F466978

General Info

Members Datasets Scaffolds Average Seq Length
590 244 573 246

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100147165|Ga0307415_1001471651
Length 274
Sequence MAAHGARIRVARRKSRKVLWIGPLTQYTNAMGSVHPLFGDSPVPRYAQLADVLRGRIARGQLKRGDQLPTLEELMQEFDVARVTVRQAIELLSREGLITAQQGRGTFVTATPSKAGRLHLQTSLAELAEVYRNDKPELTLIEEVAAMPVLDAADGRPARRYHFMRRVHSRDGVPYCVISIYLDNRVFRMAANRFRRETVVPVLLDLPRVQIARASQTLAIASADVEVAGLIGIPVNSPVAEVRRVCVGPDDTVLYLGQVTYRGDFVRLEMDLTP

Samples

Sample ID Description Type Environment
1 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
2 2643221651 Afipia sp. Root123D2 Isolate Unclassified
3 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
4 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
5 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
6 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
7 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
8 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
9 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
10 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
11 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
12 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
13 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
14 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
15 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
16 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
96 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
189 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
190 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 2.2
Rhizoplane 2.2
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000223 3300001991 Bacteria 5965
2 JGI24744J21845_10001278 3300002077 Bacteria 4954
3 JGI24034J26672_10013159 3300002239 Bacteria 1254
4 rootL2_10018900 3300003322 Bacteria 1503
5 rootH1_10082096 3300003323 Bacteria 8605
6 Ga0065715_10130365 3300005293 Bacteria 2028
7 Ga0070658_10043196 3300005327 Bacteria 3642
8 Ga0070658_10088965 3300005327 Bacteria 2542
9 Ga0070676_10024198 3300005328 Bacteria 3418
10 Ga0070676_10041240 3300005328 Bacteria 2676
11 Ga0070676_10047231 3300005328 Bacteria 2514
12 Ga0070676_10063214 3300005328 Bacteria 2204
13 Ga0070683_100008289 3300005329 Bacteria 8831
14 Ga0070683_100019073 3300005329 Bacteria 6086
15 Ga0070683_100056639 3300005329 Bacteria 3640
16 Ga0070690_100008676 3300005330 Bacteria 5864
17 Ga0070690_100022460 3300005330 Bacteria 3859
18 Ga0070690_100047600 3300005330 Bacteria 2729
19 Ga0070670_100012247 3300005331 Bacteria 7337
20 Ga0070670_100069322 3300005331 Bacteria 3027
21 Ga0070670_100542698 3300005331 Bacteria 1037
22 Ga0070677_10006194 3300005333 Bacteria 3970
23 Ga0070677_10012365 3300005333 Bacteria 2965
24 Ga0070677_10019113 3300005333 Bacteria 2477
25 Ga0068869_100033904 3300005334 Bacteria 3608
26 Ga0068869_100069287 3300005334 Bacteria 2607
27 Ga0068869_100161273 3300005334 Bacteria 1746
28 Ga0068869_100172798 3300005334 Bacteria 1689
29 Ga0068869_100229642 3300005334 Bacteria 1474
30 Ga0070666_10000894 3300005335 Bacteria 18149
31 Ga0070666_10003581 3300005335 Bacteria 9411
32 Ga0070666_10015784 3300005335 Bacteria 4823
33 Ga0070680_100104300 3300005336 Bacteria 2356
34 Ga0070680_100423753 3300005336 Bacteria 1135
35 Ga0070682_100029473 3300005337 Bacteria 3305
36 Ga0068868_100000223 3300005338 Bacteria 38565
37 Ga0068868_100050818 3300005338 Bacteria 3257
38 Ga0070660_100109902 3300005339 Bacteria 2192
39 Ga0070660_100145337 3300005339 Bacteria 1904
40 Ga0070660_100212943 3300005339 Bacteria 1569
41 Ga0070660_100700685 3300005339 Bacteria 849
42 Ga0070689_100022697 3300005340 Bacteria 4688
43 Ga0070687_100001547 3300005343 Bacteria 8153
44 Ga0070687_100030974 3300005343 Bacteria 2620
45 Ga0070661_100000823 3300005344 Bacteria 22314
46 Ga0070661_100004472 3300005344 Bacteria 9641
47 Ga0070661_100010830 3300005344 Bacteria 6348
48 Ga0070661_100021650 3300005344 Bacteria 4595
49 Ga0070661_100112666 3300005344 Bacteria 2032
50 Ga0070692_10051595 3300005345 Bacteria 2140
51 Ga0070668_100021140 3300005347 Bacteria 4919
52 Ga0070668_100028124 3300005347 Bacteria 4268
53 Ga0070668_100411464 3300005347 Bacteria 1156
54 Ga0070669_100047171 3300005353 Bacteria 3142
55 Ga0070669_100071843 3300005353 Bacteria 2561
56 Ga0070669_100211102 3300005353 Unclassified 1531
57 Ga0070675_100012762 3300005354 Bacteria 6590
58 Ga0070675_100018072 3300005354 Bacteria 5611
59 Ga0070675_100029812 3300005354 Bacteria 4401
60 Ga0070671_100019274 3300005355 Bacteria 5550
61 Ga0070671_100023768 3300005355 Bacteria 5017
62 Ga0070671_100052524 3300005355 Bacteria 3388
63 Ga0070674_100070892 3300005356 Bacteria 2463
64 Ga0070674_100122423 3300005356 Bacteria 1928
65 Ga0070673_100018574 3300005364 Bacteria 4971
66 Ga0070673_100025339 3300005364 Bacteria 4364
67 Ga0070673_100078362 3300005364 Bacteria 2673
68 Ga0070673_100129871 3300005364 Bacteria 2112
69 Ga0070673_100304904 3300005364 Bacteria 1403
70 Ga0070688_100000396 3300005365 Bacteria 22123
71 Ga0070688_100014515 3300005365 Bacteria 4465
72 Ga0070659_100008045 3300005366 Bacteria 7687
73 Ga0070659_100043565 3300005366 Bacteria 3510
74 Ga0070659_100048773 3300005366 Bacteria 3328
75 Ga0070659_100227470 3300005366 Bacteria 1541
76 Ga0070667_100002505 3300005367 Bacteria 16024
77 Ga0070667_100106518 3300005367 Bacteria 2427
78 Ga0070667_100273900 3300005367 Bacteria 1514
79 Ga0070709_10008317 3300005434 Bacteria 5696
80 Ga0070709_10204262 3300005434 Bacteria 1401
81 Ga0070709_10367701 3300005434 Bacteria 1066
82 Ga0070714_100003529 3300005435 Bacteria 11682
83 Ga0070714_100076063 3300005435 Bacteria 2914
84 Ga0070714_100325002 3300005435 Bacteria 1439
85 Ga0070713_100007608 3300005436 Bacteria 7621
86 Ga0070713_100098773 3300005436 Bacteria 2525
87 Ga0070710_10030807 3300005437 Bacteria 2889
88 Ga0070710_10169035 3300005437 Bacteria 1361
89 Ga0070701_10030537 3300005438 Bacteria 2667
90 Ga0070711_100070402 3300005439 Bacteria 2463
91 Ga0070663_100256718 3300005455 Bacteria 1385
92 Ga0070663_100362497 3300005455 Bacteria 1176
93 Ga0070678_100052020 3300005456 Bacteria 2972
94 Ga0070678_100503452 3300005456 Bacteria 1069
95 Ga0070662_100007116 3300005457 Bacteria 7241
96 Ga0070662_100028130 3300005457 Bacteria 3909
97 Ga0070662_100183439 3300005457 Bacteria 1651
98 Ga0070681_10001413 3300005458 Bacteria 21075
99 Ga0070681_10001542 3300005458 Bacteria 20408
100 Ga0070681_10010938 3300005458 Bacteria 8975
101 Ga0070681_10087414 3300005458 Bacteria 3070
102 Ga0070681_10210857 3300005458 Bacteria 1859
103 Ga0070681_10500756 3300005458 Unclassified 1128
104 Ga0068867_100011980 3300005459 Bacteria 6127
105 Ga0068867_100041968 3300005459 Bacteria 3344
106 Ga0068867_100617999 3300005459 Bacteria 947
107 Ga0070685_10023533 3300005466 Bacteria 3373
108 Ga0070685_10169095 3300005466 Bacteria 1400
109 Ga0070698_100478658 3300005471 Unclassified 1182
110 Ga0070699_100038780 3300005518 Bacteria 4124
111 Ga0070679_100003190 3300005530 Bacteria 14983
112 Ga0070679_100011789 3300005530 Bacteria 8336
113 Ga0070679_100013566 3300005530 Bacteria 7808
114 Ga0070679_100047260 3300005530 Bacteria 4290
115 Ga0070684_100003996 3300005535 Bacteria 11163
116 Ga0070684_100013539 3300005535 Bacteria 6581
117 Ga0070684_100039922 3300005535 Bacteria 4039
118 Ga0068853_100041254 3300005539 Bacteria 3941
119 Ga0068853_100072190 3300005539 Bacteria 3007
120 Ga0068853_100104470 3300005539 Bacteria 2508
121 Ga0068853_100105808 3300005539 Bacteria 2493
122 Ga0068853_100434682 3300005539 Bacteria 1233
123 Ga0070672_100001303 3300005543 Bacteria 15378
124 Ga0070672_100003805 3300005543 Bacteria 9826
125 Ga0070672_100109624 3300005543 Bacteria 2248
126 Ga0070686_100336654 3300005544 Bacteria 1130
127 Ga0070686_100642320 3300005544 Bacteria 841
128 Ga0070696_100009732 3300005546 Bacteria 6431
129 Ga0070696_100421475 3300005546 Bacteria 1048
130 Ga0070693_100059420 3300005547 Bacteria 2216
131 Ga0070693_100183680 3300005547 Bacteria 1348
132 Ga0070704_100185149 3300005549 Bacteria 1669
133 Ga0068855_100002157 3300005563 Bacteria 24326
134 Ga0068855_100020406 3300005563 Bacteria 7947
135 Ga0068855_100131286 3300005563 Bacteria 2861
136 Ga0068855_100145360 3300005563 Bacteria 2700
137 Ga0068855_100203386 3300005563 Bacteria 2229
138 Ga0068855_100218633 3300005563 Bacteria 2138
139 Ga0068855_100250135 3300005563 Bacteria 1977
140 Ga0070664_100001435 3300005564 Bacteria 19005
141 Ga0070664_100008416 3300005564 Bacteria 8341
142 Ga0070664_100057847 3300005564 Bacteria 3297
143 Ga0070664_100060705 3300005564 Bacteria 3220
144 Ga0070664_100251891 3300005564 Bacteria 1587
145 Ga0070664_100393207 3300005564 Bacteria 1267
146 Ga0068857_100000326 3300005577 Bacteria 32742
147 Ga0068857_100016778 3300005577 Bacteria 6415
148 Ga0068854_100017452 3300005578 Bacteria 4802
149 Ga0068854_100020170 3300005578 Bacteria 4504
150 Ga0068854_100022553 3300005578 Bacteria 4292
151 Ga0068856_100004005 3300005614 Bacteria 14752
152 Ga0068856_100027648 3300005614 Bacteria 5534
153 Ga0068856_100201165 3300005614 Bacteria 2006
154 Ga0068856_100347252 3300005614 Bacteria 1502
155 Ga0070702_100025669 3300005615 Bacteria 3160
156 Ga0068852_100000371 3300005616 Bacteria 30327
157 Ga0068852_100026908 3300005616 Bacteria 4681
158 Ga0068852_100041201 3300005616 Bacteria 3901
159 Ga0068852_100051055 3300005616 Bacteria 3547
160 Ga0068852_100138014 3300005616 Bacteria 2253
161 Ga0068852_100139797 3300005616 Bacteria 2240
162 Ga0068852_100153793 3300005616 Bacteria 2141
163 Ga0068852_100217060 3300005616 Bacteria 1817
164 Ga0068852_100720021 3300005616 Bacteria 1009
165 Ga0068859_100008374 3300005617 Bacteria 10481
166 Ga0068859_100012418 3300005617 Bacteria 8570
167 Ga0068859_100170950 3300005617 Bacteria 2254
168 Ga0068859_100433968 3300005617 Bacteria 1410
169 Ga0068864_100000242 3300005618 Bacteria 48756
170 Ga0068864_100016236 3300005618 Bacteria 6196
171 Ga0068866_10003255 3300005718 Bacteria 6690
172 Ga0068861_100034095 3300005719 Bacteria 3762
173 Ga0068861_100181955 3300005719 Bacteria 1750
174 Ga0068851_10007153 3300005834 Bacteria 5115
175 Ga0068870_10018393 3300005840 Bacteria 3373
176 Ga0068863_100087721 3300005841 Bacteria 2948
177 Ga0068863_100127611 3300005841 Bacteria 2427
178 Ga0068863_100164026 3300005841 Bacteria 2130
179 Ga0068863_100175737 3300005841 Bacteria 2055
180 Ga0068863_100252757 3300005841 Bacteria 1703
181 Ga0068858_100001107 3300005842 Bacteria 27868
182 Ga0068858_100004127 3300005842 Bacteria 14294
183 Ga0068858_100036868 3300005842 Bacteria 4533
184 Ga0068860_100064079 3300005843 Bacteria 3491
185 Ga0068860_100092518 3300005843 Bacteria 2881
186 Ga0068862_100017241 3300005844 Bacteria 6011
187 Ga0075366_10111454 3300006195 Bacteria 1646
188 Ga0097621_100158475 3300006237 Bacteria 1944
189 Ga0075370_10030323 3300006353 Bacteria 3017
190 Ga0068871_100122991 3300006358 Bacteria 2194
191 Ga0075428_100051121 3300006844 Bacteria 4532
192 Ga0068865_100045553 3300006881 Bacteria 3007
193 Ga0075436_100164867 3300006914 Bacteria 1563
194 Ga0097620_100008374 3300006931 Bacteria 10481
195 Ga0097620_100012420 3300006931 Bacteria 8570
196 Ga0097620_100170938 3300006931 Bacteria 2254
197 Ga0097620_100433953 3300006931 Bacteria 1410
198 Ga0099824_1021223 3300006942 Bacteria 4583
199 Ga0099823_1000008 3300006944 Bacteria 105646
200 Ga0105240_10003803 3300009093 Bacteria 23321
201 Ga0105240_10017187 3300009093 Bacteria 9759
202 Ga0105240_10040492 3300009093 Bacteria 5958
203 Ga0105240_10041117 3300009093 Bacteria 5904
204 Ga0105240_10042965 3300009093 Bacteria 5756
205 Ga0105240_10283973 3300009093 Bacteria 1900
206 Ga0105240_10871880 3300009093 Bacteria 970
207 Ga0111539_10001276 3300009094 Bacteria 33625
208 Ga0111539_10199981 3300009094 Bacteria 2330
209 Ga0105245_10048267 3300009098 Bacteria 3808
210 Ga0105243_10001253 3300009148 Bacteria 22813
211 Ga0105243_10041903 3300009148 Bacteria 3581
212 Ga0105243_10524554 3300009148 Bacteria 1127
213 Ga0105241_10004483 3300009174 Bacteria 10326
214 Ga0105241_10076694 3300009174 Bacteria 2607
215 Ga0105241_10179120 3300009174 Bacteria 1757
216 Ga0105241_10183750 3300009174 Bacteria 1736
217 Ga0105241_10660631 3300009174 Bacteria 950
218 Ga0105242_10068139 3300009176 Bacteria 2943
219 Ga0105242_10262975 3300009176 Bacteria 1559
220 Ga0105248_10002682 3300009177 Bacteria 19764
221 Ga0105248_10019531 3300009177 Bacteria 7499
222 Ga0105248_10117493 3300009177 Bacteria 2999
223 Ga0105248_10127427 3300009177 Bacteria 2872
224 Ga0105248_10227671 3300009177 Bacteria 2099
225 Ga0105237_10018193 3300009545 Bacteria 7274
226 Ga0105237_10031901 3300009545 Bacteria 5336
227 Ga0105237_10063445 3300009545 Bacteria 3692
228 Ga0105237_10099226 3300009545 Bacteria 2904
229 Ga0105237_10243842 3300009545 Bacteria 1798
230 Ga0105238_10000556 3300009551 Bacteria 39015
231 Ga0105238_10030341 3300009551 Bacteria 5502
232 Ga0105249_10002210 3300009553 Bacteria 16852
233 Ga0105249_10005537 3300009553 Bacteria 10915
234 Ga0105249_10465571 3300009553 Bacteria 1305
235 Ga0105239_10108986 3300010375 Bacteria 3068
236 Ga0105239_10232475 3300010375 Bacteria 2068
237 Ga0105246_10420645 3300011119 Bacteria 1115
238 Ga0157373_10027505 3300013100 Bacteria 4103
239 Ga0157371_10016256 3300013102 Bacteria 5558
240 Ga0157370_10005227 3300013104 Bacteria 14617
241 Ga0157370_10027293 3300013104 Bacteria 5630
242 Ga0157370_10028808 3300013104 Bacteria 5460
243 Ga0157370_10031204 3300013104 Bacteria 5215
244 Ga0157370_10031737 3300013104 Bacteria 5164
245 Ga0157370_10033264 3300013104 Bacteria 5026
246 Ga0157370_10085029 3300013104 Bacteria 2972
247 Ga0157370_10086015 3300013104 Bacteria 2954
248 Ga0157370_10175113 3300013104 Bacteria 1994
249 Ga0157369_10005626 3300013105 Bacteria 14557
250 Ga0157369_10010863 3300013105 Bacteria 10373
251 Ga0157369_10037843 3300013105 Bacteria 5279
252 Ga0157369_10085647 3300013105 Bacteria 3367
253 Ga0157369_10112271 3300013105 Bacteria 2895
254 Ga0157369_10135028 3300013105 Bacteria 2612
255 Ga0157369_10292507 3300013105 Bacteria 1695
256 Ga0157369_10444608 3300013105 Bacteria 1343
257 Ga0157369_10530528 3300013105 Bacteria 1217
258 Ga0157369_10577851 3300013105 Bacteria 1161
259 Ga0157374_10026935 3300013296 Bacteria 5178
260 Ga0157374_10273335 3300013296 Bacteria 1666
261 Ga0157374_10412282 3300013296 Bacteria 1349
262 Ga0157378_10022806 3300013297 Bacteria 5510
263 Ga0157378_10240649 3300013297 Bacteria 1728
264 Ga0157378_10684520 3300013297 Unclassified 1044
265 Ga0163162_10000769 3300013306 Bacteria 29806
266 Ga0163162_10028208 3300013306 Bacteria 5553
267 Ga0157372_10007555 3300013307 Bacteria 11556
268 Ga0157372_10009605 3300013307 Bacteria 10280
269 Ga0157372_10025738 3300013307 Bacteria 6401
270 Ga0157372_10029083 3300013307 Bacteria 6030
271 Ga0157372_10071757 3300013307 Bacteria 3901
272 Ga0157372_10088012 3300013307 Bacteria 3526
273 Ga0157372_10141941 3300013307 Bacteria 2768
274 Ga0157372_10239537 3300013307 Bacteria 2105
275 Ga0157372_10263886 3300013307 Bacteria 2000
276 Ga0157372_10448981 3300013307 Unclassified 1503
277 Ga0157375_10002140 3300013308 Bacteria 17068
278 Ga0157375_10118250 3300013308 Bacteria 2757
279 Ga0163163_10001258 3300014325 Bacteria 21365
280 Ga0163163_10023461 3300014325 Bacteria 5855
281 Ga0157380_10001782 3300014326 Bacteria 14223
282 Ga0157380_10500518 3300014326 Bacteria 1180
283 Ga0182008_10043691 3300014497 Bacteria 2231
284 Ga0157377_10039678 3300014745 Bacteria 2606
285 Ga0157379_10000912 3300014968 Bacteria 23848
286 Ga0157379_10035612 3300014968 Bacteria 4438
287 Ga0157379_10392174 3300014968 Bacteria 1275
288 Ga0157376_10043549 3300014969 Bacteria 3684
289 Ga0157376_10055566 3300014969 Bacteria 3304
290 Ga0163161_10030670 3300017792 Bacteria 3828
291 Ga0163161_10034526 3300017792 Bacteria 3619
292 Ga0213876_10175633 3300021384 Bacteria 1140
293 Ga0207666_1001742 3300025271 Bacteria 2584
294 Ga0207697_10000185 3300025315 Bacteria 32415
295 Ga0207656_10007220 3300025321 Bacteria 4037
296 Ga0207656_10015480 3300025321 Bacteria 2952
297 Ga0207656_10028002 3300025321 Bacteria 2310
298 Ga0207656_10034560 3300025321 Bacteria 2111
299 Ga0207656_10056867 3300025321 Bacteria 1706
300 Ga0207682_10000787 3300025893 Bacteria 14682
301 Ga0207682_10021010 3300025893 Bacteria 2567
302 Ga0207692_10185907 3300025898 Bacteria 1213
303 Ga0207642_10030956 3300025899 Bacteria 2236
304 Ga0207688_10001442 3300025901 Bacteria 12433
305 Ga0207680_10004719 3300025903 Bacteria 6480
306 Ga0207680_10397762 3300025903 Unclassified 973
307 Ga0207699_10023228 3300025906 Bacteria 3372
308 Ga0207699_10113782 3300025906 Bacteria 1739
309 Ga0207699_10151526 3300025906 Bacteria 1535
310 Ga0207645_10007874 3300025907 Bacteria 7492
311 Ga0207645_10020464 3300025907 Bacteria 4332
312 Ga0207645_10087052 3300025907 Bacteria 2007
313 Ga0207643_10000211 3300025908 Bacteria 40799
314 Ga0207705_10016478 3300025909 Bacteria 5296
315 Ga0207705_10154701 3300025909 Bacteria 1720
316 Ga0207705_10617415 3300025909 Unclassified 843
317 Ga0207654_10052637 3300025911 Bacteria 2347
318 Ga0207654_10087398 3300025911 Bacteria 1891
319 Ga0207654_10197051 3300025911 Bacteria 1324
320 Ga0207654_10282703 3300025911 Bacteria 1123
321 Ga0207707_10017403 3300025912 Bacteria 6267
322 Ga0207707_10020327 3300025912 Bacteria 5798
323 Ga0207707_10030709 3300025912 Bacteria 4700
324 Ga0207707_10043214 3300025912 Bacteria 3932
325 Ga0207707_10223300 3300025912 Bacteria 1640
326 Ga0207707_10386312 3300025912 Bacteria 1203
327 Ga0207695_10028312 3300025913 Bacteria 6218
328 Ga0207695_10031430 3300025913 Bacteria 5823
329 Ga0207695_10046100 3300025913 Bacteria 4622
330 Ga0207695_10104585 3300025913 Bacteria 2820
331 Ga0207695_10161145 3300025913 Bacteria 2175
332 Ga0207695_10201795 3300025913 Bacteria 1902
333 Ga0207671_10020001 3300025914 Bacteria 5106
334 Ga0207671_10064976 3300025914 Bacteria 2713
335 Ga0207693_10021286 3300025915 Bacteria 5153
336 Ga0207693_10176257 3300025915 Bacteria 1682
337 Ga0207663_10196793 3300025916 Bacteria 1451
338 Ga0207663_10309625 3300025916 Bacteria 1183
339 Ga0207663_10470118 3300025916 Bacteria 972
340 Ga0207660_10026255 3300025917 Bacteria 3965
341 Ga0207660_10100516 3300025917 Bacteria 2160
342 Ga0207660_10158513 3300025917 Bacteria 1744
343 Ga0207660_10242466 3300025917 Bacteria 1420
344 Ga0207662_10026767 3300025918 Bacteria 3328
345 Ga0207662_10038756 3300025918 Bacteria 2793
346 Ga0207657_10001312 3300025919 Bacteria 26386
347 Ga0207657_10006785 3300025919 Bacteria 11821
348 Ga0207657_10015693 3300025919 Bacteria 7326
349 Ga0207657_10032689 3300025919 Bacteria 4697
350 Ga0207657_10589893 3300025919 Bacteria 867
351 Ga0207649_10008004 3300025920 Bacteria 5752
352 Ga0207649_10013304 3300025920 Bacteria 4591
353 Ga0207649_10033690 3300025920 Bacteria 3063
354 Ga0207649_10187796 3300025920 Bacteria 1451
355 Ga0207652_10007956 3300025921 Bacteria 8509
356 Ga0207652_10017530 3300025921 Bacteria 5860
357 Ga0207652_10044200 3300025921 Bacteria 3794
358 Ga0207652_10125372 3300025921 Bacteria 2287
359 Ga0207652_10209182 3300025921 Bacteria 1756
360 Ga0207681_10000340 3300025923 Bacteria 33613
361 Ga0207681_10102335 3300025923 Bacteria 2068
362 Ga0207681_10316462 3300025923 Bacteria 1239
363 Ga0207694_10006006 3300025924 Bacteria 9294
364 Ga0207694_10046234 3300025924 Bacteria 3364
365 Ga0207650_10004356 3300025925 Bacteria 9669
366 Ga0207650_10008059 3300025925 Bacteria 7178
367 Ga0207650_10137932 3300025925 Bacteria 1915
368 Ga0207659_10003813 3300025926 Bacteria 9093
369 Ga0207659_10063131 3300025926 Bacteria 2676
370 Ga0207659_10142130 3300025926 Bacteria 1864
371 Ga0207687_10086226 3300025927 Bacteria 2280
372 Ga0207700_10005496 3300025928 Bacteria 7600
373 Ga0207700_10238904 3300025928 Bacteria 1548
374 Ga0207664_10002780 3300025929 Bacteria 11623
375 Ga0207664_10007824 3300025929 Bacteria 7424
376 Ga0207664_10012890 3300025929 Bacteria 5991
377 Ga0207664_10077004 3300025929 Bacteria 2701
378 Ga0207664_10166683 3300025929 Bacteria 1883
379 Ga0207644_10004185 3300025931 Bacteria 9364
380 Ga0207644_10007361 3300025931 Bacteria 7170
381 Ga0207644_10015964 3300025931 Bacteria 5049
382 Ga0207644_10025186 3300025931 Bacteria 4090
383 Ga0207644_10030770 3300025931 Bacteria 3736
384 Ga0207690_10020441 3300025932 Bacteria 4091
385 Ga0207690_10041319 3300025932 Bacteria 3021
386 Ga0207690_10164238 3300025932 Bacteria 1658
387 Ga0207690_10220527 3300025932 Bacteria 1451
388 Ga0207706_10030799 3300025933 Bacteria 4785
389 Ga0207706_10062511 3300025933 Bacteria 3279
390 Ga0207706_10602094 3300025933 Bacteria 944
391 Ga0207709_10004286 3300025935 Bacteria 8262
392 Ga0207709_10274186 3300025935 Bacteria 1243
393 Ga0207670_10020444 3300025936 Bacteria 4068
394 Ga0207669_10005143 3300025937 Bacteria 5835
395 Ga0207669_10158034 3300025937 Bacteria 1597
396 Ga0207704_10075160 3300025938 Bacteria 2159
397 Ga0207691_10011008 3300025940 Bacteria 8677
398 Ga0207691_10012946 3300025940 Bacteria 7989
399 Ga0207691_10028137 3300025940 Bacteria 5265
400 Ga0207711_10001235 3300025941 Bacteria 24221
401 Ga0207711_10069723 3300025941 Bacteria 3048
402 Ga0207689_10000526 3300025942 Bacteria 36327
403 Ga0207689_10002816 3300025942 Bacteria 16063
404 Ga0207689_10011620 3300025942 Bacteria 7546
405 Ga0207661_10005279 3300025944 Bacteria 9095
406 Ga0207661_10009480 3300025944 Bacteria 6984
407 Ga0207661_10053392 3300025944 Bacteria 3234
408 Ga0207679_10009794 3300025945 Bacteria 6149
409 Ga0207679_10022097 3300025945 Bacteria 4326
410 Ga0207679_10401177 3300025945 Bacteria 1206
411 Ga0207667_10002202 3300025949 Bacteria 24453
412 Ga0207667_10006654 3300025949 Bacteria 13970
413 Ga0207667_10056479 3300025949 Bacteria 4124
414 Ga0207667_10063468 3300025949 Bacteria 3859
415 Ga0207667_10228472 3300025949 Bacteria 1906
416 Ga0207667_10250754 3300025949 Bacteria 1811
417 Ga0207667_10253175 3300025949 Bacteria 1801
418 Ga0207667_10288707 3300025949 Bacteria 1676
419 Ga0207667_10742122 3300025949 Bacteria 982
420 Ga0207651_10007446 3300025960 Bacteria 5834
421 Ga0207651_10021692 3300025960 Bacteria 3909
422 Ga0207651_10047256 3300025960 Bacteria 2901
423 Ga0207651_10136995 3300025960 Bacteria 1884
424 Ga0207712_10006317 3300025961 Bacteria 7475
425 Ga0207712_10458396 3300025961 Bacteria 1083
426 Ga0207668_10000501 3300025972 Bacteria 24522
427 Ga0207668_10053336 3300025972 Bacteria 2801
428 Ga0207640_10006052 3300025981 Bacteria 6613
429 Ga0207658_10000756 3300025986 Bacteria 27753
430 Ga0207658_10013655 3300025986 Bacteria 5556
431 Ga0207658_10124454 3300025986 Bacteria 2061
432 Ga0207677_10001035 3300026023 Bacteria 15315
433 Ga0207677_10205473 3300026023 Bacteria 1569
434 Ga0207703_10001021 3300026035 Bacteria 26840
435 Ga0207703_10001349 3300026035 Bacteria 22464
436 Ga0207639_10059931 3300026041 Bacteria 2935
437 Ga0207639_10102231 3300026041 Bacteria 2319
438 Ga0207639_10111873 3300026041 Bacteria 2227
439 Ga0207639_10206611 3300026041 Bacteria 1688
440 Ga0207678_10003412 3300026067 Bacteria 14301
441 Ga0207678_10019898 3300026067 Bacteria 5900
442 Ga0207708_10000359 3300026075 Bacteria 35755
443 Ga0207708_10033661 3300026075 Bacteria 3895
444 Ga0207708_10053745 3300026075 Bacteria 3070
445 Ga0207702_10008679 3300026078 Bacteria 8571
446 Ga0207702_10026263 3300026078 Bacteria 4833
447 Ga0207702_10121859 3300026078 Bacteria 2335
448 Ga0207702_10299492 3300026078 Bacteria 1526
449 Ga0207702_10807376 3300026078 Bacteria 927
450 Ga0207702_10887183 3300026078 Bacteria 883
451 Ga0207641_10010834 3300026088 Bacteria 7470
452 Ga0207641_10113097 3300026088 Bacteria 2410
453 Ga0207641_10144641 3300026088 Bacteria 2149
454 Ga0207641_10161823 3300026088 Bacteria 2035
455 Ga0207641_10520372 3300026088 Unclassified 1157
456 Ga0207648_10013683 3300026089 Bacteria 7533
457 Ga0207676_10002578 3300026095 Bacteria 12932
458 Ga0207676_10221713 3300026095 Bacteria 1684
459 Ga0207676_10491481 3300026095 Bacteria 1164
460 Ga0207674_10000180 3300026116 Bacteria 77710
461 Ga0207674_10002872 3300026116 Bacteria 21404
462 Ga0207674_10005327 3300026116 Bacteria 15304
463 Ga0207674_10040498 3300026116 Bacteria 4825
464 Ga0207675_100003104 3300026118 Bacteria 16287
465 Ga0207675_100038976 3300026118 Bacteria 4435
466 Ga0207675_100167504 3300026118 Bacteria 2099
467 Ga0207675_100895434 3300026118 Bacteria 903
468 Ga0207683_10022430 3300026121 Bacteria 5420
469 Ga0207683_10040228 3300026121 Bacteria 4078
470 Ga0207683_10053111 3300026121 Bacteria 3552
471 Ga0207683_10458281 3300026121 Bacteria 1176
472 Ga0207698_10002150 3300026142 Bacteria 11645
473 Ga0207698_10007269 3300026142 Bacteria 6939
474 Ga0207698_10008799 3300026142 Bacteria 6401
475 Ga0207698_10030271 3300026142 Bacteria 3890
476 Ga0207698_10145941 3300026142 Bacteria 2046
477 Ga0207698_10259329 3300026142 Bacteria 1596
478 Ga0207698_10764227 3300026142 Bacteria 966
479 Ga0207698_10868429 3300026142 Bacteria 908
480 Ga0209389_1000032 3300027296 Bacteria 134064
481 Ga0209489_100035 3300027361 Bacteria 168255
482 Ga0209700_100005 3300027363 Bacteria 573969
483 Ga0209971_1012294 3300027682 Bacteria 2025
484 Ga0209974_10084252 3300027876 Unclassified 1097
485 Ga0207428_10002734 3300027907 Bacteria 17573
486 Ga0207428_10034667 3300027907 Bacteria 4132
487 Ga0207428_10281458 3300027907 Bacteria 1234
488 Ga0268266_10409149 3300028379 Bacteria 1284
489 Ga0268265_10470130 3300028380 Bacteria 1178
490 Ga0268264_10001195 3300028381 Bacteria 25076
491 Ga0268264_10042457 3300028381 Bacteria 3764
492 Ga0307410_10185430 3300031852 Bacteria 1578
493 Ga0307416_100547043 3300032002 Bacteria 1230
494 Ga0307414_10148801 3300032004 Bacteria 1844
495 Ga0307415_100147165 3300032126 Bacteria 1808
496 Ga0373943_0020748 3300035170 Bacteria 3032
497 Ga0373943_0036466 3300035170 Bacteria 2355
498 Ga0373947_0119587 3300035725 Bacteria 1672
499 Ga0373937_0015627 3300036401 Bacteria 6720
500 Ga0373925_0159104 3300037068 Bacteria 1778
501 Ga0373925_0199118 3300037068 Bacteria 1592
502 Ga0395900_0001627 3300037418 Bacteria 26397
503 Ga0395900_0071629 3300037418 Bacteria 3563
504 Ga0395900_0095943 3300037418 Bacteria 3047
505 Ga0395900_0420817 3300037418 Bacteria 1297
506 Ga0395900_0447663 3300037418 Bacteria 1248
507 Ga0395898_0059152 3300037466 Bacteria 3729
508 Ga0395898_0089028 3300037466 Bacteria 2971
509 Ga0395898_0103273 3300037466 Bacteria 2735
510 Ga0395898_0192495 3300037466 Bacteria 1949
511 Ga0395898_0529743 3300037466 Bacteria 1120
512 Ga0395905_0055901 3300037471 Bacteria 3694
513 Ga0395905_0345773 3300037471 Bacteria 1379
514 Ga0395901_0002678 3300038443 Bacteria 17967
515 Ga0395901_0094704 3300038443 Bacteria 3129
516 Ga0436365_0391850 3300039437 Bacteria 1241
517 Ga0451804_0116185 3300041463 Bacteria 1670
518 Ga0439432_085999 3300042006 Bacteria 949
519 Ga0439464_0058793 3300042439 Unclassified 1123
520 Ga0466967_0018209 3300045976 Bacteria 5604
521 Ga0495598_0005942 3300046537 Bacteria 2731
522 Ga0495598_0111339 3300046537 Bacteria 918
523 Ga0495621_0018730 3300046539 Bacteria 2252
524 Ga0495621_0037958 3300046539 Bacteria 1678
525 Ga0496101_0246056 3300048904 Bacteria 1392
526 Ga0496102_0096680 3300048905 Bacteria 2738
527 Ga0496105_0268943 3300048908 Bacteria 1377
528 Ga0496106_0182617 3300048909 Unclassified 1666
529 Ga0496107_0025037 3300048910 Bacteria 4224
530 Ga0496108_0005513 3300048911 Bacteria 10234
531 Ga0496108_0008496 3300048911 Bacteria 8332
532 Ga0496109_0011282 3300048912 Bacteria 7675
533 Ga0496110_0006589 3300048913 Bacteria 9223
534 Ga0496110_0668154 3300048913 Bacteria 939
535 Ga0496113_0216792 3300048916 Unclassified 1525
536 Ga0496114_0145461 3300048917 Bacteria 2054
537 Ga0496126_0008408 3300048929 Bacteria 11135
538 Ga0501033_0121744 3300049570 Bacteria 1893
539 Ga0501046_0000042 3300049580 Bacteria 151850
540 Ga0501046_0204970 3300049580 Bacteria 1466
541 Ga0501047_0000052 3300049581 Bacteria 153448
542 Ga0501047_0020822 3300049581 Bacteria 6300
543 Ga0501047_0050234 3300049581 Bacteria 4027
544 Ga0501047_0077049 3300049581 Bacteria 3208
545 Ga0501048_0002933 3300049582 Bacteria 13037
546 Ga0501048_0135598 3300049582 Bacteria 1740
547 Ga0501067_0025292 3300049583 Bacteria 3290
548 Ga0501069_0133649 3300049585 Bacteria 1421
549 Ga0501070_0027625 3300049586 Bacteria 4760
550 Ga0501070_0035062 3300049586 Bacteria 4193
551 Ga0501070_0346928 3300049586 Bacteria 1205
552 Ga0501070_0365745 3300049586 Bacteria 1169
553 Ga0501070_0368802 3300049586 Bacteria 1164
554 Ga0501072_0470691 3300049588 Unclassified 995
555 Ga0501073_0010399 3300049589 Bacteria 6827
556 Ga0501075_0386197 3300049591 Bacteria 1067
557 Ga0501080_0003379 3300049742 Bacteria 14071
558 Ga0501080_0024886 3300049742 Bacteria 5552
559 Ga0501080_0187933 3300049742 Bacteria 1899
560 Ga0501080_0399819 3300049742 Bacteria 1236
561 Ga0501083_0190917 3300049744 Bacteria 1337
562 Ga0501044_0225526 3300049823 Bacteria 1823
563 Ga0501044_0328610 3300049823 Bacteria 1452
564 Ga0501044_0450345 3300049823 Bacteria 1194
565 Ga0501045_0000910 3300049824 Bacteria 19284
566 nmdc:mga0k408_136225_c1 3300050493 Bacteria 1459
567 nmdc:mga08y16_109962_c1 3300050511 Bacteria 2870
568 nmdc:mga08y16_419108_c1 3300050511 Bacteria 1368
569 nmdc:mga08y16_656_c1 3300050511 Bacteria 32525
570 Ga0495619_0184619 3300053085 Bacteria 1443
571 Ga0501084_0049957 3300054114 Bacteria 3501
572 Ga0501084_0104628 3300054114 Bacteria 2377
573 Ga0501082_0497171 3300060353 Bacteria 1066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10660631 Ga0105241_106606312 232
2 iso_pu_bacteria 2617270735 2617347271 233
3 iso_pu_bacteria 2824600985 2824604098 233
4 iso_pu_bacteria 2824609381 2824610367 233
5 iso_pu_bacteria 2824653114 2824654113 233
6 iso_pu_bacteria 2838122688 2838122823 233
7 iso_pu_bacteria 2841941048 2841946869 233
8 iso_pu_bacteria 2841949485 2841950913 233
9 iso_pu_bacteria 2841983080 2841988891 233
10 iso_pu_bacteria 2842038055 2842038824 233
11 iso_pu_bacteria 2842045827 2842048231 233
12 iso_pu_bacteria 2849076700 2849077991 233
13 iso_pu_bacteria 2881364244 2881366111 233
14 iso_pu_bacteria 2885383462 2885385211 233
15 iso_pu_bacteria 2888419890 2888425028 233
16 iso_pu_bacteria 2906643746 2906645092 233
17 iso_pu_bacteria 2885383462 2885386977 234
18 3300003322 rootL2_10018900 rootL2_100189002 237
19 3300005328 Ga0070676_10024198 Ga0070676_100241982 237
20 3300005328 Ga0070676_10041240 Ga0070676_100412403 237
21 3300005328 Ga0070676_10047231 Ga0070676_100472312 237
22 3300005330 Ga0070690_100008676 Ga0070690_1000086763 237
23 3300005330 Ga0070690_100047600 Ga0070690_1000476003 237
24 3300005331 Ga0070670_100012247 Ga0070670_1000122474 237
25 3300005333 Ga0070677_10012365 Ga0070677_100123651 237
26 3300005333 Ga0070677_10019113 Ga0070677_100191132 237
27 3300005334 Ga0068869_100033904 Ga0068869_1000339042 237
28 3300005334 Ga0068869_100069287 Ga0068869_1000692872 237
29 3300005335 Ga0070666_10000894 Ga0070666_100008943 237
30 3300005335 Ga0070666_10003581 Ga0070666_100035817 237
31 3300005338 Ga0068868_100000223 Ga0068868_10000022333 237
32 3300005343 Ga0070687_100030974 Ga0070687_1000309742 237
33 3300005347 Ga0070668_100021140 Ga0070668_1000211402 237
34 3300005347 Ga0070668_100028124 Ga0070668_1000281245 237
35 3300005353 Ga0070669_100047171 Ga0070669_1000471714 237
36 3300005353 Ga0070669_100071843 Ga0070669_1000718433 237
37 3300005354 Ga0070675_100012762 Ga0070675_1000127623 237
38 3300005354 Ga0070675_100018072 Ga0070675_1000180723 237
39 3300005354 Ga0070675_100029812 Ga0070675_1000298122 237
40 3300005355 Ga0070671_100023768 Ga0070671_1000237686 237
41 3300005356 Ga0070674_100070892 Ga0070674_1000708923 237
42 3300005356 Ga0070674_100122423 Ga0070674_1001224232 237
43 3300005364 Ga0070673_100025339 Ga0070673_1000253395 237
44 3300005364 Ga0070673_100129871 Ga0070673_1001298712 237
45 3300005365 Ga0070688_100014515 Ga0070688_1000145152 237
46 3300005367 Ga0070667_100002505 Ga0070667_1000025056 237
47 3300005367 Ga0070667_100106518 Ga0070667_1001065181 237
48 3300005435 Ga0070714_100076063 Ga0070714_1000760632 237
49 3300005436 Ga0070713_100007608 Ga0070713_1000076085 237
50 3300005456 Ga0070678_100052020 Ga0070678_1000520202 237
51 3300005457 Ga0070662_100007116 Ga0070662_1000071162 237
52 3300005457 Ga0070662_100028130 Ga0070662_1000281304 237
53 3300005458 Ga0070681_10087414 Ga0070681_100874142 237
54 3300005459 Ga0068867_100011980 Ga0068867_1000119804 237
55 3300005459 Ga0068867_100041968 Ga0068867_1000419683 237
56 3300005466 Ga0070685_10169095 Ga0070685_101690952 237
57 3300005530 Ga0070679_100011789 Ga0070679_1000117895 237
58 3300005535 Ga0070684_100039922 Ga0070684_1000399223 237
59 3300005543 Ga0070672_100001303 Ga0070672_1000013039 237
60 3300005543 Ga0070672_100003805 Ga0070672_1000038059 237
61 3300005543 Ga0070672_100109624 Ga0070672_1001096242 237
62 3300005544 Ga0070686_100336654 Ga0070686_1003366542 237
63 3300005544 Ga0070686_100642320 Ga0070686_1006423201 237
64 3300005614 Ga0068856_100201165 Ga0068856_1002011653 237
65 3300005616 Ga0068852_100026908 Ga0068852_1000269084 237
66 3300005616 Ga0068852_100051055 Ga0068852_1000510553 237
67 3300005616 Ga0068852_100139797 Ga0068852_1001397971 237
68 3300005616 Ga0068852_100217060 Ga0068852_1002170602 237
69 3300005617 Ga0068859_100008374 Ga0068859_1000083745 237
70 3300005617 Ga0068859_100012418 Ga0068859_1000124188 237
71 3300005618 Ga0068864_100000242 Ga0068864_10000024241 237
72 3300005618 Ga0068864_100016236 Ga0068864_1000162366 237
73 3300005718 Ga0068866_10003255 Ga0068866_100032552 237
74 3300005719 Ga0068861_100181955 Ga0068861_1001819552 237
75 3300005841 Ga0068863_100127611 Ga0068863_1001276112 237
76 3300005841 Ga0068863_100252757 Ga0068863_1002527572 237
77 3300005842 Ga0068858_100001107 Ga0068858_1000011073 237
78 3300005842 Ga0068858_100004127 Ga0068858_1000041271 237
79 3300005843 Ga0068860_100064079 Ga0068860_1000640792 237
80 3300005844 Ga0068862_100017241 Ga0068862_1000172415 237
81 3300006237 Ga0097621_100158475 Ga0097621_1001584752 237
82 3300006353 Ga0075370_10030323 Ga0075370_100303232 237
83 3300006358 Ga0068871_100122991 Ga0068871_1001229913 237
84 3300006931 Ga0097620_100008374 Ga0097620_1000083747 237
85 3300006931 Ga0097620_100012420 Ga0097620_1000124202 237
86 3300006942 Ga0099824_1021223 Ga0099824_10212233 237
87 3300006944 Ga0099823_1000008 Ga0099823_100000825 237
88 3300009093 Ga0105240_10042965 Ga0105240_100429655 237
89 3300009098 Ga0105245_10048267 Ga0105245_100482673 237
90 3300009148 Ga0105243_10001253 Ga0105243_100012537 237
91 3300009148 Ga0105243_10524554 Ga0105243_105245542 237
92 3300009176 Ga0105242_10068139 Ga0105242_100681393 237
93 3300009176 Ga0105242_10262975 Ga0105242_102629752 237
94 3300009177 Ga0105248_10019531 Ga0105248_100195317 237
95 3300009177 Ga0105248_10117493 Ga0105248_101174933 237
96 3300009545 Ga0105237_10243842 Ga0105237_102438422 237
97 3300009553 Ga0105249_10002210 Ga0105249_100022103 237
98 3300009553 Ga0105249_10465571 Ga0105249_104655712 237
99 3300013104 Ga0157370_10085029 Ga0157370_100850292 237
100 3300013105 Ga0157369_10005626 Ga0157369_100056262 237
101 3300013105 Ga0157369_10085647 Ga0157369_100856472 237
102 3300013105 Ga0157369_10135028 Ga0157369_101350282 237
103 3300013296 Ga0157374_10412282 Ga0157374_104122822 237
104 3300013306 Ga0163162_10000769 Ga0163162_1000076931 237
105 3300013306 Ga0163162_10028208 Ga0163162_100282083 237
106 3300013307 Ga0157372_10009605 Ga0157372_100096057 237
107 3300013308 Ga0157375_10002140 Ga0157375_1000214017 237
108 3300013308 Ga0157375_10118250 Ga0157375_101182502 237
109 3300014325 Ga0163163_10001258 Ga0163163_1000125815 237
110 3300014968 Ga0157379_10000912 Ga0157379_1000091223 237
111 3300014968 Ga0157379_10035612 Ga0157379_100356124 237
112 3300014969 Ga0157376_10043549 Ga0157376_100435492 237
113 3300014969 Ga0157376_10055566 Ga0157376_100555662 237
114 3300017792 Ga0163161_10034526 Ga0163161_100345264 237
115 3300021384 Ga0213876_10175633 Ga0213876_101756331 237
116 3300025321 Ga0207656_10056867 Ga0207656_100568671 237
117 3300025893 Ga0207682_10021010 Ga0207682_100210102 237
118 3300025903 Ga0207680_10004719 Ga0207680_100047193 237
119 3300025907 Ga0207645_10020464 Ga0207645_100204642 237
120 3300025907 Ga0207645_10087052 Ga0207645_100870522 237
121 3300025912 Ga0207707_10386312 Ga0207707_103863121 237
122 3300025913 Ga0207695_10161145 Ga0207695_101611452 237
123 3300025917 Ga0207660_10100516 Ga0207660_101005162 237
124 3300025918 Ga0207662_10038756 Ga0207662_100387563 237
125 3300025921 Ga0207652_10125372 Ga0207652_101253723 237
126 3300025923 Ga0207681_10000340 Ga0207681_1000034029 237
127 3300025923 Ga0207681_10316462 Ga0207681_103164622 237
128 3300025925 Ga0207650_10008059 Ga0207650_100080595 237
129 3300025926 Ga0207659_10003813 Ga0207659_100038136 237
130 3300025926 Ga0207659_10063131 Ga0207659_100631312 237
131 3300025927 Ga0207687_10086226 Ga0207687_100862262 237
132 3300025928 Ga0207700_10005496 Ga0207700_100054965 237
133 3300025929 Ga0207664_10007824 Ga0207664_100078242 237
134 3300025929 Ga0207664_10166683 Ga0207664_101666832 237
135 3300025931 Ga0207644_10004185 Ga0207644_100041854 237
136 3300025931 Ga0207644_10015964 Ga0207644_100159644 237
137 3300025931 Ga0207644_10030770 Ga0207644_100307706 237
138 3300025933 Ga0207706_10030799 Ga0207706_100307993 237
139 3300025935 Ga0207709_10004286 Ga0207709_100042864 237
140 3300025937 Ga0207669_10005143 Ga0207669_100051433 237
141 3300025937 Ga0207669_10158034 Ga0207669_101580342 237
142 3300025940 Ga0207691_10011008 Ga0207691_100110089 237
143 3300025940 Ga0207691_10012946 Ga0207691_100129467 237
144 3300025940 Ga0207691_10028137 Ga0207691_100281375 237
145 3300025941 Ga0207711_10001235 Ga0207711_1000123513 237
146 3300025941 Ga0207711_10069723 Ga0207711_100697233 237
147 3300025942 Ga0207689_10002816 Ga0207689_100028163 237
148 3300025942 Ga0207689_10011620 Ga0207689_100116205 237
149 3300025944 Ga0207661_10053392 Ga0207661_100533922 237
150 3300025949 Ga0207667_10742122 Ga0207667_107421222 237
151 3300025960 Ga0207651_10007446 Ga0207651_100074462 237
152 3300025960 Ga0207651_10021692 Ga0207651_100216922 237
153 3300025961 Ga0207712_10006317 Ga0207712_100063179 237
154 3300025972 Ga0207668_10000501 Ga0207668_1000050119 237
155 3300025986 Ga0207658_10000756 Ga0207658_1000075625 237
156 3300025986 Ga0207658_10013655 Ga0207658_100136555 237
157 3300026023 Ga0207677_10001035 Ga0207677_100010356 237
158 3300026023 Ga0207677_10205473 Ga0207677_102054732 237
159 3300026035 Ga0207703_10001021 Ga0207703_1000102127 237
160 3300026035 Ga0207703_10001349 Ga0207703_1000134925 237
161 3300026075 Ga0207708_10033661 Ga0207708_100336614 237
162 3300026075 Ga0207708_10053745 Ga0207708_100537454 237
163 3300026078 Ga0207702_10008679 Ga0207702_100086797 237
164 3300026078 Ga0207702_10299492 Ga0207702_102994922 237
165 3300026078 Ga0207702_10887183 Ga0207702_108871831 237
166 3300026088 Ga0207641_10010834 Ga0207641_100108347 237
167 3300026088 Ga0207641_10113097 Ga0207641_101130972 237
168 3300026095 Ga0207676_10002578 Ga0207676_100025787 237
169 3300026118 Ga0207675_100038976 Ga0207675_1000389762 237
170 3300026118 Ga0207675_100895434 Ga0207675_1008954342 237
171 3300026121 Ga0207683_10040228 Ga0207683_100402282 237
172 3300026121 Ga0207683_10053111 Ga0207683_100531114 237
173 3300026142 Ga0207698_10030271 Ga0207698_100302712 237
174 3300026142 Ga0207698_10259329 Ga0207698_102593292 237
175 3300026142 Ga0207698_10764227 Ga0207698_107642271 237
176 3300027296 Ga0209389_1000032 Ga0209389_100003288 237
177 3300027361 Ga0209489_100035 Ga0209489_10003591 237
178 3300027363 Ga0209700_100005 Ga0209700_10000594 237
179 3300027907 Ga0207428_10281458 Ga0207428_102814582 237
180 3300028379 Ga0268266_10409149 Ga0268266_104091492 237
181 3300028380 Ga0268265_10470130 Ga0268265_104701302 237
182 3300028381 Ga0268264_10001195 Ga0268264_1000119519 237
183 3300031852 Ga0307410_10185430 Ga0307410_101854303 237
184 3300032004 Ga0307414_10148801 Ga0307414_101488013 237
185 3300037418 Ga0395900_0001627 Ga0395900_0001627_25479_26201 237
186 3300037418 Ga0395900_0095943 Ga0395900_0095943_1498_2232 237
187 3300037418 Ga0395900_0420817 Ga0395900_0420817_562_1284 237
188 3300037466 Ga0395898_0059152 Ga0395898_0059152_2186_2920 237
189 3300037466 Ga0395898_0089028 Ga0395898_0089028_273_995 237
190 3300037466 Ga0395898_0103273 Ga0395898_0103273_1029_1751 237
191 3300037466 Ga0395898_0529743 Ga0395898_0529743_72_794 237
192 3300037471 Ga0395905_0345773 Ga0395905_0345773_385_1107 237
193 3300038443 Ga0395901_0002678 Ga0395901_0002678_16952_17674 237
194 3300039437 Ga0436365_0391850 Ga0436365_0391850_447_1169 237
195 3300045976 Ga0466967_0018209 Ga0466967_0018209_1909_2631 237
196 3300046537 Ga0495598_0005942 Ga0495598_0005942_1884_2603 237
197 3300046539 Ga0495621_0018730 Ga0495621_0018730_517_1236 237
198 3300048911 Ga0496108_0008496 Ga0496108_0008496_1675_2394 237
199 3300048929 Ga0496126_0008408 Ga0496126_0008408_5787_6509 237
200 3300049570 Ga0501033_0121744 Ga0501033_0121744_16_738 237
201 3300049580 Ga0501046_0204970 Ga0501046_0204970_512_1234 237
202 3300049581 Ga0501047_0020822 Ga0501047_0020822_158_880 237
203 3300049581 Ga0501047_0077049 Ga0501047_0077049_1560_2282 237
204 3300049586 Ga0501070_0027625 Ga0501070_0027625_3231_3953 237
205 3300049586 Ga0501070_0365745 Ga0501070_0365745_97_819 237
206 3300049586 Ga0501070_0368802 Ga0501070_0368802_246_968 237
207 3300049742 Ga0501080_0024886 Ga0501080_0024886_3861_4583 237
208 3300049823 Ga0501044_0225526 Ga0501044_0225526_294_1016 237
209 3300050511 nmdc:mga08y16_419108_c1 nmdc:mga08y16_419108_c1_306_1025 237
210 iso_pu_bacteria 2643221651 2644289114 237
211 3300049580 Ga0501046_0000042 Ga0501046_0000042_11257_11982 238
212 3300049581 Ga0501047_0000052 Ga0501047_0000052_141467_142192 238
213 3300049582 Ga0501048_0002933 Ga0501048_0002933_7699_8424 238
214 3300049823 Ga0501044_0328610 Ga0501044_0328610_437_1162 238
215 3300049824 Ga0501045_0000910 Ga0501045_0000910_7455_8180 238
216 3300003323 rootH1_10082096 rootH1_100820966 239
217 3300005459 Ga0068867_100617999 Ga0068867_1006179991 239
218 3300005841 Ga0068863_100164026 Ga0068863_1001640262 239
219 3300006195 Ga0075366_10111454 Ga0075366_101114542 239
220 3300009093 Ga0105240_10283973 Ga0105240_102839732 239
221 3300014326 Ga0157380_10500518 Ga0157380_105005182 239
222 3300025913 Ga0207695_10201795 Ga0207695_102017952 239
223 3300026088 Ga0207641_10144641 Ga0207641_101446412 239
224 3300027682 Ga0209971_1012294 Ga0209971_10122942 239
225 3300027876 Ga0209974_10084252 Ga0209974_100842522 239
226 3300032002 Ga0307416_100547043 Ga0307416_1005470432 239
227 3300032126 Ga0307415_100147165 Ga0307415_1001471651 239
228 3300037418 Ga0395900_0071629 Ga0395900_0071629_2749_3471 239
229 3300037471 Ga0395905_0055901 Ga0395905_0055901_1058_1780 239
230 3300042006 Ga0439432_085999 Ga0439432_085999_119_853 239
231 3300049582 Ga0501048_0135598 Ga0501048_0135598_88_813 239
232 3300049591 Ga0501075_0386197 Ga0501075_0386197_247_972 239
233 3300050493 nmdc:mga0k408_136225_c1 nmdc:mga0k408_136225_c1_136_861 239
234 3300005327 Ga0070658_10043196 Ga0070658_100431964 240
235 3300005329 Ga0070683_100056639 Ga0070683_1000566392 240
236 3300005331 Ga0070670_100069322 Ga0070670_1000693222 240
237 3300005334 Ga0068869_100229642 Ga0068869_1002296422 240
238 3300005339 Ga0070660_100212943 Ga0070660_1002129432 240
239 3300005344 Ga0070661_100000823 Ga0070661_1000008238 240
240 3300005366 Ga0070659_100043565 Ga0070659_1000435653 240
241 3300005434 Ga0070709_10367701 Ga0070709_103677012 240
242 3300005435 Ga0070714_100003529 Ga0070714_1000035297 240
243 3300005436 Ga0070713_100098773 Ga0070713_1000987731 240
244 3300005437 Ga0070710_10169035 Ga0070710_101690352 240
245 3300005455 Ga0070663_100362497 Ga0070663_1003624972 240
246 3300005458 Ga0070681_10010938 Ga0070681_100109387 240
247 3300005471 Ga0070698_100478658 Ga0070698_1004786582 240
248 3300005530 Ga0070679_100003190 Ga0070679_1000031903 240
249 3300005535 Ga0070684_100003996 Ga0070684_1000039963 240
250 3300005539 Ga0068853_100105808 Ga0068853_1001058082 240
251 3300005547 Ga0070693_100059420 Ga0070693_1000594201 240
252 3300005547 Ga0070693_100183680 Ga0070693_1001836801 240
253 3300005563 Ga0068855_100002157 Ga0068855_10000215722 240
254 3300005564 Ga0070664_100001435 Ga0070664_10000143523 240
255 3300005577 Ga0068857_100000326 Ga0068857_1000003265 240
256 3300005578 Ga0068854_100017452 Ga0068854_1000174523 240
257 3300005614 Ga0068856_100004005 Ga0068856_10000400514 240
258 3300005616 Ga0068852_100000371 Ga0068852_10000037113 240
259 3300005617 Ga0068859_100433968 Ga0068859_1004339682 240
260 3300005834 Ga0068851_10007153 Ga0068851_100071534 240
261 3300005841 Ga0068863_100175737 Ga0068863_1001757372 240
262 3300006844 Ga0075428_100051121 Ga0075428_1000511215 240
263 3300006931 Ga0097620_100433953 Ga0097620_1004339532 240
264 3300009093 Ga0105240_10003803 Ga0105240_1000380318 240
265 3300009093 Ga0105240_10017187 Ga0105240_100171875 240
266 3300009094 Ga0111539_10001276 Ga0111539_1000127614 240
267 3300009174 Ga0105241_10183750 Ga0105241_101837502 240
268 3300009177 Ga0105248_10227671 Ga0105248_102276712 240
269 3300009545 Ga0105237_10063445 Ga0105237_100634454 240
270 3300009551 Ga0105238_10000556 Ga0105238_1000055629 240
271 3300013104 Ga0157370_10005227 Ga0157370_1000522714 240
272 3300013104 Ga0157370_10175113 Ga0157370_101751132 240
273 3300013105 Ga0157369_10010863 Ga0157369_100108635 240
274 3300013297 Ga0157378_10684520 Ga0157378_106845202 240
275 3300013307 Ga0157372_10007555 Ga0157372_100075558 240
276 3300014497 Ga0182008_10043691 Ga0182008_100436913 240
277 3300025321 Ga0207656_10007220 Ga0207656_100072202 240
278 3300025906 Ga0207699_10151526 Ga0207699_101515262 240
279 3300025909 Ga0207705_10154701 Ga0207705_101547011 240
280 3300025911 Ga0207654_10052637 Ga0207654_100526373 240
281 3300025912 Ga0207707_10030709 Ga0207707_100307094 240
282 3300025913 Ga0207695_10028312 Ga0207695_100283123 240
283 3300025913 Ga0207695_10031430 Ga0207695_100314303 240
284 3300025919 Ga0207657_10006785 Ga0207657_100067854 240
285 3300025920 Ga0207649_10008004 Ga0207649_100080043 240
286 3300025921 Ga0207652_10017530 Ga0207652_100175304 240
287 3300025924 Ga0207694_10006006 Ga0207694_100060064 240
288 3300025925 Ga0207650_10137932 Ga0207650_101379322 240
289 3300025929 Ga0207664_10002780 Ga0207664_100027804 240
290 3300025932 Ga0207690_10020441 Ga0207690_100204412 240
291 3300025944 Ga0207661_10005279 Ga0207661_100052792 240
292 3300025945 Ga0207679_10009794 Ga0207679_100097943 240
293 3300025949 Ga0207667_10002202 Ga0207667_1000220218 240
294 3300025981 Ga0207640_10006052 Ga0207640_100060522 240
295 3300026078 Ga0207702_10026263 Ga0207702_100262633 240
296 3300026088 Ga0207641_10520372 Ga0207641_105203722 240
297 3300026116 Ga0207674_10000180 Ga0207674_1000018036 240
298 3300026142 Ga0207698_10002150 Ga0207698_1000215014 240
299 3300027907 Ga0207428_10002734 Ga0207428_100027343 240
300 3300048916 Ga0496113_0216792 Ga0496113_0216792_696_1421 240
301 3300049588 Ga0501072_0470691 Ga0501072_0470691_17_742 240
302 3300049742 Ga0501080_0399819 Ga0501080_0399819_491_1216 240
303 3300049823 Ga0501044_0450345 Ga0501044_0450345_396_1121 240
304 3300050511 nmdc:mga08y16_656_c1 nmdc:mga08y16_656_c1_18692_19432 240
305 3300054114 Ga0501084_0049957 Ga0501084_0049957_1839_2564 240
306 3300049581 Ga0501047_0050234 Ga0501047_0050234_1810_2544 243
307 3300049583 Ga0501067_0025292 Ga0501067_0025292_2318_3052 243
308 3300049585 Ga0501069_0133649 Ga0501069_0133649_102_836 243
309 3300049586 Ga0501070_0035062 Ga0501070_0035062_1824_2558 243
310 3300049586 Ga0501070_0346928 Ga0501070_0346928_22_756 243
311 3300049589 Ga0501073_0010399 Ga0501073_0010399_4776_5510 243
312 3300049742 Ga0501080_0003379 Ga0501080_0003379_6826_7560 243
313 3300049742 Ga0501080_0187933 Ga0501080_0187933_851_1585 243
314 3300049744 Ga0501083_0190917 Ga0501083_0190917_220_954 243
315 3300054114 Ga0501084_0104628 Ga0501084_0104628_1092_1826 243
316 3300060353 Ga0501082_0497171 Ga0501082_0497171_283_1017 243
317 3300013307 Ga0157372_10141941 Ga0157372_101419411 244
318 3300025920 Ga0207649_10187796 Ga0207649_101877962 247
319 3300025932 Ga0207690_10220527 Ga0207690_102205272 247
320 3300042439 Ga0439464_0058793 Ga0439464_0058793_343_1086 247
321 3300001991 JGI24743J22301_10000223 JGI24743J22301_100002233 248
322 3300002077 JGI24744J21845_10001278 JGI24744J21845_100012785 248
323 3300002239 JGI24034J26672_10013159 JGI24034J26672_100131592 248
324 3300005293 Ga0065715_10130365 Ga0065715_101303652 248
325 3300005327 Ga0070658_10088965 Ga0070658_100889652 248
326 3300005328 Ga0070676_10063214 Ga0070676_100632142 248
327 3300005329 Ga0070683_100008289 Ga0070683_1000082893 248
328 3300005329 Ga0070683_100019073 Ga0070683_1000190734 248
329 3300005330 Ga0070690_100022460 Ga0070690_1000224602 248
330 3300005331 Ga0070670_100542698 Ga0070670_1005426981 248
331 3300005333 Ga0070677_10006194 Ga0070677_100061943 248
332 3300005334 Ga0068869_100161273 Ga0068869_1001612731 248
333 3300005334 Ga0068869_100172798 Ga0068869_1001727982 248
334 3300005335 Ga0070666_10015784 Ga0070666_100157844 248
335 3300005336 Ga0070680_100104300 Ga0070680_1001043002 248
336 3300005336 Ga0070680_100423753 Ga0070680_1004237532 248
337 3300005337 Ga0070682_100029473 Ga0070682_1000294734 248
338 3300005338 Ga0068868_100050818 Ga0068868_1000508183 248
339 3300005339 Ga0070660_100109902 Ga0070660_1001099022 248
340 3300005339 Ga0070660_100145337 Ga0070660_1001453372 248
341 3300005339 Ga0070660_100700685 Ga0070660_1007006851 248
342 3300005340 Ga0070689_100022697 Ga0070689_1000226973 248
343 3300005343 Ga0070687_100001547 Ga0070687_1000015474 248
344 3300005344 Ga0070661_100004472 Ga0070661_1000044723 248
345 3300005344 Ga0070661_100010830 Ga0070661_1000108304 248
346 3300005344 Ga0070661_100021650 Ga0070661_1000216501 248
347 3300005344 Ga0070661_100112666 Ga0070661_1001126662 248
348 3300005345 Ga0070692_10051595 Ga0070692_100515952 248
349 3300005347 Ga0070668_100411464 Ga0070668_1004114642 248
350 3300005353 Ga0070669_100211102 Ga0070669_1002111022 248
351 3300005355 Ga0070671_100019274 Ga0070671_1000192742 248
352 3300005355 Ga0070671_100052524 Ga0070671_1000525242 248
353 3300005364 Ga0070673_100018574 Ga0070673_1000185743 248
354 3300005364 Ga0070673_100078362 Ga0070673_1000783621 248
355 3300005364 Ga0070673_100304904 Ga0070673_1003049042 248
356 3300005365 Ga0070688_100000396 Ga0070688_1000003966 248
357 3300005366 Ga0070659_100008045 Ga0070659_1000080454 248
358 3300005366 Ga0070659_100048773 Ga0070659_1000487732 248
359 3300005366 Ga0070659_100227470 Ga0070659_1002274701 248
360 3300005367 Ga0070667_100273900 Ga0070667_1002739002 248
361 3300005434 Ga0070709_10008317 Ga0070709_100083173 248
362 3300005434 Ga0070709_10204262 Ga0070709_102042622 248
363 3300005435 Ga0070714_100325002 Ga0070714_1003250022 248
364 3300005437 Ga0070710_10030807 Ga0070710_100308072 248
365 3300005438 Ga0070701_10030537 Ga0070701_100305372 248
366 3300005439 Ga0070711_100070402 Ga0070711_1000704022 248
367 3300005455 Ga0070663_100256718 Ga0070663_1002567181 248
368 3300005456 Ga0070678_100503452 Ga0070678_1005034521 248
369 3300005457 Ga0070662_100183439 Ga0070662_1001834392 248
370 3300005458 Ga0070681_10001413 Ga0070681_1000141314 248
371 3300005458 Ga0070681_10001542 Ga0070681_1000154210 248
372 3300005458 Ga0070681_10210857 Ga0070681_102108572 248
373 3300005458 Ga0070681_10500756 Ga0070681_105007562 248
374 3300005466 Ga0070685_10023533 Ga0070685_100235333 248
375 3300005518 Ga0070699_100038780 Ga0070699_1000387802 248
376 3300005530 Ga0070679_100013566 Ga0070679_1000135664 248
377 3300005530 Ga0070679_100047260 Ga0070679_1000472602 248
378 3300005535 Ga0070684_100013539 Ga0070684_1000135393 248
379 3300005539 Ga0068853_100041254 Ga0068853_1000412543 248
380 3300005539 Ga0068853_100072190 Ga0068853_1000721904 248
381 3300005539 Ga0068853_100104470 Ga0068853_1001044702 248
382 3300005539 Ga0068853_100434682 Ga0068853_1004346821 248
383 3300005546 Ga0070696_100009732 Ga0070696_1000097322 248
384 3300005546 Ga0070696_100421475 Ga0070696_1004214751 248
385 3300005549 Ga0070704_100185149 Ga0070704_1001851492 248
386 3300005563 Ga0068855_100020406 Ga0068855_1000204063 248
387 3300005563 Ga0068855_100131286 Ga0068855_1001312862 248
388 3300005563 Ga0068855_100145360 Ga0068855_1001453603 248
389 3300005563 Ga0068855_100203386 Ga0068855_1002033863 248
390 3300005563 Ga0068855_100218633 Ga0068855_1002186332 248
391 3300005563 Ga0068855_100250135 Ga0068855_1002501352 248
392 3300005564 Ga0070664_100008416 Ga0070664_1000084166 248
393 3300005564 Ga0070664_100057847 Ga0070664_1000578474 248
394 3300005564 Ga0070664_100060705 Ga0070664_1000607052 248
395 3300005564 Ga0070664_100251891 Ga0070664_1002518912 248
396 3300005564 Ga0070664_100393207 Ga0070664_1003932072 248
397 3300005577 Ga0068857_100016778 Ga0068857_1000167784 248
398 3300005578 Ga0068854_100020170 Ga0068854_1000201703 248
399 3300005578 Ga0068854_100022553 Ga0068854_1000225532 248
400 3300005614 Ga0068856_100027648 Ga0068856_1000276482 248
401 3300005614 Ga0068856_100347252 Ga0068856_1003472522 248
402 3300005615 Ga0070702_100025669 Ga0070702_1000256692 248
403 3300005616 Ga0068852_100041201 Ga0068852_1000412012 248
404 3300005616 Ga0068852_100138014 Ga0068852_1001380142 248
405 3300005616 Ga0068852_100153793 Ga0068852_1001537932 248
406 3300005616 Ga0068852_100720021 Ga0068852_1007200211 248
407 3300005617 Ga0068859_100170950 Ga0068859_1001709502 248
408 3300005719 Ga0068861_100034095 Ga0068861_1000340953 248
409 3300005840 Ga0068870_10018393 Ga0068870_100183932 248
410 3300005841 Ga0068863_100087721 Ga0068863_1000877212 248
411 3300005842 Ga0068858_100036868 Ga0068858_1000368683 248
412 3300005843 Ga0068860_100092518 Ga0068860_1000925182 248
413 3300006881 Ga0068865_100045553 Ga0068865_1000455533 248
414 3300006914 Ga0075436_100164867 Ga0075436_1001648672 248
415 3300006931 Ga0097620_100170938 Ga0097620_1001709381 248
416 3300009093 Ga0105240_10040492 Ga0105240_100404924 248
417 3300009093 Ga0105240_10041117 Ga0105240_100411173 248
418 3300009093 Ga0105240_10871880 Ga0105240_108718801 248
419 3300009094 Ga0111539_10199981 Ga0111539_101999812 248
420 3300009148 Ga0105243_10041903 Ga0105243_100419034 248
421 3300009174 Ga0105241_10004483 Ga0105241_100044837 248
422 3300009174 Ga0105241_10076694 Ga0105241_100766942 248
423 3300009174 Ga0105241_10179120 Ga0105241_101791202 248
424 3300009177 Ga0105248_10002682 Ga0105248_100026823 248
425 3300009177 Ga0105248_10127427 Ga0105248_101274272 248
426 3300009545 Ga0105237_10018193 Ga0105237_100181935 248
427 3300009545 Ga0105237_10031901 Ga0105237_100319013 248
428 3300009545 Ga0105237_10099226 Ga0105237_100992264 248
429 3300009551 Ga0105238_10030341 Ga0105238_100303413 248
430 3300009553 Ga0105249_10005537 Ga0105249_100055374 248
431 3300010375 Ga0105239_10108986 Ga0105239_101089864 248
432 3300010375 Ga0105239_10232475 Ga0105239_102324752 248
433 3300011119 Ga0105246_10420645 Ga0105246_104206452 248
434 3300013100 Ga0157373_10027505 Ga0157373_100275053 248
435 3300013102 Ga0157371_10016256 Ga0157371_100162564 248
436 3300013104 Ga0157370_10027293 Ga0157370_100272933 248
437 3300013104 Ga0157370_10028808 Ga0157370_100288082 248
438 3300013104 Ga0157370_10031204 Ga0157370_100312045 248
439 3300013104 Ga0157370_10031737 Ga0157370_100317373 248
440 3300013104 Ga0157370_10033264 Ga0157370_100332642 248
441 3300013104 Ga0157370_10086015 Ga0157370_100860153 248
442 3300013105 Ga0157369_10037843 Ga0157369_100378432 248
443 3300013105 Ga0157369_10112271 Ga0157369_101122712 248
444 3300013105 Ga0157369_10292507 Ga0157369_102925072 248
445 3300013105 Ga0157369_10444608 Ga0157369_104446081 248
446 3300013105 Ga0157369_10530528 Ga0157369_105305282 248
447 3300013105 Ga0157369_10577851 Ga0157369_105778512 248
448 3300013296 Ga0157374_10026935 Ga0157374_100269353 248
449 3300013296 Ga0157374_10273335 Ga0157374_102733352 248
450 3300013297 Ga0157378_10022806 Ga0157378_100228063 248
451 3300013297 Ga0157378_10240649 Ga0157378_102406492 248
452 3300013307 Ga0157372_10025738 Ga0157372_100257384 248
453 3300013307 Ga0157372_10029083 Ga0157372_100290834 248
454 3300013307 Ga0157372_10071757 Ga0157372_100717571 248
455 3300013307 Ga0157372_10088012 Ga0157372_100880123 248
456 3300013307 Ga0157372_10239537 Ga0157372_102395372 248
457 3300013307 Ga0157372_10263886 Ga0157372_102638862 248
458 3300013307 Ga0157372_10448981 Ga0157372_104489812 248
459 3300014325 Ga0163163_10023461 Ga0163163_100234613 248
460 3300014326 Ga0157380_10001782 Ga0157380_1000178215 248
461 3300014745 Ga0157377_10039678 Ga0157377_100396782 248
462 3300014968 Ga0157379_10392174 Ga0157379_103921742 248
463 3300017792 Ga0163161_10030670 Ga0163161_100306702 248
464 3300025271 Ga0207666_1001742 Ga0207666_10017422 248
465 3300025315 Ga0207697_10000185 Ga0207697_1000018511 248
466 3300025321 Ga0207656_10015480 Ga0207656_100154801 248
467 3300025321 Ga0207656_10028002 Ga0207656_100280022 248
468 3300025321 Ga0207656_10034560 Ga0207656_100345602 248
469 3300025893 Ga0207682_10000787 Ga0207682_100007877 248
470 3300025898 Ga0207692_10185907 Ga0207692_101859072 248
471 3300025899 Ga0207642_10030956 Ga0207642_100309562 248
472 3300025901 Ga0207688_10001442 Ga0207688_100014427 248
473 3300025903 Ga0207680_10397762 Ga0207680_103977622 248
474 3300025906 Ga0207699_10023228 Ga0207699_100232282 248
475 3300025906 Ga0207699_10113782 Ga0207699_101137822 248
476 3300025907 Ga0207645_10007874 Ga0207645_100078744 248
477 3300025908 Ga0207643_10000211 Ga0207643_1000021115 248
478 3300025909 Ga0207705_10016478 Ga0207705_100164783 248
479 3300025909 Ga0207705_10617415 Ga0207705_106174151 248
480 3300025911 Ga0207654_10087398 Ga0207654_100873982 248
481 3300025911 Ga0207654_10197051 Ga0207654_101970512 248
482 3300025911 Ga0207654_10282703 Ga0207654_102827032 248
483 3300025912 Ga0207707_10017403 Ga0207707_100174033 248
484 3300025912 Ga0207707_10020327 Ga0207707_100203272 248
485 3300025912 Ga0207707_10043214 Ga0207707_100432142 248
486 3300025912 Ga0207707_10223300 Ga0207707_102233001 248
487 3300025913 Ga0207695_10046100 Ga0207695_100461002 248
488 3300025913 Ga0207695_10104585 Ga0207695_101045853 248
489 3300025914 Ga0207671_10020001 Ga0207671_100200012 248
490 3300025914 Ga0207671_10064976 Ga0207671_100649763 248
491 3300025915 Ga0207693_10021286 Ga0207693_100212862 248
492 3300025915 Ga0207693_10176257 Ga0207693_101762572 248
493 3300025916 Ga0207663_10196793 Ga0207663_101967932 248
494 3300025916 Ga0207663_10309625 Ga0207663_103096252 248
495 3300025916 Ga0207663_10470118 Ga0207663_104701182 248
496 3300025917 Ga0207660_10026255 Ga0207660_100262552 248
497 3300025917 Ga0207660_10158513 Ga0207660_101585132 248
498 3300025917 Ga0207660_10242466 Ga0207660_102424662 248
499 3300025918 Ga0207662_10026767 Ga0207662_100267672 248
500 3300025919 Ga0207657_10001312 Ga0207657_100013124 248
501 3300025919 Ga0207657_10015693 Ga0207657_100156935 248
502 3300025919 Ga0207657_10032689 Ga0207657_100326892 248
503 3300025919 Ga0207657_10589893 Ga0207657_105898931 248
504 3300025920 Ga0207649_10013304 Ga0207649_100133043 248
505 3300025920 Ga0207649_10033690 Ga0207649_100336902 248
506 3300025921 Ga0207652_10007956 Ga0207652_100079564 248
507 3300025921 Ga0207652_10044200 Ga0207652_100442002 248
508 3300025921 Ga0207652_10209182 Ga0207652_102091822 248
509 3300025923 Ga0207681_10102335 Ga0207681_101023352 248
510 3300025924 Ga0207694_10046234 Ga0207694_100462342 248
511 3300025925 Ga0207650_10004356 Ga0207650_100043564 248
512 3300025926 Ga0207659_10142130 Ga0207659_101421302 248
513 3300025928 Ga0207700_10238904 Ga0207700_102389041 248
514 3300025929 Ga0207664_10012890 Ga0207664_100128905 248
515 3300025929 Ga0207664_10077004 Ga0207664_100770042 248
516 3300025931 Ga0207644_10007361 Ga0207644_100073614 248
517 3300025931 Ga0207644_10025186 Ga0207644_100251862 248
518 3300025932 Ga0207690_10041319 Ga0207690_100413193 248
519 3300025932 Ga0207690_10164238 Ga0207690_101642382 248
520 3300025933 Ga0207706_10062511 Ga0207706_100625112 248
521 3300025933 Ga0207706_10602094 Ga0207706_106020941 248
522 3300025935 Ga0207709_10274186 Ga0207709_102741862 248
523 3300025936 Ga0207670_10020444 Ga0207670_100204443 248
524 3300025938 Ga0207704_10075160 Ga0207704_100751602 248
525 3300025942 Ga0207689_10000526 Ga0207689_1000052612 248
526 3300025944 Ga0207661_10009480 Ga0207661_100094802 248
527 3300025945 Ga0207679_10022097 Ga0207679_100220975 248
528 3300025945 Ga0207679_10401177 Ga0207679_104011771 248
529 3300025949 Ga0207667_10006654 Ga0207667_100066545 248
530 3300025949 Ga0207667_10056479 Ga0207667_100564794 248
531 3300025949 Ga0207667_10063468 Ga0207667_100634683 248
532 3300025949 Ga0207667_10228472 Ga0207667_102284722 248
533 3300025949 Ga0207667_10250754 Ga0207667_102507542 248
534 3300025949 Ga0207667_10253175 Ga0207667_102531751 248
535 3300025949 Ga0207667_10288707 Ga0207667_102887072 248
536 3300025960 Ga0207651_10047256 Ga0207651_100472564 248
537 3300025960 Ga0207651_10136995 Ga0207651_101369952 248
538 3300025961 Ga0207712_10458396 Ga0207712_104583962 248
539 3300025972 Ga0207668_10053336 Ga0207668_100533363 248
540 3300025986 Ga0207658_10124454 Ga0207658_101244542 248
541 3300026041 Ga0207639_10059931 Ga0207639_100599313 248
542 3300026041 Ga0207639_10102231 Ga0207639_101022312 248
543 3300026041 Ga0207639_10111873 Ga0207639_101118732 248
544 3300026041 Ga0207639_10206611 Ga0207639_102066112 248
545 3300026067 Ga0207678_10003412 Ga0207678_100034122 248
546 3300026067 Ga0207678_10019898 Ga0207678_100198984 248
547 3300026075 Ga0207708_10000359 Ga0207708_1000035911 248
548 3300026078 Ga0207702_10121859 Ga0207702_101218592 248
549 3300026078 Ga0207702_10807376 Ga0207702_108073762 248
550 3300026088 Ga0207641_10161823 Ga0207641_101618232 248
551 3300026089 Ga0207648_10013683 Ga0207648_100136833 248
552 3300026095 Ga0207676_10221713 Ga0207676_102217132 248
553 3300026095 Ga0207676_10491481 Ga0207676_104914812 248
554 3300026116 Ga0207674_10002872 Ga0207674_1000287212 248
555 3300026116 Ga0207674_10005327 Ga0207674_100053274 248
556 3300026116 Ga0207674_10040498 Ga0207674_100404982 248
557 3300026118 Ga0207675_100003104 Ga0207675_1000031047 248
558 3300026118 Ga0207675_100167504 Ga0207675_1001675042 248
559 3300026121 Ga0207683_10022430 Ga0207683_100224303 248
560 3300026121 Ga0207683_10458281 Ga0207683_104582812 248
561 3300026142 Ga0207698_10007269 Ga0207698_100072694 248
562 3300026142 Ga0207698_10008799 Ga0207698_100087992 248
563 3300026142 Ga0207698_10145941 Ga0207698_101459412 248
564 3300026142 Ga0207698_10868429 Ga0207698_108684291 248
565 3300027907 Ga0207428_10034667 Ga0207428_100346672 248
566 3300028381 Ga0268264_10042457 Ga0268264_100424573 248
567 3300035170 Ga0373943_0020748 Ga0373943_0020748_635_1381 248
568 3300035170 Ga0373943_0036466 Ga0373943_0036466_268_1014 248
569 3300035725 Ga0373947_0119587 Ga0373947_0119587_893_1639 248
570 3300036401 Ga0373937_0015627 Ga0373937_0015627_5817_6563 248
571 3300037068 Ga0373925_0159104 Ga0373925_0159104_196_942 248
572 3300037068 Ga0373925_0199118 Ga0373925_0199118_747_1493 248
573 3300037418 Ga0395900_0447663 Ga0395900_0447663_188_937 248
574 3300037466 Ga0395898_0192495 Ga0395898_0192495_1119_1868 248
575 3300038443 Ga0395901_0094704 Ga0395901_0094704_1241_1990 248
576 3300041463 Ga0451804_0116185 Ga0451804_0116185_519_1265 248
577 3300046537 Ga0495598_0111339 Ga0495598_0111339_135_881 248
578 3300046539 Ga0495621_0037958 Ga0495621_0037958_206_952 248
579 3300048904 Ga0496101_0246056 Ga0496101_0246056_160_906 248
580 3300048905 Ga0496102_0096680 Ga0496102_0096680_614_1360 248
581 3300048908 Ga0496105_0268943 Ga0496105_0268943_457_1203 248
582 3300048909 Ga0496106_0182617 Ga0496106_0182617_210_956 248
583 3300048910 Ga0496107_0025037 Ga0496107_0025037_997_1743 248
584 3300048911 Ga0496108_0005513 Ga0496108_0005513_4593_5339 248
585 3300048912 Ga0496109_0011282 Ga0496109_0011282_6854_7600 248
586 3300048913 Ga0496110_0006589 Ga0496110_0006589_3678_4424 248
587 3300048913 Ga0496110_0668154 Ga0496110_0668154_87_836 248
588 3300048917 Ga0496114_0145461 Ga0496114_0145461_978_1724 248
589 3300050511 nmdc:mga08y16_109962_c1 nmdc:mga08y16_109962_c1_804_1550 248
590 3300053085 Ga0495619_0184619 Ga0495619_0184619_448_1194 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

45

108

0.98

PF07702

UTRA

UTRA domain

137

267

0.93

PF08279

HTH_11

HTH domain

60

107

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9544 17 82
4r1h-assembly1.cif.gz_B gntr family transcriptional regulator from listeria monocytogenes 0.9416 13 83
3neu-assembly1.cif.gz_A-2 the crystal structure of a functionally-unknown protein lin1836 from listeria innocua clip11262 0.9377 13 84
2ek5-assembly4.cif.gz_C crystal structure of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution 0.9356 17 85
2ek5-assembly4.cif.gz_C-3 crystal structure of the transcriptional factor from c.glutamicum at 2.2 angstrom resolution 0.9356 17 85
ID Description Score Start End Superfamily
af_P31475_2_79_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9945 19 84 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9832 40 82 1.10.10.10
af_P9WMG7_15_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9825 19 84 1.10.10.10
af_O86331_14_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9797 14 82 1.10.10.10
af_P0ACL2_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9732 14 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X8VWR4-F1-model_v4 GntR family transcriptional regulator 0.9839 14 83 GO:0003677
GO:0003700
AF-A0A840J180-F1-model_v4 DNA-binding GntR family transcriptional regulator 0.9818 14 88 GO:0003677
GO:0003700
GO:0045892
AF-A0A7V4QQS5-F1-model_v4 GntR family transcriptional regulator 0.97 15 85 GO:0003677
GO:0003700
GO:0045892
AF-A0A4Q2FG05-F1-model_v4 GntR family transcriptional regulator 0.9684 14 83 GO:0003677
GO:0003700
AF-A0A7V3AEG4-F1-model_v4 GntR family transcriptional regulator 0.9628 13 87 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
85.67 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map