 Ga0070664_100325278 3300005564 Bacteria 1394
117 Ga0070664_100456573 3300005564 Bacteria 1173
118 Ga0070664_100834613 3300005564 Bacteria 862
119 Ga0068854_100178109 3300005578 Bacteria 1659
120 Ga0068852_100046991 3300005616 Bacteria 3680
121 Ga0068852_100363624 3300005616 Bacteria 1416
122 Ga0068852_100657581 3300005616 Unclassified 1056
123 Ga0068859_100050320 3300005617 Bacteria 4186
124 Ga0068859_100183425 3300005617 Bacteria 2176
125 Ga0068859_100516332 3300005617 Bacteria 1290
126 Ga0068864_100023736 3300005618 Bacteria 5153
127 Ga0068864_100035418 3300005618 Bacteria 4249
128 Ga0068864_100487137 3300005618 Bacteria 1184
129 Ga0068864_100619454 3300005618 Bacteria 1052
130 Ga0068864_100654099 3300005618 Bacteria 1023
131 Ga0068864_100695477 3300005618 Bacteria 993
132 Ga0068866_10006663 3300005718 Bacteria 4817
133 Ga0068866_10771229 3300005718 Bacteria 666
134 Ga0068861_100254351 3300005719 Bacteria 1500
135 Ga0068861_100938408 3300005719 Bacteria 822
136 Ga0068851_10047765 3300005834 Bacteria 2169
137 Ga0068851_10141868 3300005834 Bacteria 1307
138 Ga0068851_10350278 3300005834 Bacteria 859
139 Ga0068851_10380488 3300005834 Bacteria 827
140 Ga0068870_10060960 3300005840 Bacteria 2027
141 Ga0068863_100014193 3300005841 Bacteria 7674
142 Ga0068863_100037925 3300005841 Bacteria 4586
143 Ga0068863_100129756 3300005841 Bacteria 2406
144 Ga0068863_100397394 3300005841 Bacteria 1348
145 Ga0068863_101024468 3300005841 Bacteria 829
146 Ga0068863_102485322 3300005841 Bacteria 527
147 Ga0068858_100010943 3300005842 Bacteria 8575
148 Ga0068860_100028165 3300005843 Bacteria 5408
149 Ga0068860_100324206 3300005843 Bacteria 1512
150 Ga0068860_101164481 3300005843 Bacteria 791
151 Ga0068860_101179606 3300005843 Bacteria 786
152 Ga0068862_100141087 3300005844 Bacteria 2139
153 Ga0068862_102791602 3300005844 Bacteria 500
154 Ga0097621_100081987 3300006237 Bacteria 2685
155 Ga0097621_100756762 3300006237 Bacteria 898
156 Ga0097621_102299376 3300006237 Bacteria 516
157 Ga0075370_10001130 3300006353 Bacteria 11191
158 Ga0075370_10306622 3300006353 Bacteria 945
159 Ga0068871_100057992 3300006358 Bacteria 3152
160 Ga0068871_100206018 3300006358 Bacteria 1700
161 Ga0068871_100250229 3300006358 Bacteria 1543
162 Ga0068871_100552836 3300006358 Bacteria 1043
163 Ga0068871_101092957 3300006358 Unclassified 745
164 Ga0068865_100021793 3300006881 Bacteria 4171
165 Ga0068865_100185259 3300006881 Bacteria 1606
166 Ga0068865_100434739 3300006881 Bacteria 1082
167 Ga0068865_100486375 3300006881 Bacteria 1027
168 Ga0068865_100794356 3300006881 Bacteria 816
169 Ga0097620_100050319 3300006931 Bacteria 4186
170 Ga0097620_100183432 3300006931 Bacteria 2176
171 Ga0097620_100516313 3300006931 Bacteria 1290
172 Ga0111539_10522078 3300009094 Bacteria 1383
173 Ga0111539_11287014 3300009094 Bacteria 849
174 Ga0105245_10091026 3300009098 Bacteria 2807
175 Ga0105245_10197183 3300009098 Bacteria 1932
176 Ga0105245_11780477 3300009098 Bacteria 669
177 Ga0105245_12782977 3300009098 Bacteria 542
178 Ga0105243_10046051 3300009148 Bacteria 3429
179 Ga0105241_12102059 3300009174 Bacteria 558
180 Ga0105242_10102944 3300009176 Bacteria 2422
181 Ga0105242_13018297 3300009176 Bacteria 521
182 Ga0105248_10008728 3300009177 Bacteria 11134
183 Ga0105248_10152958 3300009177 Bacteria 2603
184 Ga0105248_10217120 3300009177 Bacteria 2154
185 Ga0105248_10403275 3300009177 Bacteria 1539
186 Ga0105248_10406583 3300009177 Bacteria 1533
187 Ga0105248_10433870 3300009177 Bacteria 1480
188 Ga0105248_10437661 3300009177 Bacteria 1473
189 Ga0105248_11665486 3300009177 Bacteria 723
190 Ga0105237_10546956 3300009545 Bacteria 1164
191 Ga0105249_10052344 3300009553 Bacteria 3728
192 Ga0105239_10389954 3300010375 Bacteria 1575
193 Ga0157374_10025500 3300013296 Bacteria 5309
194 Ga0157374_10566869 3300013296 Bacteria 1144
195 Ga0157374_10723401 3300013296 Bacteria 1009
196 Ga0157378_10037022 3300013297 Bacteria 4320
197 Ga0157378_10751674 3300013297 Bacteria 998
198 Ga0157378_10989006 3300013297 Bacteria 875
199 Ga0157378_11296375 3300013297 Bacteria 769
200 Ga0157378_11873670 3300013297 Bacteria 648
201 Ga0163162_10070427 3300013306 Bacteria 3548
202 Ga0163162_10096444 3300013306 Bacteria 3045
203 Ga0163162_10329941 3300013306 Bacteria 1658
204 Ga0163162_10447357 3300013306 Bacteria 1424
205 Ga0163162_11854613 3300013306 Bacteria 690
206 Ga0157375_10034082 3300013308 Bacteria 4846
207 Ga0157375_10070238 3300013308 Bacteria 3511
208 Ga0157375_10117617 3300013308 Bacteria 2764
209 Ga0157375_10380379 3300013308 Bacteria 1578
210 Ga0157375_10737897 3300013308 Bacteria 1137
211 Ga0163163_10124389 3300014325 Bacteria 2615
212 Ga0163163_10347531 3300014325 Bacteria 1539
213 Ga0163163_10379434 3300014325 Bacteria 1471
214 Ga0163163_11278999 3300014325 Bacteria 796
215 Ga0157380_10016562 3300014326 Bacteria 5438
216 Ga0157380_10321458 3300014326 Bacteria 1435
217 Ga0157380_11612673 3300014326 Bacteria 704
218 Ga0157380_11618520 3300014326 Bacteria 703
219 Ga0157377_10000028 3300014745 Bacteria 134810
220 Ga0157379_10073383 3300014968 Bacteria 3063
221 Ga0157379_10132738 3300014968 Bacteria 2242
222 Ga0157379_10660248 3300014968 Bacteria 979
223 Ga0157379_11259822 3300014968 Bacteria 713
224 Ga0157379_11397789 3300014968 Bacteria 678
225 Ga0157376_10216193 3300014969 Bacteria 1772
226 Ga0157376_10353261 3300014969 Bacteria 1407
227 Ga0157376_10471148 3300014969 Bacteria 1229
228 Ga0157376_11062921 3300014969 Bacteria 834
229 Ga0157376_11216848 3300014969 Bacteria 782
230 Ga0157376_12219093 3300014969 Bacteria 588
231 Ga0163161_10026997 3300017792 Bacteria 4071
232 Ga0163161_10033682 3300017792 Bacteria 3661
233 Ga0163161_10067370 3300017792 Bacteria 2615
234 Ga0207425_1000519 3300025245 Bacteria 23496
235 Ga0209129_1000075 3300025258 Bacteria 201273
236 Ga0209565_1054691 3300025263 Bacteria 706
237 Ga0209673_1003475 3300025273 Bacteria 9256
238 Ga0209673_1006240 3300025273 Bacteria 5813
239 Ga0209673_1029058 3300025273 Bacteria 1766
240 Ga0209676_1013673 3300025292 Bacteria 3105
241 Ga0209564_1000046 3300025295 Bacteria 373787
242 Ga0209758_1000052 3300025297 Bacteria 338962
243 Ga0209758_1000369 3300025297 Bacteria 79541
244 Ga0209050_1000202 3300025298 Bacteria 133468
245 Ga0209050_1005099 3300025298 Bacteria 8462
246 Ga0209256_1013083 3300025299 Bacteria 3108
247 Ga0209256_1031338 3300025299 Bacteria 1455
248 Ga0209051_1007707 3300025303 Bacteria 5838
249 Ga0207697_10170901 3300025315 Bacteria 951
250 Ga0207656_10104221 3300025321 Bacteria 1304
251 Ga0207656_10341611 3300025321 Bacteria 746
252 Ga0207682_10002379 3300025893 Bacteria 8471
253 Ga0207682_10005147 3300025893 Bacteria 5357
254 Ga0207682_10117551 3300025893 Bacteria 1176
255 Ga0207682_10578869 3300025893 Bacteria 530
256 Ga0207642_10007496 3300025899 Bacteria 3690
257 Ga0207642_10217534 3300025899 Bacteria 1066
258 Ga0207688_10120375 3300025901 Bacteria 1531
259 Ga0207688_10479570 3300025901 Bacteria 777
260 Ga0207688_10900752 3300025901 Bacteria 560
261 Ga0207680_10126619 3300025903 Bacteria 1678
262 Ga0207680_10211636 3300025903 Bacteria 1326
263 Ga0207680_10278073 3300025903 Bacteria 1163
264 Ga0207645_10017366 3300025907 Bacteria 4750
265 Ga0207645_10065530 3300025907 Bacteria 2322
266 Ga0207645_10171202 3300025907 Bacteria 1423
267 Ga0207643_10078138 3300025908 Bacteria 1914
268 Ga0207649_10213642 3300025920 Bacteria 1370
269 Ga0207649_10779845 3300025920 Bacteria 745
270 Ga0207649_10899563 3300025920 Bacteria 694
271 Ga0207681_10028924 3300025923 Bacteria 3593
272 Ga0207681_10062019 3300025923 Bacteria 2572
273 Ga0207681_10626196 3300025923 Bacteria 891
274 Ga0207650_10001450 3300025925 Bacteria 17074
275 Ga0207650_10006252 3300025925 Bacteria 8115
276 Ga0207650_10094840 3300025925 Bacteria 2287
277 Ga0207650_10452144 3300025925 Bacteria 1069
278 Ga0207650_10540229 3300025925 Bacteria 977
279 Ga0207650_10902911 3300025925 Bacteria 750
280 Ga0207659_10037997 3300025926 Bacteria 3346
281 Ga0207659_10045679 3300025926 Bacteria 3090
282 Ga0207659_10124924 3300025926 Bacteria 1977
283 Ga0207659_11063883 3300025926 Bacteria 696
284 Ga0207687_10010456 3300025927 Bacteria 6059
285 Ga0207687_10168888 3300025927 Bacteria 1685
286 Ga0207687_10723387 3300025927 Bacteria 846
287 Ga0207687_11043960 3300025927 Bacteria 701
288 Ga0207687_11389816 3300025927 Bacteria 603
289 Ga0207644_10009040 3300025931 Bacteria 6531
290 Ga0207644_10022840 3300025931 Bacteria 4277
291 Ga0207644_10171359 3300025931 Bacteria 1694
292 Ga0207706_10052506 3300025933 Bacteria 3599
293 Ga0207706_10384296 3300025933 Bacteria 1218
294 Ga0207706_10945924 3300025933 Bacteria 726
295 Ga0207686_10228519 3300025934 Bacteria 1347
296 Ga0207709_10346432 3300025935 Bacteria 1120
297 Ga0207670_10126568 3300025936 Bacteria 1865
298 Ga0207669_10014175 3300025937 Bacteria 3988
299 Ga0207669_10065172 3300025937 Bacteria 2258
300 Ga0207669_10086912 3300025937 Bacteria 2023
301 Ga0207669_10402379 3300025937 Bacteria 1073
302 Ga0207704_10003573 3300025938 Bacteria 7066
303 Ga0207704_10083915 3300025938 Bacteria 2069
304 Ga0207704_10206759 3300025938 Bacteria 1441
305 Ga0207704_10433843 3300025938 Bacteria 1045
306 Ga0207691_10015818 3300025940 Bacteria 7170
307 Ga0207691_10018444 3300025940 Bacteria 6613
308 Ga0207691_10054934 3300025940 Bacteria 3632
309 Ga0207691_10073621 3300025940 Bacteria 3081
310 Ga0207691_10120371 3300025940 Bacteria 2327
311 Ga0207691_10513520 3300025940 Bacteria 1017
312 Ga0207691_10991036 3300025940 Bacteria 701
313 Ga0207711_10010511 3300025941 Bacteria 7688
314 Ga0207711_10013603 3300025941 Bacteria 6760
315 Ga0207711_10236164 3300025941 Bacteria 1675
316 Ga0207711_10388539 3300025941 Bacteria 1295
317 Ga0207711_10428057 3300025941 Bacteria 1231
318 Ga0207689_10020073 3300025942 Bacteria 5626
319 Ga0207689_11083830 3300025942 Bacteria 675
320 Ga0207679_10047544 3300025945 Bacteria 3118
321 Ga0207679_10110106 3300025945 Bacteria 2172
322 Ga0207679_10271438 3300025945 Bacteria 1451
323 Ga0207679_10957504 3300025945 Bacteria 784
324 Ga0207667_10781458 3300025949 Bacteria 953
325 Ga0207651_10021817 3300025960 Bacteria 3901
326 Ga0207651_10031277 3300025960 Bacteria 3400
327 Ga0207651_10045261 3300025960 Bacteria 2950
328 Ga0207651_10157750 3300025960 Bacteria 1775
329 Ga0207712_10013145 3300025961 Bacteria 5304
330 Ga0207668_10051620 3300025972 Bacteria 2841
331 Ga0207668_10164748 3300025972 Bacteria 1731
332 Ga0207640_10887244 3300025981 Bacteria 778
333 Ga0207658_10003189 3300025986 Bacteria 11689
334 Ga0207658_10006549 3300025986 Bacteria 7942
335 Ga0207658_10118635 3300025986 Bacteria 2105
336 Ga0207658_10145630 3300025986 Bacteria 1923
337 Ga0207658_10697793 3300025986 Bacteria 917
338 Ga0207658_11144940 3300025986 Bacteria 711
339 Ga0207658_11262218 3300025986 Bacteria 675
340 Ga0207677_10015594 3300026023 Bacteria 4476
341 Ga0207677_10049686 3300026023 Bacteria 2832
342 Ga0207677_10179612 3300026023 Bacteria 1664
343 Ga0207677_10372637 3300026023 Bacteria 1203
344 Ga0207677_10622818 3300026023 Bacteria 949
345 Ga0207677_10681283 3300026023 Bacteria 910
346 Ga0207703_10062899 3300026035 Bacteria 3041
347 Ga0207678_10319364 3300026067 Bacteria 1336
348 Ga0207708_10010592 3300026075 Bacteria 6847
349 Ga0207641_10006217 3300026088 Bacteria 10101
350 Ga0207641_10012361 3300026088 Bacteria 7003
351 Ga0207641_10148927 3300026088 Bacteria 2118
352 Ga0207641_10200863 3300026088 Bacteria 1838
353 Ga0207641_10705541 3300026088 Bacteria 994
354 Ga0207641_11031668 3300026088 Bacteria 820
355 Ga0207648_10000146 3300026089 Bacteria 70573
356 Ga0207648_10005079 3300026089 Bacteria 13337
357 Ga0207648_10031809 3300026089 Bacteria 4663
358 Ga0207648_10045581 3300026089 Bacteria 3846
359 Ga0207648_10082049 3300026089 Bacteria 2812
360 Ga0207648_10203297 3300026089 Bacteria 1757
361 Ga0207648_10264334 3300026089 Bacteria 1536
362 Ga0207648_10278213 3300026089 Bacteria 1496
363 Ga0207648_10554974 3300026089 Bacteria 1055
364 Ga0207676_10041792 3300026095 Bacteria 3522
365 Ga0207676_10044926 3300026095 Bacteria 3410
366 Ga0207676_10227127 3300026095 Bacteria 1666
367 Ga0207676_11320480 3300026095 Bacteria 716
368 Ga0207676_11799130 3300026095 Bacteria 611
369 Ga0207675_100004297 3300026118 Bacteria 13767
370 Ga0207675_101644906 3300026118 Bacteria 662
371 Ga0207683_10013995 3300026121 Bacteria 6840
372 Ga0207683_10025378 3300026121 Bacteria 5112
373 Ga0207683_10100393 3300026121 Bacteria 2584
374 Ga0207683_10109452 3300026121 Bacteria 2473
375 Ga0207683_10226578 3300026121 Bacteria 1704
376 Ga0207683_10234264 3300026121 Bacteria 1675
377 Ga0207683_10267952 3300026121 Bacteria 1560
378 Ga0207683_10800567 3300026121 Bacteria 875
379 Ga0207683_10998049 3300026121 Bacteria 777
380 Ga0207698_10563746 3300026142 Bacteria 1118
381 Ga0209281_1026979 3300027111 Bacteria 1056
382 Ga0209389_1024054 3300027296 Bacteria 5356
383 Ga0209371_1025422 3300027312 Bacteria 1362
384 Ga0268266_10099882 3300028379 Bacteria 2555
385 Ga0268266_10422273 3300028379 Bacteria 1264
386 Ga0268265_10128933 3300028380 Bacteria 2098
387 Ga0268264_10068278 3300028381 Bacteria 3003
388 Ga0268264_10083481 3300028381 Bacteria 2737
389 Ga0268264_10217435 3300028381 Bacteria 1757
390 Ga0268264_10391481 3300028381 Bacteria 1333
391 Ga0268264_10512757 3300028381 Bacteria 1171
392 Ga0268264_12694698 3300028381 Bacteria 501
393 Ga0307517_10167594 3300028786 Bacteria 1454
394 Ga0307515_10012290 3300028794 Bacteria 16114
395 Ga0307515_10027144 3300028794 Bacteria 9806
396 Ga0268256_1024468 3300030500 Bacteria 1549
397 Ga0268256_1028922 3300030500 Bacteria 1362
398 Ga0265328_10006677 3300031239 Bacteria 4858
399 Ga0265328_10046030 3300031239 Bacteria 1604
400 Ga0265327_10000184 3300031251 Bacteria 133023
401 Ga0265316_10000115 3300031344 Bacteria 86934
402 Ga0307513_10236577 3300031456 Bacteria 1635
403 Ga0307513_10405874 3300031456 Bacteria 1096
404 Ga0307408_100083242 3300031548 Bacteria 2397
405 Ga0307408_100192225 3300031548 Bacteria 1645
406 Ga0307408_101582587 3300031548 Bacteria 622
407 Ga0307514_10227038 3300031649 Bacteria 1137
408 Ga0307516_10402430 3300031730 Bacteria 1028
409 Ga0307405_10004178 3300031731 Bacteria 6796
410 Ga0307405_11821657 3300031731 Bacteria 541
411 Ga0307413_10000382 3300031824 Bacteria 14204
412 Ga0307413_10280659 3300031824 Bacteria 1253
413 Ga0307413_10663488 3300031824 Bacteria 862
414 Ga0307413_10825736 3300031824 Bacteria 781
415 Ga0307410_10023271 3300031852 Bacteria 3848
416 Ga0307410_10063639 3300031852 Bacteria 2531
417 Ga0307410_10142693 3300031852 Bacteria 1774
418 Ga0307410_10263405 3300031852 Bacteria 1345
419 Ga0307406_10028686 3300031901 Bacteria 3364
420 Ga0307406_10697564 3300031901 Bacteria 847
421 Ga0307407_10740540 3300031903 Bacteria 743
422 Ga0307412_10001248 3300031911 Bacteria 14402
423 Ga0307412_10014839 3300031911 Bacteria 4605
424 Ga0307412_10149333 3300031911 Bacteria 1722
425 Ga0307412_10417928 3300031911 Bacteria 1096
426 Ga0307409_100034041 3300031995 Bacteria 3716
427 Ga0307409_100266732 3300031995 Bacteria 1575
428 Ga0307409_101597123 3300031995 Unclassified 680
429 Ga0307409_102721872 3300031995 Bacteria 523
430 Ga0307416_100028719 3300032002 Bacteria 4142
431 Ga0307416_100041838 3300032002 Bacteria 3572
432 Ga0307416_100078096 3300032002 Bacteria 2784
433 Ga0307416_100292283 3300032002 Bacteria 1614
434 Ga0307414_10118315 3300032004 Bacteria 2032
435 Ga0307414_10581199 3300032004 Bacteria 1002
436 Ga0307411_10003562 3300032005 Bacteria 7250
437 Ga0307411_10040610 3300032005 Bacteria 2953
438 Ga0307411_10196799 3300032005 Bacteria 1544
439 Ga0307411_10670025 3300032005 Bacteria 900
440 Ga0307411_10714945 3300032005 Bacteria 874
441 Ga0307411_10794084 3300032005 Bacteria 833
442 Ga0307415_100078353 3300032126 Bacteria 2350
443 Ga0307510_10001502 3300033180 Bacteria 25726
444 Ga0373946_0110662 3300035171 Bacteria 1243
445 Ga0373931_0907307 3300035691 Bacteria 592
446 Ga0373925_0131292 3300037068 Bacteria 1953
447 Ga0373925_0720811 3300037068 Bacteria 822
448 Ga0395898_0376603 3300037466 Bacteria 1354
449 Ga0395905_0003562 3300037471 Bacteria 16585
450 Ga0395905_0027611 3300037471 Bacteria 5352
451 Ga0436365_0636198 3300039437 Bacteria 614
452 Ga0451795_1607973 3300041456 Bacteria 1676
453 Ga0451800_1676192 3300041459 Bacteria 1877
454 Ga0451833_0562403 3300041491 Bacteria 639
455 Ga0439441_017973 3300042001 Bacteria 1275
456 Ga0439449_0094886 3300042007 Bacteria 1102
457 Ga0439450_002823 3300042008 Bacteria 2790
458 Ga0439455_0020321 3300042012 Bacteria 1574
459 Ga0439455_0025785 3300042012 Bacteria 1431
460 Ga0450902_065066 3300042137 Bacteria 633
461 Ga0439464_0015768 3300042439 Bacteria 2041
462 Ga0466969_0058054 3300044656 Bacteria 1884
463 Ga0466972_0030364 3300044658 Bacteria 2660
464 Ga0466972_0262744 3300044658 Bacteria 807
465 Ga0466965_0022645 3300044683 Bacteria 3029
466 Ga0466965_0127947 3300044683 Bacteria 1315
467 Ga0466965_0238955 3300044683 Bacteria 972
468 Ga0466966_0114503 3300044684 Bacteria 1660
469 Ga0466961_0560862 3300044693 Bacteria 687
470 Ga0466961_0600584 3300044693 Bacteria 662
471 Ga0466963_0037912 3300044694 Bacteria 3150
472 Ga0466964_0004724 3300044706 Bacteria 5032
473 Ga0466964_0254815 3300044706 Bacteria 867
474 Ga0466971_0083046 3300044719 Bacteria 1462
475 Ga0466970_0006015 3300044765 Bacteria 6049
476 Ga0466957_0008708 3300044842 Bacteria 5780
477 Ga0466960_0026574 3300044901 Bacteria 2631
478 Ga0466959_0000371 3300045049 Bacteria 26505
479 Ga0451576_0256394 3300045051 Bacteria 1828
480 Ga0466958_0035526 3300045836 Bacteria 2977
481 Ga0466967_0029942 3300045976 Bacteria 4562
482 Ga0495638_0049265 3300046460 Bacteria 2634
483 Ga0495653_0812535 3300046463 Bacteria 561
484 Ga0495582_0488385 3300046473 Bacteria 712
485 Ga0495632_0003371 3300046519 Bacteria 11383
486 Ga0495597_0288816 3300046542 Bacteria 638
487 Ga0495668_0045224 3300046616 Bacteria 2447
488 Ga0495635_0187047 3300046663 Bacteria 1407
489 Ga0495647_0106307 3300046681 Bacteria 1167
490 Ga0495670_0044270 3300046691 Bacteria 2222
491 Ga0495671_0037139 3300046692 Bacteria 2465
492 Ga0495686_0485619 3300047472 Bacteria 652
493 Ga0495686_0637678 3300047472 Bacteria 549
494 Ga0496100_1296563 3300048903 Bacteria 575
495 Ga0496102_0418951 3300048905 Bacteria 1258
496 Ga0496104_0664428 3300048907 Bacteria 951
497 Ga0496104_1517025 3300048907 Bacteria 573
498 Ga0496108_0341169 3300048911 Bacteria 1307
499 Ga0496108_1190219 3300048911 Bacteria 645
500 Ga0496109_0168653 3300048912 Bacteria 2053
501 Ga0496110_0051053 3300048913 Bacteria 3634
502 Ga0496110_0999927 3300048913 Bacteria 744
503 Ga0496110_1062157 3300048913 Bacteria 718
504 Ga0496112_0017310 3300048915 Bacteria 6769
505 Ga0496112_0889644 3300048915 Bacteria 813
506 Ga0496113_0642871 3300048916 Bacteria 848
507 Ga0496114_1127872 3300048917 Bacteria 669
508 Ga0496116_0062807 3300048919 Bacteria 2396
509 Ga0496116_0214846 3300048919 Bacteria 992
510 Ga0496117_0056563 3300048920 Bacteria 2731
511 Ga0496117_0058316 3300048920 Bacteria 2675
512 Ga0496118_0007262 3300048921 Bacteria 11811
513 Ga0496118_0035536 3300048921 Bacteria 4044
514 Ga0496118_0280743 3300048921 Bacteria 927
515 Ga0496119_0014412 3300048922 Bacteria 6191
516 Ga0496119_0107698 3300048922 Bacteria 1553
517 Ga0496120_0019231 3300048923 Bacteria 4375
518 Ga0496121_0000748 3300048924 Bacteria 59722
519 Ga0496121_0021987 3300048924 Bacteria 6215
520 Ga0496121_0030262 3300048924 Bacteria 4975
521 Ga0496122_0001323 3300048925 Bacteria 40594
522 Ga0496122_0320601 3300048925 Bacteria 824
523 Ga0496123_0000568 3300048926 Bacteria 63015
524 Ga0496123_0083369 3300048926 Bacteria 1933
525 Ga0496124_0000317 3300048927 Bacteria 89188
526 Ga0496124_0028462 3300048927 Bacteria 4998
527 Ga0496124_0367269 3300048927 Bacteria 1011
528 Ga0496125_0000096 3300048928 Bacteria 205618
529 Ga0496125_0014868 3300048928 Bacteria 7558
530 Ga0496125_0070327 3300048928 Bacteria 2740
531 Ga0496125_0712742 3300048928 Bacteria 531
532 Ga0496126_0090143 3300048929 Bacteria 2698
533 Ga0496126_0091471 3300048929 Bacteria 2675
534 Ga0496126_0123004 3300048929 Bacteria 2248
535 Ga0501292_000588 3300049515 Bacteria 4474
536 Ga0501302_031871 3300049525 Bacteria 505
537 Ga0501036_1573485 3300049572 Bacteria 531
538 Ga0501038_0021274 3300049574 Bacteria 5825
539 Ga0501047_0508078 3300049581 Bacteria 1031
540 Ga0501198_000006 3300049649 Bacteria 129954
541 Ga0501206_030296 3300049653 Bacteria 802
542 Ga0501222_000007 3300049662 Bacteria 126703
543 Ga0501246_043466 3300049676 Bacteria 544
544 Ga0501262_023176 3300049759 Bacteria 862
545 Ga0501265_003337 3300049762 Bacteria 1825
546 Ga0501035_0022705 3300049822 Bacteria 5763
547 Ga0501044_0011058 3300049823 Bacteria 9788
548 nmdc:mga0k408_54542_c1 3300050493 Bacteria 2317
549 nmdc:mga06z11_110842_c1 3300050494 Bacteria 1519
550 nmdc:mga07m45_13125_c1 3300050496 Bacteria 3558
551 nmdc:mga07m45_18526_c1 3300050496 Bacteria 3760
552 nmdc:mga08y16_695277_c1 3300050511 Bacteria 1017
553 Ga0500635_0439137 3300053080 Bacteria 517
554 Ga0495655_0128863 3300053083 Bacteria 777
555 Ga0500578_0001398 3300053086 Bacteria 24361
556 Ga0500578_0059651 3300053086 Bacteria 2438
557 Ga0500646_0050429 3300053090 Bacteria 1199
558 Ga0500651_0041492 3300053093 Bacteria 2900
559 Ga0500651_0122739 3300053093 Bacteria 1576
560 Ga0500650_0076887 3300053098 Bacteria 1560
561 Ga0500607_152417 3300053121 Bacteria 1069
562 Ga0500628_006474 3300053129 Bacteria 1982
563 Ga0500642_0000935 3300053130 Bacteria 8467
564 Ga0500652_000807 3300053131 Bacteria 10505
565 Ga0500652_074004 3300053131 Bacteria 1414
566 Ga0500561_0149788 3300053137 Bacteria 726
567 Ga0500568_0032786 3300053139 Bacteria 2134
568 Ga0500577_0005790 3300053142 Bacteria 3363
569 Ga0500604_0089754 3300053151 Bacteria 1002
570 Ga0500622_0000599 3300053156 Bacteria 32760
571 Ga0500622_0001554 3300053156 Bacteria 18138
572 Ga0500636_0301964 3300053177 Bacteria 788
573 Ga0500584_145099 3300053726 Bacteria 897
574 Ga0500645_001454 3300053730 Bacteria 11959
575 Ga0500587_018414 3300053739 Bacteria 899

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_1517025 Ga0496104_1517025_13_294 91
2 3300048913 Ga0496110_0999927 Ga0496110_0999927_58_339 91
3 3300005334 Ga0068869_101176350 Ga0068869_1011763501 106
4 3300013296 Ga0157374_10025500 Ga0157374_100255003 106
5 3300013297 Ga0157378_11296375 Ga0157378_112963752 106
6 iso_pu_bacteria 2599185292 2599904513 109
7 iso_pu_bacteria 2643221569 2643861102 109
8 iso_pu_bacteria 2643221594 2643983447 109
9 iso_pu_bacteria 2643221621 2644124403 109
10 iso_pu_bacteria 2808606395 2809032640 109
11 iso_pu_bacteria 2857537821 2857542328 109
12 iso_pu_bacteria 2858950400 2858951238 109
13 iso_pu_bacteria 2941479691 2941485430 109
14 iso_pu_bacteria 2585428057 2587726733 110
15 iso_pu_bacteria 2585428058 2587733229 110
16 iso_pu_bacteria 2588253510 2588294349 110
17 iso_pu_bacteria 2643221592 2643969030 110
18 iso_pu_bacteria 2643221625 2644144161 110
19 iso_pu_bacteria 2643221648 2644273281 110
20 iso_pu_bacteria 2643221654 2644304289 110
21 3300005330 Ga0070690_101187444 Ga0070690_1011874441 112
22 3300005331 Ga0070670_100094920 Ga0070670_1000949203 112
23 3300005364 Ga0070673_100359782 Ga0070673_1003597823 112
24 3300005618 Ga0068864_100619454 Ga0068864_1006194541 112
25 3300009177 Ga0105248_10437661 Ga0105248_104376612 112
26 3300010375 Ga0105239_10389954 Ga0105239_103899542 112
27 3300013296 Ga0157374_10723401 Ga0157374_107234012 112
28 3300013306 Ga0163162_11854613 Ga0163162_118546132 112
29 3300025925 Ga0207650_10006252 Ga0207650_100062524 112
30 3300025926 Ga0207659_10037997 Ga0207659_100379974 112
31 3300025960 Ga0207651_10021817 Ga0207651_100218174 112
32 3300026088 Ga0207641_11031668 Ga0207641_110316682 112
33 3300048903 Ga0496100_1296563 Ga0496100_1296563_94_438 112
34 3300005262 Ga0065165_1000613 Ga0065165_100061324 113
35 3300005327 Ga0070658_10715002 Ga0070658_107150022 113
36 3300005328 Ga0070676_10012268 Ga0070676_100122683 113
37 3300005328 Ga0070676_10176031 Ga0070676_101760311 113
38 3300005328 Ga0070676_10349101 Ga0070676_103491012 113
39 3300005328 Ga0070676_10731175 Ga0070676_107311751 113
40 3300005331 Ga0070670_100049061 Ga0070670_1000490613 113
41 3300005331 Ga0070670_100051811 Ga0070670_1000518114 113
42 3300005331 Ga0070670_100347009 Ga0070670_1003470092 113
43 3300005331 Ga0070670_100524844 Ga0070670_1005248441 113
44 3300005331 Ga0070670_100843976 Ga0070670_1008439761 113
45 3300005331 Ga0070670_101718009 Ga0070670_1017180091 113
46 3300005333 Ga0070677_10001509 Ga0070677_100015097 113
47 3300005333 Ga0070677_10059075 Ga0070677_100590752 113
48 3300005333 Ga0070677_10069930 Ga0070677_100699302 113
49 3300005333 Ga0070677_10645569 Ga0070677_106455691 113
50 3300005334 Ga0068869_100024693 Ga0068869_1000246934 113
51 3300005334 Ga0068869_101385859 Ga0068869_1013858591 113
52 3300005335 Ga0070666_10409488 Ga0070666_104094882 113
53 3300005335 Ga0070666_11515148 Ga0070666_115151481 113
54 3300005338 Ga0068868_100186265 Ga0068868_1001862652 113
55 3300005338 Ga0068868_100422401 Ga0068868_1004224012 113
56 3300005338 Ga0068868_100751597 Ga0068868_1007515972 113
57 3300005339 Ga0070660_100264192 Ga0070660_1002641922 113
58 3300005344 Ga0070661_100250424 Ga0070661_1002504241 113
59 3300005344 Ga0070661_100998872 Ga0070661_1009988721 113
60 3300005347 Ga0070668_100004749 Ga0070668_1000047494 113
61 3300005353 Ga0070669_100005812 Ga0070669_1000058126 113
62 3300005353 Ga0070669_100378281 Ga0070669_1003782811 113
63 3300005354 Ga0070675_100060429 Ga0070675_1000604293 113
64 3300005354 Ga0070675_100107739 Ga0070675_1001077392 113
65 3300005354 Ga0070675_101533680 Ga0070675_1015336801 113
66 3300005355 Ga0070671_100044017 Ga0070671_1000440173 113
67 3300005355 Ga0070671_100179923 Ga0070671_1001799231 113
68 3300005356 Ga0070674_100027028 Ga0070674_1000270284 113
69 3300005356 Ga0070674_100649309 Ga0070674_1006493092 113
70 3300005364 Ga0070673_100046038 Ga0070673_1000460382 113
71 3300005364 Ga0070673_100223579 Ga0070673_1002235793 113
72 3300005364 Ga0070673_100483061 Ga0070673_1004830612 113
73 3300005364 Ga0070673_100803485 Ga0070673_1008034851 113
74 3300005365 Ga0070688_101101631 Ga0070688_1011016311 113
75 3300005367 Ga0070667_100014226 Ga0070667_1000142262 113
76 3300005367 Ga0070667_101135574 Ga0070667_1011355741 113
77 3300005438 Ga0070701_10615094 Ga0070701_106150941 113
78 3300005455 Ga0070663_100161435 Ga0070663_1001614351 113
79 3300005455 Ga0070663_102022445 Ga0070663_1020224451 113
80 3300005455 Ga0070663_102111821 Ga0070663_1021118211 113
81 3300005456 Ga0070678_100123918 Ga0070678_1001239183 113
82 3300005456 Ga0070678_100335204 Ga0070678_1003352042 113
83 3300005456 Ga0070678_100429393 Ga0070678_1004293932 113
84 3300005456 Ga0070678_100490454 Ga0070678_1004904542 113
85 3300005456 Ga0070678_101070796 Ga0070678_1010707961 113
86 3300005457 Ga0070662_100028972 Ga0070662_1000289724 113
87 3300005459 Ga0068867_100000085 Ga0068867_10000008550 113
88 3300005459 Ga0068867_100017886 Ga0068867_1000178864 113
89 3300005459 Ga0068867_100708892 Ga0068867_1007088922 113
90 3300005459 Ga0068867_101700351 Ga0068867_1017003511 113
91 3300005471 Ga0070698_101132972 Ga0070698_1011329721 113
92 3300005543 Ga0070672_100023511 Ga0070672_1000235114 113
93 3300005543 Ga0070672_100062850 Ga0070672_1000628502 113
94 3300005543 Ga0070672_100065940 Ga0070672_1000659403 113
95 3300005543 Ga0070672_100405307 Ga0070672_1004053072 113
96 3300005544 Ga0070686_100274335 Ga0070686_1002743352 113
97 3300005548 Ga0070665_100307537 Ga0070665_1003075371 113
98 3300005548 Ga0070665_101040022 Ga0070665_1010400222 113
99 3300005563 Ga0068855_101140991 Ga0068855_1011409912 113
100 3300005564 Ga0070664_100325278 Ga0070664_1003252781 113
101 3300005564 Ga0070664_100456573 Ga0070664_1004565732 113
102 3300005564 Ga0070664_100834613 Ga0070664_1008346132 113
103 3300005616 Ga0068852_100046991 Ga0068852_1000469912 113
104 3300005616 Ga0068852_100363624 Ga0068852_1003636242 113
105 3300005616 Ga0068852_100657581 Ga0068852_1006575811 113
106 3300005617 Ga0068859_100050320 Ga0068859_1000503202 113
107 3300005618 Ga0068864_100035418 Ga0068864_1000354184 113
108 3300005618 Ga0068864_100487137 Ga0068864_1004871373 113
109 3300005618 Ga0068864_100654099 Ga0068864_1006540992 113
110 3300005618 Ga0068864_100695477 Ga0068864_1006954772 113
111 3300005718 Ga0068866_10006663 Ga0068866_100066634 113
112 3300005719 Ga0068861_100254351 Ga0068861_1002543514 113
113 3300005834 Ga0068851_10047765 Ga0068851_100477653 113
114 3300005834 Ga0068851_10380488 Ga0068851_103804882 113
115 3300005841 Ga0068863_100037925 Ga0068863_1000379253 113
116 3300005841 Ga0068863_100129756 Ga0068863_1001297562 113
117 3300005841 Ga0068863_100397394 Ga0068863_1003973943 113
118 3300005841 Ga0068863_102485322 Ga0068863_1024853222 113
119 3300005842 Ga0068858_100010943 Ga0068858_1000109435 113
120 3300005843 Ga0068860_100028165 Ga0068860_1000281655 113
121 3300005843 Ga0068860_101164481 Ga0068860_1011644812 113
122 3300005844 Ga0068862_100141087 Ga0068862_1001410872 113
123 3300005844 Ga0068862_102791602 Ga0068862_1027916021 113
124 3300006237 Ga0097621_100081987 Ga0097621_1000819872 113
125 3300006237 Ga0097621_102299376 Ga0097621_1022993761 113
126 3300006353 Ga0075370_10306622 Ga0075370_103066222 113
127 3300006358 Ga0068871_100250229 Ga0068871_1002502292 113
128 3300006358 Ga0068871_100552836 Ga0068871_1005528362 113
129 3300006358 Ga0068871_101092957 Ga0068871_1010929572 113
130 3300006881 Ga0068865_100021793 Ga0068865_1000217934 113
131 3300006881 Ga0068865_100434739 Ga0068865_1004347392 113
132 3300006881 Ga0068865_100486375 Ga0068865_1004863752 113
133 3300006881 Ga0068865_100794356 Ga0068865_1007943562 113
134 3300006931 Ga0097620_100050319 Ga0097620_1000503192 113
135 3300009094 Ga0111539_10522078 Ga0111539_105220782 113
136 3300009094 Ga0111539_11287014 Ga0111539_112870142 113
137 3300009098 Ga0105245_10197183 Ga0105245_101971834 113
138 3300009098 Ga0105245_11780477 Ga0105245_117804772 113
139 3300009148 Ga0105243_10046051 Ga0105243_100460514 113
140 3300009176 Ga0105242_10102944 Ga0105242_101029444 113
141 3300009177 Ga0105248_10008728 Ga0105248_100087284 113
142 3300009177 Ga0105248_10152958 Ga0105248_101529583 113
143 3300009177 Ga0105248_10217120 Ga0105248_102171203 113
144 3300009177 Ga0105248_10403275 Ga0105248_104032752 113
145 3300009177 Ga0105248_10406583 Ga0105248_104065832 113
146 3300009177 Ga0105248_10433870 Ga0105248_104338702 113
147 3300009553 Ga0105249_10052344 Ga0105249_100523443 113
148 3300013297 Ga0157378_10751674 Ga0157378_107516741 113
149 3300013297 Ga0157378_10989006 Ga0157378_109890061 113
150 3300013306 Ga0163162_10096444 Ga0163162_100964443 113
151 3300013306 Ga0163162_10447357 Ga0163162_104473574 113
152 3300013308 Ga0157375_10117617 Ga0157375_101176173 113
153 3300013308 Ga0157375_10380379 Ga0157375_103803792 113
154 3300014325 Ga0163163_10124389 Ga0163163_101243893 113
155 3300014325 Ga0163163_10379434 Ga0163163_103794343 113
156 3300014326 Ga0157380_10016562 Ga0157380_100165623 113
157 3300014326 Ga0157380_11612673 Ga0157380_116126732 113
158 3300014326 Ga0157380_11618520 Ga0157380_116185201 113
159 3300014745 Ga0157377_10000028 Ga0157377_1000002813 113
160 3300014968 Ga0157379_10073383 Ga0157379_100733833 113
161 3300014969 Ga0157376_10216193 Ga0157376_102161932 113
162 3300014969 Ga0157376_10471148 Ga0157376_104711482 113
163 3300017792 Ga0163161_10033682 Ga0163161_100336822 113
164 3300017792 Ga0163161_10067370 Ga0163161_100673701 113
165 3300025273 Ga0209673_1006240 Ga0209673_10062408 113
166 3300025292 Ga0209676_1013673 Ga0209676_10136732 113
167 3300025298 Ga0209050_1005099 Ga0209050_10050993 113
168 3300025299 Ga0209256_1013083 Ga0209256_10130834 113
169 3300025315 Ga0207697_10170901 Ga0207697_101709012 113
170 3300025893 Ga0207682_10005147 Ga0207682_100051474 113
171 3300025893 Ga0207682_10117551 Ga0207682_101175512 113
172 3300025893 Ga0207682_10578869 Ga0207682_105788691 113
173 3300025899 Ga0207642_10007496 Ga0207642_100074964 113
174 3300025901 Ga0207688_10479570 Ga0207688_104795702 113
175 3300025901 Ga0207688_10900752 Ga0207688_109007522 113
176 3300025903 Ga0207680_10278073 Ga0207680_102780732 113
177 3300025907 Ga0207645_10017366 Ga0207645_100173663 113
178 3300025907 Ga0207645_10065530 Ga0207645_100655301 113
179 3300025920 Ga0207649_10213642 Ga0207649_102136423 113
180 3300025920 Ga0207649_10779845 Ga0207649_107798452 113
181 3300025920 Ga0207649_10899563 Ga0207649_108995631 113
182 3300025923 Ga0207681_10028924 Ga0207681_100289242 113
183 3300025925 Ga0207650_10452144 Ga0207650_104521443 113
184 3300025925 Ga0207650_10902911 Ga0207650_109029111 113
185 3300025926 Ga0207659_10045679 Ga0207659_100456793 113
186 3300025927 Ga0207687_10168888 Ga0207687_101688883 113
187 3300025927 Ga0207687_10723387 Ga0207687_107233872 113
188 3300025927 Ga0207687_11389816 Ga0207687_113898161 113
189 3300025931 Ga0207644_10171359 Ga0207644_101713593 113
190 3300025933 Ga0207706_10052506 Ga0207706_100525064 113
191 3300025933 Ga0207706_10945924 Ga0207706_109459241 113
192 3300025934 Ga0207686_10228519 Ga0207686_102285192 113
193 3300025935 Ga0207709_10346432 Ga0207709_103464323 113
194 3300025937 Ga0207669_10014175 Ga0207669_100141752 113
195 3300025937 Ga0207669_10402379 Ga0207669_104023792 113
196 3300025938 Ga0207704_10003573 Ga0207704_100035733 113
197 3300025938 Ga0207704_10083915 Ga0207704_100839152 113
198 3300025938 Ga0207704_10206759 Ga0207704_102067592 113
199 3300025940 Ga0207691_10018444 Ga0207691_100184446 113
200 3300025940 Ga0207691_10054934 Ga0207691_100549344 113
201 3300025940 Ga0207691_10073621 Ga0207691_100736213 113
202 3300025940 Ga0207691_10120371 Ga0207691_101203712 113
203 3300025940 Ga0207691_10991036 Ga0207691_109910362 113
204 3300025941 Ga0207711_10010511 Ga0207711_100105117 113
205 3300025941 Ga0207711_10013603 Ga0207711_100136034 113
206 3300025941 Ga0207711_10236164 Ga0207711_102361642 113
207 3300025941 Ga0207711_10388539 Ga0207711_103885392 113
208 3300025941 Ga0207711_10428057 Ga0207711_104280572 113
209 3300025942 Ga0207689_10020073 Ga0207689_100200735 113
210 3300025945 Ga0207679_10047544 Ga0207679_100475443 113
211 3300025945 Ga0207679_10271438 Ga0207679_102714382 113
212 3300025945 Ga0207679_10957504 Ga0207679_109575041 113
213 3300025949 Ga0207667_10781458 Ga0207667_107814582 113
214 3300025960 Ga0207651_10031277 Ga0207651_100312772 113
215 3300025960 Ga0207651_10157750 Ga0207651_101577503 113
216 3300025961 Ga0207712_10013145 Ga0207712_100131454 113
217 3300025972 Ga0207668_10051620 Ga0207668_100516202 113
218 3300025972 Ga0207668_10164748 Ga0207668_101647483 113
219 3300025986 Ga0207658_10006549 Ga0207658_100065494 113
220 3300025986 Ga0207658_10118635 Ga0207658_101186351 113
221 3300025986 Ga0207658_11262218 Ga0207658_112622182 113
222 3300026023 Ga0207677_10049686 Ga0207677_100496862 113
223 3300026023 Ga0207677_10179612 Ga0207677_101796123 113
224 3300026023 Ga0207677_10622818 Ga0207677_106228181 113
225 3300026023 Ga0207677_10681283 Ga0207677_106812832 113
226 3300026035 Ga0207703_10062899 Ga0207703_100628993 113
227 3300026067 Ga0207678_10319364 Ga0207678_103193643 113
228 3300026075 Ga0207708_10010592 Ga0207708_100105929 113
229 3300026088 Ga0207641_10006217 Ga0207641_100062177 113
230 3300026088 Ga0207641_10012361 Ga0207641_100123615 113
231 3300026088 Ga0207641_10705541 Ga0207641_107055411 113
232 3300026089 Ga0207648_10000146 Ga0207648_1000014659 113
233 3300026089 Ga0207648_10005079 Ga0207648_100050794 113
234 3300026089 Ga0207648_10082049 Ga0207648_100820493 113
235 3300026089 Ga0207648_10278213 Ga0207648_102782132 113
236 3300026089 Ga0207648_10554974 Ga0207648_105549742 113
237 3300026095 Ga0207676_10041792 Ga0207676_100417924 113
238 3300026095 Ga0207676_10044926 Ga0207676_100449262 113
239 3300026095 Ga0207676_10227127 Ga0207676_102271271 113
240 3300026095 Ga0207676_11320480 Ga0207676_113204802 113
241 3300026118 Ga0207675_100004297 Ga0207675_1000042974 113
242 3300026121 Ga0207683_10013995 Ga0207683_100139956 113
243 3300026121 Ga0207683_10100393 Ga0207683_101003932 113
244 3300026121 Ga0207683_10226578 Ga0207683_102265782 113
245 3300026121 Ga0207683_10234264 Ga0207683_102342642 113
246 3300026121 Ga0207683_10267952 Ga0207683_102679523 113
247 3300026121 Ga0207683_10998049 Ga0207683_109980492 113
248 3300026142 Ga0207698_10563746 Ga0207698_105637462 113
249 3300027111 Ga0209281_1026979 Ga0209281_10269792 113
250 3300027296 Ga0209389_1024054 Ga0209389_10240542 113
251 3300027312 Ga0209371_1025422 Ga0209371_10254222 113
252 3300028379 Ga0268266_10422273 Ga0268266_104222731 113
253 3300028380 Ga0268265_10128933 Ga0268265_101289332 113
254 3300028381 Ga0268264_10068278 Ga0268264_100682782 113
255 3300028381 Ga0268264_10083481 Ga0268264_100834814 113
256 3300028381 Ga0268264_10391481 Ga0268264_103914812 113
257 3300028381 Ga0268264_10512757 Ga0268264_105127572 113
258 3300030500 Ga0268256_1024468 Ga0268256_10244682 113
259 3300030500 Ga0268256_1028922 Ga0268256_10289222 113
260 3300031239 Ga0265328_10006677 Ga0265328_100066773 113
261 3300031239 Ga0265328_10046030 Ga0265328_100460302 113
262 3300031251 Ga0265327_10000184 Ga0265327_1000018490 113
263 3300031344 Ga0265316_10000115 Ga0265316_1000011542 113
264 3300031730 Ga0307516_10402430 Ga0307516_104024302 113
265 3300031824 Ga0307413_10663488 Ga0307413_106634881 113
266 3300031852 Ga0307410_10023271 Ga0307410_100232715 113
267 3300031901 Ga0307406_10697564 Ga0307406_106975642 113
268 3300031911 Ga0307412_10001248 Ga0307412_1000124813 113
269 3300031911 Ga0307412_10149333 Ga0307412_101493333 113
270 3300031911 Ga0307412_10417928 Ga0307412_104179283 113
271 3300031995 Ga0307409_100266732 Ga0307409_1002667321 113
272 3300032002 Ga0307416_100041838 Ga0307416_1000418383 113
273 3300032004 Ga0307414_10581199 Ga0307414_105811992 113
274 3300032005 Ga0307411_10670025 Ga0307411_106700252 113
275 3300032005 Ga0307411_10714945 Ga0307411_107149452 113
276 3300037068 Ga0373925_0720811 Ga0373925_0720811_242_589 113
277 3300037471 Ga0395905_0003562 Ga0395905_0003562_15957_16310 113
278 3300037471 Ga0395905_0027611 Ga0395905_0027611_3724_4068 113
279 3300039437 Ga0436365_0636198 Ga0436365_0636198_131_478 113
280 3300042001 Ga0439441_017973 Ga0439441_017973_287_628 113
281 3300042007 Ga0439449_0094886 Ga0439449_0094886_628_1017 113
282 3300042008 Ga0439450_002823 Ga0439450_002823_766_1107 113
283 3300042012 Ga0439455_0020321 Ga0439455_0020321_102_449 113
284 3300042012 Ga0439455_0025785 Ga0439455_0025785_270_611 113
285 3300042137 Ga0450902_065066 Ga0450902_065066_73_417 113
286 3300042439 Ga0439464_0015768 Ga0439464_0015768_1179_1520 113
287 3300044656 Ga0466969_0058054 Ga0466969_0058054_816_1163 113
288 3300044658 Ga0466972_0030364 Ga0466972_0030364_1418_1762 113
289 3300044658 Ga0466972_0262744 Ga0466972_0262744_109_453 113
290 3300044683 Ga0466965_0022645 Ga0466965_0022645_1767_2111 113
291 3300044683 Ga0466965_0127947 Ga0466965_0127947_885_1232 113
292 3300044683 Ga0466965_0238955 Ga0466965_0238955_161_505 113
293 3300044684 Ga0466966_0114503 Ga0466966_0114503_622_969 113
294 3300044693 Ga0466961_0560862 Ga0466961_0560862_232_579 113
295 3300044693 Ga0466961_0600584 Ga0466961_0600584_131_475 113
296 3300044694 Ga0466963_0037912 Ga0466963_0037912_2523_2870 113
297 3300044706 Ga0466964_0004724 Ga0466964_0004724_3443_3790 113
298 3300044706 Ga0466964_0254815 Ga0466964_0254815_482_826 113
299 3300044719 Ga0466971_0083046 Ga0466971_0083046_622_969 113
300 3300044765 Ga0466970_0006015 Ga0466970_0006015_2201_2548 113
301 3300044842 Ga0466957_0008708 Ga0466957_0008708_5400_5747 113
302 3300044901 Ga0466960_0026574 Ga0466960_0026574_1107_1451 113
303 3300045049 Ga0466959_0000371 Ga0466959_0000371_17085_17432 113
304 3300045051 Ga0451576_0256394 Ga0451576_0256394_763_1116 113
305 3300045836 Ga0466958_0035526 Ga0466958_0035526_109_456 113
306 3300045976 Ga0466967_0029942 Ga0466967_0029942_628_975 113
307 3300046463 Ga0495653_0812535 Ga0495653_0812535_95_436 113
308 3300046473 Ga0495582_0488385 Ga0495582_0488385_71_418 113
309 3300046663 Ga0495635_0187047 Ga0495635_0187047_996_1337 113
310 3300046681 Ga0495647_0106307 Ga0495647_0106307_473_820 113
311 3300046691 Ga0495670_0044270 Ga0495670_0044270_1642_1983 113
312 3300048905 Ga0496102_0418951 Ga0496102_0418951_622_969 113
313 3300048907 Ga0496104_0664428 Ga0496104_0664428_317_661 113
314 3300048911 Ga0496108_0341169 Ga0496108_0341169_567_914 113
315 3300048911 Ga0496108_1190219 Ga0496108_1190219_21_368 113
316 3300048912 Ga0496109_0168653 Ga0496109_0168653_777_1124 113
317 3300048913 Ga0496110_0051053 Ga0496110_0051053_266_619 113
318 3300048913 Ga0496110_1062157 Ga0496110_1062157_352_693 113
319 3300048915 Ga0496112_0017310 Ga0496112_0017310_95_442 113
320 3300048916 Ga0496113_0642871 Ga0496113_0642871_42_389 113
321 3300048919 Ga0496116_0062807 Ga0496116_0062807_1636_1980 113
322 3300048919 Ga0496116_0214846 Ga0496116_0214846_596_940 113
323 3300048920 Ga0496117_0056563 Ga0496117_0056563_1160_1504 113
324 3300048920 Ga0496117_0058316 Ga0496117_0058316_1895_2239 113
325 3300048921 Ga0496118_0007262 Ga0496118_0007262_10210_10554 113
326 3300048921 Ga0496118_0035536 Ga0496118_0035536_1527_1871 113
327 3300048921 Ga0496118_0280743 Ga0496118_0280743_323_667 113
328 3300048922 Ga0496119_0014412 Ga0496119_0014412_4085_4429 113
329 3300048922 Ga0496119_0107698 Ga0496119_0107698_527_871 113
330 3300048923 Ga0496120_0019231 Ga0496120_0019231_1413_1757 113
331 3300048924 Ga0496121_0000748 Ga0496121_0000748_23115_23459 113
332 3300048924 Ga0496121_0021987 Ga0496121_0021987_1315_1659 113
333 3300048924 Ga0496121_0030262 Ga0496121_0030262_2298_2642 113
334 3300048925 Ga0496122_0001323 Ga0496122_0001323_30607_30951 113
335 3300048925 Ga0496122_0320601 Ga0496122_0320601_28_372 113
336 3300048926 Ga0496123_0000568 Ga0496123_0000568_53678_54022 113
337 3300048926 Ga0496123_0083369 Ga0496123_0083369_1139_1483 113
338 3300048927 Ga0496124_0000317 Ga0496124_0000317_7733_8077 113
339 3300048927 Ga0496124_0028462 Ga0496124_0028462_3987_4331 113
340 3300048927 Ga0496124_0367269 Ga0496124_0367269_461_805 113
341 3300048928 Ga0496125_0000096 Ga0496125_0000096_168725_169069 113
342 3300048928 Ga0496125_0014868 Ga0496125_0014868_7006_7350 113
343 3300048928 Ga0496125_0070327 Ga0496125_0070327_985_1329 113
344 3300048928 Ga0496125_0712742 Ga0496125_0712742_165_509 113
345 3300048929 Ga0496126_0090143 Ga0496126_0090143_1373_1717 113
346 3300048929 Ga0496126_0091471 Ga0496126_0091471_1331_1675 113
347 3300048929 Ga0496126_0123004 Ga0496126_0123004_1163_1504 113
348 3300049515 Ga0501292_000588 Ga0501292_000588_291_632 113
349 3300049525 Ga0501302_031871 Ga0501302_031871_17_358 113
350 3300049572 Ga0501036_1573485 Ga0501036_1573485_50_391 113
351 3300049574 Ga0501038_0021274 Ga0501038_0021274_957_1337 113
352 3300049581 Ga0501047_0508078 Ga0501047_0508078_92_472 113
353 3300049649 Ga0501198_000006 Ga0501198_000006_123274_123615 113
354 3300049653 Ga0501206_030296 Ga0501206_030296_440_781 113
355 3300049662 Ga0501222_000007 Ga0501222_000007_83249_83590 113
356 3300049676 Ga0501246_043466 Ga0501246_043466_138_479 113
357 3300049759 Ga0501262_023176 Ga0501262_023176_300_641 113
358 3300049762 Ga0501265_003337 Ga0501265_003337_474_815 113
359 3300049822 Ga0501035_0022705 Ga0501035_0022705_1538_1918 113
360 3300049823 Ga0501044_0011058 Ga0501044_0011058_6321_6701 113
361 3300050511 nmdc:mga08y16_695277_c1 nmdc:mga08y16_695277_c1_173_520 113
362 3300053156 Ga0500622_0001554 Ga0500622_0001554_10608_10973 113
363 3300002773 JGI25152J39213_1008231 JGI25152J39213_10082312 114
364 3300003215 JGI25153J46596_10000996 JGI25153J46596_100009965 114
365 3300003215 JGI25153J46596_10003477 JGI25153J46596_100034776 114
366 3300003771 Ga0055526_1014058 Ga0055526_10140585 114
367 3300003791 Ga0055530_10003267 Ga0055530_100032674 114
368 3300005262 Ga0065165_1002866 Ga0065165_10028661 114
369 3300005327 Ga0070658_11399790 Ga0070658_113997901 114
370 3300005328 Ga0070676_10027596 Ga0070676_100275963 114
371 3300005328 Ga0070676_10085154 Ga0070676_100851543 114
372 3300005328 Ga0070676_10274896 Ga0070676_102748963 114
373 3300005331 Ga0070670_100013636 Ga0070670_1000136362 114
374 3300005331 Ga0070670_100100127 Ga0070670_1001001272 114
375 3300005333 Ga0070677_10047482 Ga0070677_100474822 114
376 3300005334 Ga0068869_101919934 Ga0068869_1019199341 114
377 3300005335 Ga0070666_10158417 Ga0070666_101584172 114
378 3300005338 Ga0068868_100034050 Ga0068868_1000340502 114
379 3300005338 Ga0068868_100214972 Ga0068868_1002149722 114
380 3300005340 Ga0070689_100324720 Ga0070689_1003247202 114
381 3300005347 Ga0070668_100252510 Ga0070668_1002525102 114
382 3300005353 Ga0070669_100004931 Ga0070669_1000049313 114
383 3300005353 Ga0070669_100260405 Ga0070669_1002604053 114
384 3300005355 Ga0070671_100003667 Ga0070671_10000366711 114
385 3300005355 Ga0070671_100062955 Ga0070671_1000629554 114
386 3300005355 Ga0070671_100088819 Ga0070671_1000888194 114
387 3300005356 Ga0070674_100006142 Ga0070674_1000061423 114
388 3300005356 Ga0070674_100026379 Ga0070674_1000263795 114
389 3300005364 Ga0070673_100009720 Ga0070673_1000097204 114
390 3300005364 Ga0070673_100770357 Ga0070673_1007703572 114
391 3300005367 Ga0070667_100003317 Ga0070667_10000331711 114
392 3300005367 Ga0070667_100377070 Ga0070667_1003770702 114
393 3300005367 Ga0070667_100717114 Ga0070667_1007171141 114
394 3300005441 Ga0070700_100408130 Ga0070700_1004081302 114
395 3300005456 Ga0070678_100072719 Ga0070678_1000727192 114
396 3300005456 Ga0070678_100531525 Ga0070678_1005315251 114
397 3300005456 Ga0070678_100938621 Ga0070678_1009386212 114
398 3300005457 Ga0070662_101168204 Ga0070662_1011682041 114
399 3300005459 Ga0068867_100237600 Ga0068867_1002376002 114
400 3300005459 Ga0068867_100294488 Ga0068867_1002944883 114
401 3300005466 Ga0070685_10580770 Ga0070685_105807702 114
402 3300005543 Ga0070672_100017990 Ga0070672_1000179906 114
403 3300005543 Ga0070672_100925897 Ga0070672_1009258972 114
404 3300005543 Ga0070672_101054378 Ga0070672_1010543781 114
405 3300005548 Ga0070665_100071010 Ga0070665_1000710104 114
406 3300005548 Ga0070665_100645562 Ga0070665_1006455622 114
407 3300005564 Ga0070664_100320722 Ga0070664_1003207221 114
408 3300005578 Ga0068854_100178109 Ga0068854_1001781094 114
409 3300005617 Ga0068859_100183425 Ga0068859_1001834252 114
410 3300005617 Ga0068859_100516332 Ga0068859_1005163322 114
411 3300005618 Ga0068864_100023736 Ga0068864_1000237365 114
412 3300005718 Ga0068866_10771229 Ga0068866_107712291 114
413 3300005719 Ga0068861_100938408 Ga0068861_1009384081 114
414 3300005834 Ga0068851_10141868 Ga0068851_101418682 114
415 3300005834 Ga0068851_10350278 Ga0068851_103502782 114
416 3300005840 Ga0068870_10060960 Ga0068870_100609603 114
417 3300005841 Ga0068863_100014193 Ga0068863_1000141932 114
418 3300005841 Ga0068863_101024468 Ga0068863_1010244682 114
419 3300005843 Ga0068860_100324206 Ga0068860_1003242063 114
420 3300005843 Ga0068860_101179606 Ga0068860_1011796062 114
421 3300006237 Ga0097621_100756762 Ga0097621_1007567621 114
422 3300006353 Ga0075370_10001130 Ga0075370_100011304 114
423 3300006358 Ga0068871_100057992 Ga0068871_1000579923 114
424 3300006358 Ga0068871_100206018 Ga0068871_1002060184 114
425 3300006881 Ga0068865_100185259 Ga0068865_1001852592 114
426 3300006931 Ga0097620_100183432 Ga0097620_1001834322 114
427 3300006931 Ga0097620_100516313 Ga0097620_1005163132 114
428 3300009098 Ga0105245_10091026 Ga0105245_100910264 114
429 3300009098 Ga0105245_12782977 Ga0105245_127829771 114
430 3300009174 Ga0105241_12102059 Ga0105241_121020592 114
431 3300009176 Ga0105242_13018297 Ga0105242_130182972 114
432 3300009177 Ga0105248_11665486 Ga0105248_116654862 114
433 3300009545 Ga0105237_10546956 Ga0105237_105469562 114
434 3300013296 Ga0157374_10566869 Ga0157374_105668692 114
435 3300013297 Ga0157378_10037022 Ga0157378_100370223 114
436 3300013297 Ga0157378_11873670 Ga0157378_118736702 114
437 3300013306 Ga0163162_10070427 Ga0163162_100704273 114
438 3300013306 Ga0163162_10329941 Ga0163162_103299412 114
439 3300013308 Ga0157375_10034082 Ga0157375_100340825 114
440 3300013308 Ga0157375_10070238 Ga0157375_100702383 114
441 3300013308 Ga0157375_10737897 Ga0157375_107378971 114
442 3300014325 Ga0163163_10347531 Ga0163163_103475311 114
443 3300014325 Ga0163163_11278999 Ga0163163_112789992 114
444 3300014326 Ga0157380_10321458 Ga0157380_103214582 114
445 3300014968 Ga0157379_10132738 Ga0157379_101327384 114
446 3300014968 Ga0157379_10660248 Ga0157379_106602482 114
447 3300014968 Ga0157379_11259822 Ga0157379_112598222 114
448 3300014968 Ga0157379_11397789 Ga0157379_113977892 114
449 3300014969 Ga0157376_10353261 Ga0157376_103532611 114
450 3300014969 Ga0157376_11062921 Ga0157376_110629212 114
451 3300014969 Ga0157376_11216848 Ga0157376_112168482 114
452 3300014969 Ga0157376_12219093 Ga0157376_122190932 114
453 3300017792 Ga0163161_10026997 Ga0163161_100269974 114
454 3300025245 Ga0207425_1000519 Ga0207425_100051923 114
455 3300025258 Ga0209129_1000075 Ga0209129_100007510 114
456 3300025263 Ga0209565_1054691 Ga0209565_10546912 114
457 3300025273 Ga0209673_1003475 Ga0209673_10034752 114
458 3300025273 Ga0209673_1029058 Ga0209673_10290582 114
459 3300025295 Ga0209564_1000046 Ga0209564_1000046174 114
460 3300025297 Ga0209758_1000052 Ga0209758_1000052289 114
461 3300025297 Ga0209758_1000369 Ga0209758_100036976 114
462 3300025298 Ga0209050_1000202 Ga0209050_100020298 114
463 3300025299 Ga0209256_1031338 Ga0209256_10313382 114
464 3300025303 Ga0209051_1007707 Ga0209051_10077074 114
465 3300025321 Ga0207656_10104221 Ga0207656_101042212 114
466 3300025321 Ga0207656_10341611 Ga0207656_103416111 114
467 3300025893 Ga0207682_10002379 Ga0207682_100023796 114
468 3300025899 Ga0207642_10217534 Ga0207642_102175342 114
469 3300025901 Ga0207688_10120375 Ga0207688_101203753 114
470 3300025903 Ga0207680_10126619 Ga0207680_101266193 114
471 3300025903 Ga0207680_10211636 Ga0207680_102116362 114
472 3300025907 Ga0207645_10171202 Ga0207645_101712024 114
473 3300025908 Ga0207643_10078138 Ga0207643_100781383 114
474 3300025923 Ga0207681_10062019 Ga0207681_100620193 114
475 3300025923 Ga0207681_10626196 Ga0207681_106261962 114
476 3300025925 Ga0207650_10001450 Ga0207650_100014503 114
477 3300025925 Ga0207650_10094840 Ga0207650_100948403 114
478 3300025925 Ga0207650_10540229 Ga0207650_105402292 114
479 3300025926 Ga0207659_10124924 Ga0207659_101249242 114
480 3300025926 Ga0207659_11063883 Ga0207659_110638831 114
481 3300025927 Ga0207687_10010456 Ga0207687_100104563 114
482 3300025927 Ga0207687_11043960 Ga0207687_110439602 114
483 3300025931 Ga0207644_10009040 Ga0207644_100090403 114
484 3300025931 Ga0207644_10022840 Ga0207644_100228403 114
485 3300025933 Ga0207706_10384296 Ga0207706_103842962 114
486 3300025936 Ga0207670_10126568 Ga0207670_101265683 114
487 3300025937 Ga0207669_10065172 Ga0207669_100651721 114
488 3300025937 Ga0207669_10086912 Ga0207669_100869123 114
489 3300025938 Ga0207704_10433843 Ga0207704_104338431 114
490 3300025940 Ga0207691_10015818 Ga0207691_100158183 114
491 3300025940 Ga0207691_10513520 Ga0207691_105135201 114
492 3300025942 Ga0207689_11083830 Ga0207689_110838302 114
493 3300025945 Ga0207679_10110106 Ga0207679_101101063 114
494 3300025960 Ga0207651_10045261 Ga0207651_100452613 114
495 3300025981 Ga0207640_10887244 Ga0207640_108872442 114
496 3300025986 Ga0207658_10003189 Ga0207658_100031895 114
497 3300025986 Ga0207658_10145630 Ga0207658_101456302 114
498 3300025986 Ga0207658_10697793 Ga0207658_106977932 114
499 3300025986 Ga0207658_11144940 Ga0207658_111449402 114
500 3300026023 Ga0207677_10015594 Ga0207677_100155942 114
501 3300026023 Ga0207677_10372637 Ga0207677_103726371 114
502 3300026088 Ga0207641_10148927 Ga0207641_101489272 114
503 3300026088 Ga0207641_10200863 Ga0207641_102008632 114
504 3300026089 Ga0207648_10031809 Ga0207648_100318093 114
505 3300026089 Ga0207648_10045581 Ga0207648_100455813 114
506 3300026089 Ga0207648_10203297 Ga0207648_102032973 114
507 3300026089 Ga0207648_10264334 Ga0207648_102643342 114
508 3300026095 Ga0207676_11799130 Ga0207676_117991302 114
509 3300026118 Ga0207675_101644906 Ga0207675_1016449061 114
510 3300026121 Ga0207683_10025378 Ga0207683_100253785 114
511 3300026121 Ga0207683_10109452 Ga0207683_101094522 114
512 3300026121 Ga0207683_10800567 Ga0207683_108005672 114
513 3300028379 Ga0268266_10099882 Ga0268266_100998823 114
514 3300028381 Ga0268264_10217435 Ga0268264_102174352 114
515 3300028381 Ga0268264_12694698 Ga0268264_126946981 114
516 3300028786 Ga0307517_10167594 Ga0307517_101675944 114
517 3300028794 Ga0307515_10012290 Ga0307515_100122905 114
518 3300028794 Ga0307515_10027144 Ga0307515_100271446 114
519 3300031456 Ga0307513_10236577 Ga0307513_102365772 114
520 3300031456 Ga0307513_10405874 Ga0307513_104058742 114
521 3300031548 Ga0307408_100083242 Ga0307408_1000832423 114
522 3300031548 Ga0307408_100192225 Ga0307408_1001922253 114
523 3300031548 Ga0307408_101582587 Ga0307408_1015825872 114
524 3300031649 Ga0307514_10227038 Ga0307514_102270382 114
525 3300031731 Ga0307405_10004178 Ga0307405_100041784 114
526 3300031731 Ga0307405_11821657 Ga0307405_118216571 114
527 3300031824 Ga0307413_10000382 Ga0307413_100003828 114
528 3300031824 Ga0307413_10280659 Ga0307413_102806591 114
529 3300031824 Ga0307413_10825736 Ga0307413_108257362 114
530 3300031852 Ga0307410_10063639 Ga0307410_100636394 114
531 3300031852 Ga0307410_10142693 Ga0307410_101426934 114
532 3300031852 Ga0307410_10263405 Ga0307410_102634051 114
533 3300031901 Ga0307406_10028686 Ga0307406_100286862 114
534 3300031903 Ga0307407_10740540 Ga0307407_107405401 114
535 3300031911 Ga0307412_10014839 Ga0307412_100148395 114
536 3300031995 Ga0307409_100034041 Ga0307409_1000340415 114
537 3300031995 Ga0307409_101597123 Ga0307409_1015971232 114
538 3300031995 Ga0307409_102721872 Ga0307409_1027218721 114
539 3300032002 Ga0307416_100028719 Ga0307416_1000287193 114
540 3300032002 Ga0307416_100078096 Ga0307416_1000780963 114
541 3300032002 Ga0307416_100292283 Ga0307416_1002922831 114
542 3300032004 Ga0307414_10118315 Ga0307414_101183153 114
543 3300032005 Ga0307411_10003562 Ga0307411_100035624 114
544 3300032005 Ga0307411_10040610 Ga0307411_100406104 114
545 3300032005 Ga0307411_10196799 Ga0307411_101967993 114
546 3300032005 Ga0307411_10794084 Ga0307411_107940842 114
547 3300032126 Ga0307415_100078353 Ga0307415_1000783533 114
548 3300033180 Ga0307510_10001502 Ga0307510_1000150211 114
549 3300035171 Ga0373946_0110662 Ga0373946_0110662_378_722 114
550 3300035691 Ga0373931_0907307 Ga0373931_0907307_176_520 114
551 3300037068 Ga0373925_0131292 Ga0373925_0131292_1091_1435 114
552 3300037466 Ga0395898_0376603 Ga0395898_0376603_438_800 114
553 3300041456 Ga0451795_1607973 Ga0451795_1607973_681_1028 114
554 3300041459 Ga0451800_1676192 Ga0451800_1676192_1243_1590 114
555 3300041491 Ga0451833_0562403 Ga0451833_0562403_35_379 114
556 3300046460 Ga0495638_0049265 Ga0495638_0049265_1485_1832 114
557 3300046519 Ga0495632_0003371 Ga0495632_0003371_7317_7664 114
558 3300046542 Ga0495597_0288816 Ga0495597_0288816_244_588 114
559 3300046616 Ga0495668_0045224 Ga0495668_0045224_1960_2304 114
560 3300046692 Ga0495671_0037139 Ga0495671_0037139_581_925 114
561 3300047472 Ga0495686_0485619 Ga0495686_0485619_160_504 114
562 3300047472 Ga0495686_0637678 Ga0495686_0637678_173_517 114
563 3300048915 Ga0496112_0889644 Ga0496112_0889644_192_536 114
564 3300048917 Ga0496114_1127872 Ga0496114_1127872_252_596 114
565 3300050493 nmdc:mga0k408_54542_c1 nmdc:mga0k408_54542_c1_1533_1880 114
566 3300050494 nmdc:mga06z11_110842_c1 nmdc:mga06z11_110842_c1_1042_1389 114
567 3300050496 nmdc:mga07m45_13125_c1 nmdc:mga07m45_13125_c1_1528_1875 114
568 3300050496 nmdc:mga07m45_18526_c1 nmdc:mga07m45_18526_c1_1066_1410 114
569 3300053080 Ga0500635_0439137 Ga0500635_0439137_70_414 114
570 3300053083 Ga0495655_0128863 Ga0495655_0128863_135_479 114
571 3300053086 Ga0500578_0001398 Ga0500578_0001398_3133_3480 114
572 3300053086 Ga0500578_0059651 Ga0500578_0059651_1061_1405 114
573 3300053090 Ga0500646_0050429 Ga0500646_0050429_69_416 114
574 3300053093 Ga0500651_0041492 Ga0500651_0041492_1904_2251 114
575 3300053093 Ga0500651_0122739 Ga0500651_0122739_326_673 114
576 3300053098 Ga0500650_0076887 Ga0500650_0076887_866_1213 114
577 3300053121 Ga0500607_152417 Ga0500607_152417_701_1045 114
578 3300053129 Ga0500628_006474 Ga0500628_006474_974_1321 114
579 3300053130 Ga0500642_0000935 Ga0500642_0000935_1507_1854 114
580 3300053131 Ga0500652_000807 Ga0500652_000807_1320_1667 114
581 3300053131 Ga0500652_074004 Ga0500652_074004_1047_1391 114
582 3300053137 Ga0500561_0149788 Ga0500561_0149788_189_536 114
583 3300053139 Ga0500568_0032786 Ga0500568_0032786_1433_1780 114
584 3300053142 Ga0500577_0005790 Ga0500577_0005790_2233_2580 114
585 3300053151 Ga0500604_0089754 Ga0500604_0089754_123_470 114
586 3300053156 Ga0500622_0000599 Ga0500622_0000599_18297_18644 114
587 3300053177 Ga0500636_0301964 Ga0500636_0301964_268_612 114
588 3300053726 Ga0500584_145099 Ga0500584_145099_44_391 114
589 3300053730 Ga0500645_001454 Ga0500645_001454_1210_1554 114
590 3300053739 Ga0500587_018414 Ga0500587_018414_40_384 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04273

BLH_phosphatase

Beta-lactamase hydrolase-like protein, phosphatase-like domain

5

114

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.8908 7 114
3gxg-assembly1.cif.gz_A crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution 0.868 6 112
2f46-assembly2.cif.gz_B crystal structure of a putative phosphatase (nma1982) from neisseria meningitidis z2491 at 1.41 a resolution 0.8403 7 114
3gxh-assembly3.cif.gz_B crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.40 a resolution 0.8223 6 113
3gxg-assembly1.cif.gz_A crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution 0.791 6 112
ID Description Score Start End Superfamily
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8904 5 114 3.90.190.10
2f46B00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8542 5 114 3.90.190.10
af_A4HTV6_250_347_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8511 21 87 3.90.190.10
3gxhB00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8268 6 113 3.90.190.10
af_Q7EYM9_283_443_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8176 4 101 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A254NFZ4-F1-model_v4 TIGR01244 family protein 1.001 6 112 GO:0016787
AF-A0A5C0ASX7-F1-model_v4 TIGR01244 family phosphatase 0.9953 5 112 GO:0016787
AF-A0A2U8FRR3-F1-model_v4 TIGR01244 family phosphatase 0.9936 2 113 GO:0016787
AF-A0A257FQY4-F1-model_v4 deleted 0.9918 6 114
AF-A0A7H4K0P0-F1-model_v4 deleted 0.9916 27 113

Feature Viewer

pLDDT pTM Quality
95.39 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map