F466963
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 266 | 590 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300009993|Ga0105028_101012|Ga0105028_1010124 |
| Length | 222 |
| Sequence | MILLDRVTKTYGRVATPALDRISLHVEPKEFVIVVGQSGAGKSTLLKLLTREERPSTGKIIVGGIDYDKLKDRDIPLLRRKIGVVFQDFKLLPNRTVFENVSFALEIVGMGNREIRHTVPKLKGKEKRMPLELSGGERQRVAIARAIVRQPKILIADEPTGNLDPKHAWDVISVLEKINRYGTTVLLTTHNQEIVNKLKRRVVTIQHGQIASDRAGASYKVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 80 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 152 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 153 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 154 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 177 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 178 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 179 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 180 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 181 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 184 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 228 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 229 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 230 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 235 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 236 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 237 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 239 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 240 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 241 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 243 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 244 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 245 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 246 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 247 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 248 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 249 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 250 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 251 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 252 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 253 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 254 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 256 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 257 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 258 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 259 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 260 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 261 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 262 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 264 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.46 |
| Nodule | 0 |
| Rhizoplane | 0.51 |
| Rhizosphere | 81.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1328258 | 2162886007 | Bacteria | 2061 |
| 2 | JGI24736J21556_1018298 | 3300001904 | Bacteria | 1109 |
| 3 | JGI24741J21665_1000674 | 3300001915 | Bacteria | 10264 |
| 4 | JGI24741J21665_1002268 | 3300001915 | Bacteria | 5068 |
| 5 | JGI24740J21852_10006266 | 3300001979 | Bacteria | 4943 |
| 6 | JGI24740J21852_10037935 | 3300001979 | Bacteria | 1483 |
| 7 | JGI24739J22299_10005648 | 3300001989 | Bacteria | 4740 |
| 8 | JGI24737J22298_10000002 | 3300001990 | Bacteria | 76949 |
| 9 | JGI24743J22301_10008310 | 3300001991 | Bacteria | 1819 |
| 10 | JGI24735J21928_10000026 | 3300002067 | Bacteria | 88519 |
| 11 | JGI24735J21928_10000042 | 3300002067 | Bacteria | 58971 |
| 12 | JGI24735J21928_10000107 | 3300002067 | Bacteria | 30612 |
| 13 | JGI24738J21930_10016672 | 3300002075 | Bacteria | 1549 |
| 14 | rootH2_10078746 | 3300003320 | Bacteria | 3138 |
| 15 | rootH1_10034957 | 3300003323 | Bacteria | 1611 |
| 16 | rootH1_10121568 | 3300003323 | Bacteria | 4153 |
| 17 | Ga0065704_10101481 | 3300005289 | Bacteria | 2236 |
| 18 | Ga0070658_10000035 | 3300005327 | Bacteria | 145828 |
| 19 | Ga0070658_10002131 | 3300005327 | Bacteria | 16615 |
| 20 | Ga0070658_10005656 | 3300005327 | Bacteria | 10134 |
| 21 | Ga0070658_10010220 | 3300005327 | Bacteria | 7526 |
| 22 | Ga0070658_10175623 | 3300005327 | Bacteria | 1801 |
| 23 | Ga0070676_10014686 | 3300005328 | Bacteria | 4307 |
| 24 | Ga0070676_10145950 | 3300005328 | Bacteria | 1510 |
| 25 | Ga0070683_100000130 | 3300005329 | Bacteria | 48482 |
| 26 | Ga0070683_100211638 | 3300005329 | Bacteria | 1842 |
| 27 | Ga0070683_100665668 | 3300005329 | Bacteria | 997 |
| 28 | Ga0070690_100003312 | 3300005330 | Bacteria | 8790 |
| 29 | Ga0070666_10096277 | 3300005335 | Bacteria | 2037 |
| 30 | Ga0070680_100109873 | 3300005336 | Bacteria | 2295 |
| 31 | Ga0070680_100398379 | 3300005336 | Bacteria | 1173 |
| 32 | Ga0070680_100489041 | 3300005336 | Bacteria | 1052 |
| 33 | Ga0070682_100005661 | 3300005337 | Bacteria | 6967 |
| 34 | Ga0070682_100229875 | 3300005337 | Bacteria | 1325 |
| 35 | Ga0070660_100000099 | 3300005339 | Bacteria | 52371 |
| 36 | Ga0070660_100002635 | 3300005339 | Bacteria | 12338 |
| 37 | Ga0070660_100049994 | 3300005339 | Bacteria | 3216 |
| 38 | Ga0070691_10091496 | 3300005341 | Bacteria | 1500 |
| 39 | Ga0070687_100295550 | 3300005343 | Bacteria | 1025 |
| 40 | Ga0070661_100014870 | 3300005344 | Bacteria | 5490 |
| 41 | Ga0070661_100019512 | 3300005344 | Bacteria | 4832 |
| 42 | Ga0070661_100169657 | 3300005344 | Bacteria | 1656 |
| 43 | Ga0070668_100099717 | 3300005347 | Bacteria | 2300 |
| 44 | Ga0070669_100083495 | 3300005353 | Bacteria | 2382 |
| 45 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 46 | Ga0070671_100313225 | 3300005355 | Bacteria | 1337 |
| 47 | Ga0070674_100003164 | 3300005356 | Bacteria | 9175 |
| 48 | Ga0070673_100008713 | 3300005364 | Bacteria | 6767 |
| 49 | Ga0070659_100000797 | 3300005366 | Bacteria | 22983 |
| 50 | Ga0070659_100007446 | 3300005366 | Bacteria | 7955 |
| 51 | Ga0070659_100019205 | 3300005366 | Bacteria | 5174 |
| 52 | Ga0070659_100201846 | 3300005366 | Bacteria | 1637 |
| 53 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 54 | Ga0070667_100072118 | 3300005367 | Bacteria | 2942 |
| 55 | Ga0070714_100001085 | 3300005435 | Bacteria | 19461 |
| 56 | Ga0070708_100023930 | 3300005445 | Bacteria | 5199 |
| 57 | Ga0070663_100355392 | 3300005455 | Bacteria | 1187 |
| 58 | Ga0070678_100000867 | 3300005456 | Bacteria | 15459 |
| 59 | Ga0070678_100086943 | 3300005456 | Bacteria | 2386 |
| 60 | Ga0070662_100022040 | 3300005457 | Bacteria | 4356 |
| 61 | Ga0070681_10003503 | 3300005458 | Bacteria | 14697 |
| 62 | Ga0070681_10513697 | 3300005458 | Bacteria | 1111 |
| 63 | Ga0070685_10002389 | 3300005466 | Bacteria | 9659 |
| 64 | Ga0070685_10007413 | 3300005466 | Bacteria | 5613 |
| 65 | Ga0070679_100000219 | 3300005530 | Bacteria | 46654 |
| 66 | Ga0070679_100127789 | 3300005530 | Bacteria | 2523 |
| 67 | Ga0070679_100199551 | 3300005530 | Bacteria | 1967 |
| 68 | Ga0070679_100278535 | 3300005530 | Bacteria | 1625 |
| 69 | Ga0070679_100378726 | 3300005530 | Bacteria | 1362 |
| 70 | Ga0070684_100000623 | 3300005535 | Bacteria | 24450 |
| 71 | Ga0070684_100081415 | 3300005535 | Bacteria | 2865 |
| 72 | Ga0070684_100093331 | 3300005535 | Bacteria | 2679 |
| 73 | Ga0070684_100207661 | 3300005535 | Bacteria | 1785 |
| 74 | Ga0068853_100017986 | 3300005539 | Bacteria | 5842 |
| 75 | Ga0068853_100491870 | 3300005539 | Bacteria | 1157 |
| 76 | Ga0070672_100057775 | 3300005543 | Bacteria | 3047 |
| 77 | Ga0070686_100038924 | 3300005544 | Bacteria | 2960 |
| 78 | Ga0068855_100000003 | 3300005563 | Bacteria | 589862 |
| 79 | Ga0068855_100001636 | 3300005563 | Bacteria | 28089 |
| 80 | Ga0068855_100002650 | 3300005563 | Bacteria | 22058 |
| 81 | Ga0068855_100003265 | 3300005563 | Bacteria | 19847 |
| 82 | Ga0068855_100050197 | 3300005563 | Bacteria | 4918 |
| 83 | Ga0068855_100070845 | 3300005563 | Bacteria | 4055 |
| 84 | Ga0068855_100072054 | 3300005563 | Bacteria | 4016 |
| 85 | Ga0068855_100329981 | 3300005563 | Bacteria | 1684 |
| 86 | Ga0068855_100429492 | 3300005563 | Bacteria | 1444 |
| 87 | Ga0070664_100001018 | 3300005564 | Bacteria | 22010 |
| 88 | Ga0068857_100000040 | 3300005577 | Bacteria | 70513 |
| 89 | Ga0068857_100014858 | 3300005577 | Bacteria | 6790 |
| 90 | Ga0068857_100021612 | 3300005577 | Bacteria | 5662 |
| 91 | Ga0068857_100023099 | 3300005577 | Bacteria | 5470 |
| 92 | Ga0068857_100066918 | 3300005577 | Bacteria | 3197 |
| 93 | Ga0068857_100097858 | 3300005577 | Bacteria | 2631 |
| 94 | Ga0068857_100100416 | 3300005577 | Bacteria | 2596 |
| 95 | Ga0068857_100119870 | 3300005577 | Bacteria | 2368 |
| 96 | Ga0068857_100313187 | 3300005577 | Bacteria | 1448 |
| 97 | Ga0068854_100245788 | 3300005578 | Bacteria | 1427 |
| 98 | Ga0068856_100000001 | 3300005614 | Bacteria | 565602 |
| 99 | Ga0068856_100000354 | 3300005614 | Bacteria | 50023 |
| 100 | Ga0068856_100040232 | 3300005614 | Bacteria | 4591 |
| 101 | Ga0068856_100237680 | 3300005614 | Bacteria | 1837 |
| 102 | Ga0068856_100485696 | 3300005614 | Bacteria | 1256 |
| 103 | Ga0068856_100679211 | 3300005614 | Bacteria | 1050 |
| 104 | Ga0068852_100133713 | 3300005616 | Bacteria | 2287 |
| 105 | Ga0068852_100530766 | 3300005616 | Bacteria | 1175 |
| 106 | Ga0068859_100101592 | 3300005617 | Bacteria | 2933 |
| 107 | Ga0068859_101492012 | 3300005617 | Bacteria | 746 |
| 108 | Ga0068863_100248954 | 3300005841 | Bacteria | 1716 |
| 109 | Ga0068863_100629240 | 3300005841 | Bacteria | 1063 |
| 110 | Ga0068860_100007462 | 3300005843 | Bacteria | 10936 |
| 111 | Ga0068860_100024465 | 3300005843 | Bacteria | 5834 |
| 112 | Ga0068860_100167299 | 3300005843 | Bacteria | 2123 |
| 113 | Ga0068860_100500189 | 3300005843 | Bacteria | 1213 |
| 114 | Ga0068860_100677181 | 3300005843 | Bacteria | 1040 |
| 115 | Ga0081539_10001122 | 3300005985 | Bacteria | 48598 |
| 116 | Ga0075365_10000021 | 3300006038 | Bacteria | 64483 |
| 117 | Ga0075365_10022683 | 3300006038 | Bacteria | 3937 |
| 118 | Ga0075365_10111393 | 3300006038 | Bacteria | 1881 |
| 119 | Ga0075365_10218429 | 3300006038 | Bacteria | 1337 |
| 120 | Ga0075368_10000062 | 3300006042 | Bacteria | 25855 |
| 121 | Ga0075363_100000019 | 3300006048 | Bacteria | 34359 |
| 122 | Ga0075364_10013648 | 3300006051 | Bacteria | 5001 |
| 123 | Ga0075364_10031430 | 3300006051 | Bacteria | 3411 |
| 124 | Ga0075367_10000012 | 3300006178 | Bacteria | 42001 |
| 125 | Ga0075367_10003115 | 3300006178 | Bacteria | 7802 |
| 126 | Ga0075367_10061567 | 3300006178 | Bacteria | 2240 |
| 127 | Ga0075369_10000012 | 3300006186 | Bacteria | 74833 |
| 128 | Ga0075369_10016321 | 3300006186 | Bacteria | 2995 |
| 129 | Ga0075369_10148160 | 3300006186 | Bacteria | 1072 |
| 130 | Ga0075366_10000011 | 3300006195 | Bacteria | 79037 |
| 131 | Ga0075366_10000134 | 3300006195 | Bacteria | 30925 |
| 132 | Ga0075366_10000959 | 3300006195 | Bacteria | 14075 |
| 133 | Ga0075366_10002255 | 3300006195 | Bacteria | 9851 |
| 134 | Ga0075366_10003146 | 3300006195 | Bacteria | 8640 |
| 135 | Ga0097621_100000001 | 3300006237 | Bacteria | 632268 |
| 136 | Ga0097621_100331720 | 3300006237 | Bacteria | 1349 |
| 137 | Ga0097621_100984273 | 3300006237 | Bacteria | 788 |
| 138 | Ga0075370_10000866 | 3300006353 | Bacteria | 12318 |
| 139 | Ga0075370_10007565 | 3300006353 | Bacteria | 5539 |
| 140 | Ga0075370_10008017 | 3300006353 | Bacteria | 5415 |
| 141 | Ga0075370_10039890 | 3300006353 | Bacteria | 2647 |
| 142 | Ga0068871_100000005 | 3300006358 | Bacteria | 123210 |
| 143 | Ga0068871_100086325 | 3300006358 | Bacteria | 2607 |
| 144 | Ga0075428_100016057 | 3300006844 | Bacteria | 8280 |
| 145 | Ga0075430_100042755 | 3300006846 | Bacteria | 3831 |
| 146 | Ga0068865_100000316 | 3300006881 | Bacteria | 26705 |
| 147 | Ga0068865_100622667 | 3300006881 | Bacteria | 914 |
| 148 | Ga0075436_100242621 | 3300006914 | Bacteria | 1282 |
| 149 | Ga0097620_100101590 | 3300006931 | Bacteria | 2933 |
| 150 | Ga0097620_101492097 | 3300006931 | Bacteria | 746 |
| 151 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 152 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 153 | Ga0105240_10023637 | 3300009093 | Bacteria | 8119 |
| 154 | Ga0105240_10123197 | 3300009093 | Bacteria | 3119 |
| 155 | Ga0105240_10427476 | 3300009093 | Bacteria | 1487 |
| 156 | Ga0105240_10590074 | 3300009093 | Bacteria | 1224 |
| 157 | Ga0105240_10741750 | 3300009093 | Bacteria | 1068 |
| 158 | Ga0111539_10000492 | 3300009094 | Bacteria | 50138 |
| 159 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 160 | Ga0105245_10000093 | 3300009098 | Bacteria | 86866 |
| 161 | Ga0105245_10006458 | 3300009098 | Bacteria | 10315 |
| 162 | Ga0105245_10035287 | 3300009098 | Bacteria | 4438 |
| 163 | Ga0105245_10061797 | 3300009098 | Bacteria | 3378 |
| 164 | Ga0105245_10072265 | 3300009098 | Bacteria | 3133 |
| 165 | Ga0105245_10266082 | 3300009098 | Bacteria | 1670 |
| 166 | Ga0105245_10340574 | 3300009098 | Bacteria | 1483 |
| 167 | Ga0105245_10959572 | 3300009098 | Bacteria | 898 |
| 168 | Ga0105247_10280856 | 3300009101 | Bacteria | 1149 |
| 169 | Ga0105247_10287203 | 3300009101 | Unclassified | 1137 |
| 170 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 171 | Ga0105243_10001490 | 3300009148 | Bacteria | 20502 |
| 172 | Ga0105241_10000007 | 3300009174 | Bacteria | 343524 |
| 173 | Ga0105241_10012054 | 3300009174 | Bacteria | 6349 |
| 174 | Ga0105241_10036701 | 3300009174 | Bacteria | 3689 |
| 175 | Ga0105242_10000002 | 3300009176 | Bacteria | 262559 |
| 176 | Ga0105242_10001924 | 3300009176 | Bacteria | 16329 |
| 177 | Ga0105242_10028406 | 3300009176 | Bacteria | 4453 |
| 178 | Ga0105242_10114405 | 3300009176 | Bacteria | 2305 |
| 179 | Ga0105248_10432176 | 3300009177 | Bacteria | 1483 |
| 180 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 181 | Ga0105237_10010322 | 3300009545 | Bacteria | 9950 |
| 182 | Ga0105237_10332270 | 3300009545 | Bacteria | 1524 |
| 183 | Ga0105238_10092416 | 3300009551 | Bacteria | 3013 |
| 184 | Ga0105238_10283075 | 3300009551 | Bacteria | 1639 |
| 185 | Ga0105249_10004977 | 3300009553 | Bacteria | 11464 |
| 186 | Ga0105249_10134697 | 3300009553 | Bacteria | 2362 |
| 187 | Ga0105029_100172 | 3300009984 | Bacteria | 3263 |
| 188 | Ga0105028_101012 | 3300009993 | Bacteria | 2960 |
| 189 | Ga0105239_10020947 | 3300010375 | Bacteria | 7213 |
| 190 | Ga0105239_10021841 | 3300010375 | Bacteria | 7055 |
| 191 | Ga0105239_10040288 | 3300010375 | Bacteria | 5118 |
| 192 | Ga0105246_10001734 | 3300011119 | Bacteria | 13031 |
| 193 | Ga0105246_10006713 | 3300011119 | Bacteria | 7037 |
| 194 | Ga0157373_10000433 | 3300013100 | Bacteria | 33251 |
| 195 | Ga0157373_10029275 | 3300013100 | Bacteria | 3968 |
| 196 | Ga0157373_10229700 | 3300013100 | Bacteria | 1310 |
| 197 | Ga0157371_10001803 | 3300013102 | Bacteria | 21647 |
| 198 | Ga0157371_10004875 | 3300013102 | Bacteria | 11537 |
| 199 | Ga0157370_10000924 | 3300013104 | Bacteria | 37267 |
| 200 | Ga0157370_10001253 | 3300013104 | Bacteria | 31691 |
| 201 | Ga0157370_10546709 | 3300013104 | Bacteria | 1062 |
| 202 | Ga0157370_10599917 | 3300013104 | Bacteria | 1008 |
| 203 | Ga0157369_10000024 | 3300013105 | Bacteria | 225851 |
| 204 | Ga0157369_10000104 | 3300013105 | Bacteria | 118133 |
| 205 | Ga0157369_10000444 | 3300013105 | Bacteria | 54827 |
| 206 | Ga0157369_10012770 | 3300013105 | Bacteria | 9524 |
| 207 | Ga0157369_10050340 | 3300013105 | Bacteria | 4512 |
| 208 | Ga0157369_10539388 | 3300013105 | Bacteria | 1206 |
| 209 | Ga0157374_10000225 | 3300013296 | Bacteria | 52365 |
| 210 | Ga0157374_10000501 | 3300013296 | Bacteria | 35418 |
| 211 | Ga0157374_10000509 | 3300013296 | Bacteria | 35015 |
| 212 | Ga0157374_10001467 | 3300013296 | Bacteria | 19900 |
| 213 | Ga0157374_10005951 | 3300013296 | Bacteria | 10312 |
| 214 | Ga0157374_10183376 | 3300013296 | Bacteria | 2046 |
| 215 | Ga0157374_10195970 | 3300013296 | Bacteria | 1977 |
| 216 | Ga0157374_10375658 | 3300013296 | Unclassified | 1415 |
| 217 | Ga0157378_10220560 | 3300013297 | Bacteria | 1802 |
| 218 | Ga0163162_10119428 | 3300013306 | Bacteria | 2739 |
| 219 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 220 | Ga0157372_10000553 | 3300013307 | Bacteria | 41144 |
| 221 | Ga0157372_10104511 | 3300013307 | Bacteria | 3238 |
| 222 | Ga0163163_10008888 | 3300014325 | Bacteria | 8946 |
| 223 | Ga0157377_10002625 | 3300014745 | Bacteria | 7976 |
| 224 | Ga0157376_10000007 | 3300014969 | Bacteria | 368004 |
| 225 | Ga0207710_10151988 | 3300025900 | Unclassified | 1123 |
| 226 | Ga0207688_10172618 | 3300025901 | Bacteria | 1286 |
| 227 | Ga0207680_10177620 | 3300025903 | Bacteria | 1438 |
| 228 | Ga0207647_10000315 | 3300025904 | Bacteria | 40274 |
| 229 | Ga0207647_10001817 | 3300025904 | Bacteria | 16373 |
| 230 | Ga0207705_10000010 | 3300025909 | Bacteria | 518023 |
| 231 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 232 | Ga0207705_10000065 | 3300025909 | Bacteria | 137123 |
| 233 | Ga0207705_10004833 | 3300025909 | Bacteria | 10139 |
| 234 | Ga0207705_10022207 | 3300025909 | Bacteria | 4527 |
| 235 | Ga0207705_10024571 | 3300025909 | Bacteria | 4299 |
| 236 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 237 | Ga0207654_10024380 | 3300025911 | Bacteria | 3251 |
| 238 | Ga0207654_10140097 | 3300025911 | Bacteria | 1541 |
| 239 | Ga0207707_10005260 | 3300025912 | Bacteria | 11333 |
| 240 | Ga0207707_10009816 | 3300025912 | Bacteria | 8302 |
| 241 | Ga0207707_10242777 | 3300025912 | Bacteria | 1566 |
| 242 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 243 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 244 | Ga0207695_10028809 | 3300025913 | Bacteria | 6148 |
| 245 | Ga0207695_10313927 | 3300025913 | Bacteria | 1457 |
| 246 | Ga0207695_10420121 | 3300025913 | Bacteria | 1221 |
| 247 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 248 | Ga0207671_10009916 | 3300025914 | Bacteria | 7917 |
| 249 | Ga0207660_10153362 | 3300025917 | Bacteria | 1772 |
| 250 | Ga0207662_10301310 | 3300025918 | Bacteria | 1066 |
| 251 | Ga0207657_10001204 | 3300025919 | Bacteria | 27540 |
| 252 | Ga0207657_10001496 | 3300025919 | Bacteria | 24997 |
| 253 | Ga0207657_10008411 | 3300025919 | Bacteria | 10475 |
| 254 | Ga0207657_10070357 | 3300025919 | Bacteria | 2966 |
| 255 | Ga0207649_10010995 | 3300025920 | Bacteria | 4978 |
| 256 | Ga0207649_10028172 | 3300025920 | Bacteria | 3305 |
| 257 | Ga0207652_10001284 | 3300025921 | Bacteria | 22377 |
| 258 | Ga0207652_10065247 | 3300025921 | Bacteria | 3152 |
| 259 | Ga0207652_10079483 | 3300025921 | Bacteria | 2865 |
| 260 | Ga0207652_10218195 | 3300025921 | Bacteria | 1718 |
| 261 | Ga0207652_10261285 | 3300025921 | Bacteria | 1562 |
| 262 | Ga0207652_10269506 | 3300025921 | Bacteria | 1536 |
| 263 | Ga0207652_10592734 | 3300025921 | Bacteria | 994 |
| 264 | Ga0207681_10140070 | 3300025923 | Bacteria | 1800 |
| 265 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 266 | Ga0207687_10000907 | 3300025927 | Bacteria | 20171 |
| 267 | Ga0207687_10010247 | 3300025927 | Bacteria | 6123 |
| 268 | Ga0207687_10020599 | 3300025927 | Bacteria | 4376 |
| 269 | Ga0207687_10297871 | 3300025927 | Bacteria | 1298 |
| 270 | Ga0207700_10239546 | 3300025928 | Bacteria | 1546 |
| 271 | Ga0207664_10001077 | 3300025929 | Bacteria | 18198 |
| 272 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 273 | Ga0207644_10008039 | 3300025931 | Bacteria | 6901 |
| 274 | Ga0207644_10172178 | 3300025931 | Bacteria | 1691 |
| 275 | Ga0207690_10004353 | 3300025932 | Bacteria | 8359 |
| 276 | Ga0207690_10689037 | 3300025932 | Bacteria | 839 |
| 277 | Ga0207706_10000053 | 3300025933 | Bacteria | 114286 |
| 278 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 279 | Ga0207686_10001050 | 3300025934 | Bacteria | 16339 |
| 280 | Ga0207686_10209077 | 3300025934 | Bacteria | 1402 |
| 281 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 282 | Ga0207709_10011294 | 3300025935 | Bacteria | 4926 |
| 283 | Ga0207670_10676325 | 3300025936 | Bacteria | 853 |
| 284 | Ga0207669_10400095 | 3300025937 | Bacteria | 1075 |
| 285 | Ga0207704_10000843 | 3300025938 | Bacteria | 13602 |
| 286 | Ga0207691_10018821 | 3300025940 | Bacteria | 6541 |
| 287 | Ga0207711_10377392 | 3300025941 | Bacteria | 1315 |
| 288 | Ga0207661_10000118 | 3300025944 | Bacteria | 50730 |
| 289 | Ga0207661_10028558 | 3300025944 | Bacteria | 4273 |
| 290 | Ga0207661_10064196 | 3300025944 | Bacteria | 2976 |
| 291 | Ga0207661_10305996 | 3300025944 | Bacteria | 1426 |
| 292 | Ga0207679_10000193 | 3300025945 | Bacteria | 49103 |
| 293 | Ga0207679_10126487 | 3300025945 | Bacteria | 2043 |
| 294 | Ga0207679_10614706 | 3300025945 | Bacteria | 980 |
| 295 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 296 | Ga0207667_10000784 | 3300025949 | Bacteria | 41252 |
| 297 | Ga0207667_10003751 | 3300025949 | Bacteria | 18715 |
| 298 | Ga0207667_10004748 | 3300025949 | Bacteria | 16618 |
| 299 | Ga0207667_10014120 | 3300025949 | Bacteria | 9116 |
| 300 | Ga0207667_10037504 | 3300025949 | Bacteria | 5180 |
| 301 | Ga0207667_10058970 | 3300025949 | Bacteria | 4023 |
| 302 | Ga0207667_10170880 | 3300025949 | Bacteria | 2234 |
| 303 | Ga0207667_10532935 | 3300025949 | Bacteria | 1189 |
| 304 | Ga0207667_10580571 | 3300025949 | Bacteria | 1132 |
| 305 | Ga0207667_10654553 | 3300025949 | Bacteria | 1056 |
| 306 | Ga0207651_10004852 | 3300025960 | Bacteria | 6848 |
| 307 | Ga0207712_10064727 | 3300025961 | Bacteria | 2608 |
| 308 | Ga0207712_10089008 | 3300025961 | Bacteria | 2268 |
| 309 | Ga0207640_10081458 | 3300025981 | Bacteria | 2213 |
| 310 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 311 | Ga0207658_10021047 | 3300025986 | Bacteria | 4522 |
| 312 | Ga0207639_10028883 | 3300026041 | Bacteria | 4054 |
| 313 | Ga0207678_10378798 | 3300026067 | Unclassified | 1223 |
| 314 | Ga0207702_10000062 | 3300026078 | Bacteria | 124850 |
| 315 | Ga0207702_10000190 | 3300026078 | Bacteria | 73848 |
| 316 | Ga0207702_10028752 | 3300026078 | Bacteria | 4623 |
| 317 | Ga0207702_10633074 | 3300026078 | Bacteria | 1051 |
| 318 | Ga0207641_10020510 | 3300026088 | Bacteria | 5429 |
| 319 | Ga0207641_10194486 | 3300026088 | Bacteria | 1866 |
| 320 | Ga0207641_10583998 | 3300026088 | Bacteria | 1092 |
| 321 | Ga0207648_10012947 | 3300026089 | Bacteria | 7791 |
| 322 | Ga0207674_10000001 | 3300026116 | Bacteria | 616581 |
| 323 | Ga0207674_10003329 | 3300026116 | Bacteria | 19756 |
| 324 | Ga0207674_10034987 | 3300026116 | Bacteria | 5245 |
| 325 | Ga0207674_10092451 | 3300026116 | Bacteria | 3015 |
| 326 | Ga0207674_10131856 | 3300026116 | Bacteria | 2462 |
| 327 | Ga0207674_10285130 | 3300026116 | Bacteria | 1600 |
| 328 | Ga0207674_10339089 | 3300026116 | Bacteria | 1453 |
| 329 | Ga0207683_10001083 | 3300026121 | Bacteria | 24823 |
| 330 | Ga0207683_10272951 | 3300026121 | Bacteria | 1545 |
| 331 | Ga0207698_10025132 | 3300026142 | Bacteria | 4190 |
| 332 | Ga0207698_10080372 | 3300026142 | Bacteria | 2626 |
| 333 | Ga0207698_10934730 | 3300026142 | Bacteria | 876 |
| 334 | Ga0209813_10000002 | 3300027866 | Bacteria | 215993 |
| 335 | Ga0207428_10031187 | 3300027907 | Bacteria | 4402 |
| 336 | Ga0268266_10004953 | 3300028379 | Bacteria | 12601 |
| 337 | Ga0268264_10033265 | 3300028381 | Bacteria | 4234 |
| 338 | Ga0268264_10041097 | 3300028381 | Bacteria | 3823 |
| 339 | Ga0268264_10573062 | 3300028381 | Bacteria | 1110 |
| 340 | Ga0265337_1000080 | 3300028556 | Bacteria | 45887 |
| 341 | Ga0265337_1000451 | 3300028556 | Bacteria | 21825 |
| 342 | Ga0265337_1000834 | 3300028556 | Bacteria | 16183 |
| 343 | Ga0265337_1001454 | 3300028556 | Bacteria | 11616 |
| 344 | Ga0265337_1004106 | 3300028556 | Bacteria | 6116 |
| 345 | Ga0265326_10001913 | 3300028558 | Bacteria | 7128 |
| 346 | Ga0265326_10001956 | 3300028558 | Bacteria | 7053 |
| 347 | Ga0265326_10002098 | 3300028558 | Bacteria | 6784 |
| 348 | Ga0265326_10017846 | 3300028558 | Bacteria | 2044 |
| 349 | Ga0265319_1002291 | 3300028563 | Bacteria | 10563 |
| 350 | Ga0265319_1013897 | 3300028563 | Bacteria | 3180 |
| 351 | Ga0265334_10000045 | 3300028573 | Bacteria | 93663 |
| 352 | Ga0265334_10000403 | 3300028573 | Bacteria | 22701 |
| 353 | Ga0265334_10000676 | 3300028573 | Bacteria | 17067 |
| 354 | Ga0265334_10075579 | 3300028573 | Bacteria | 1248 |
| 355 | Ga0265334_10168345 | 3300028573 | Bacteria | 768 |
| 356 | Ga0265318_10027653 | 3300028577 | Bacteria | 2226 |
| 357 | Ga0265318_10053876 | 3300028577 | Bacteria | 1508 |
| 358 | Ga0265318_10057872 | 3300028577 | Bacteria | 1448 |
| 359 | Ga0265318_10059589 | 3300028577 | Bacteria | 1423 |
| 360 | Ga0265323_10008089 | 3300028653 | Bacteria | 4350 |
| 361 | Ga0265322_10001957 | 3300028654 | Bacteria | 6514 |
| 362 | Ga0265322_10049354 | 3300028654 | Bacteria | 1195 |
| 363 | Ga0265336_10002603 | 3300028666 | Bacteria | 7360 |
| 364 | Ga0265336_10003039 | 3300028666 | Bacteria | 6692 |
| 365 | Ga0265336_10009629 | 3300028666 | Bacteria | 3333 |
| 366 | Ga0265338_10000003 | 3300028800 | Bacteria | 733923 |
| 367 | Ga0265338_10000195 | 3300028800 | Bacteria | 114621 |
| 368 | Ga0265338_10000323 | 3300028800 | Bacteria | 87009 |
| 369 | Ga0265338_10000412 | 3300028800 | Bacteria | 76488 |
| 370 | Ga0265338_10000891 | 3300028800 | Bacteria | 50269 |
| 371 | Ga0265338_10001293 | 3300028800 | Bacteria | 41034 |
| 372 | Ga0265338_10001463 | 3300028800 | Bacteria | 38257 |
| 373 | Ga0265338_10009158 | 3300028800 | Bacteria | 11878 |
| 374 | Ga0265338_10016351 | 3300028800 | Bacteria | 8079 |
| 375 | Ga0265338_10035468 | 3300028800 | Bacteria | 4794 |
| 376 | Ga0265338_10060422 | 3300028800 | Bacteria | 3330 |
| 377 | Ga0265338_10095622 | 3300028800 | Bacteria | 2439 |
| 378 | Ga0265338_10115914 | 3300028800 | Bacteria | 2147 |
| 379 | Ga0265338_10241590 | 3300028800 | Bacteria | 1337 |
| 380 | Ga0265324_10011905 | 3300029957 | Bacteria | 3302 |
| 381 | Ga0265324_10056860 | 3300029957 | Bacteria | 1340 |
| 382 | Ga0316179_1039080 | 3300030734 | Bacteria | 1656 |
| 383 | Ga0316183_1044371 | 3300030742 | Bacteria | 23716 |
| 384 | Ga0316183_1116204 | 3300030742 | Bacteria | 23360 |
| 385 | Ga0316181_1063761 | 3300030744 | Bacteria | 284591 |
| 386 | Ga0316182_1011253 | 3300030745 | Bacteria | 3630 |
| 387 | Ga0316182_1167866 | 3300030745 | Bacteria | 4453 |
| 388 | Ga0316182_1313426 | 3300030745 | Bacteria | 15981 |
| 389 | Ga0265330_10004861 | 3300031235 | Bacteria | 6768 |
| 390 | Ga0265332_10010841 | 3300031238 | Bacteria | 4048 |
| 391 | Ga0265328_10003567 | 3300031239 | Bacteria | 6859 |
| 392 | Ga0265320_10055310 | 3300031240 | Bacteria | 1910 |
| 393 | Ga0265320_10062134 | 3300031240 | Bacteria | 1779 |
| 394 | Ga0265325_10012313 | 3300031241 | Bacteria | 4893 |
| 395 | Ga0265325_10089688 | 3300031241 | Bacteria | 1518 |
| 396 | Ga0265325_10180322 | 3300031241 | Bacteria | 984 |
| 397 | Ga0265329_10014059 | 3300031242 | Bacteria | 2834 |
| 398 | Ga0265340_10002239 | 3300031247 | Bacteria | 11055 |
| 399 | Ga0265340_10012961 | 3300031247 | Bacteria | 4392 |
| 400 | Ga0265339_10010518 | 3300031249 | Bacteria | 5746 |
| 401 | Ga0265331_10006997 | 3300031250 | Bacteria | 6584 |
| 402 | Ga0265327_10000017 | 3300031251 | Bacteria | 445264 |
| 403 | Ga0265327_10003876 | 3300031251 | Bacteria | 13782 |
| 404 | Ga0265327_10016060 | 3300031251 | Bacteria | 4786 |
| 405 | Ga0265327_10020579 | 3300031251 | Bacteria | 4012 |
| 406 | Ga0265327_10048902 | 3300031251 | Bacteria | 2220 |
| 407 | Ga0265327_10163183 | 3300031251 | Bacteria | 1028 |
| 408 | Ga0265316_10028506 | 3300031344 | Bacteria | 4605 |
| 409 | Ga0265316_10048984 | 3300031344 | Bacteria | 3330 |
| 410 | Ga0265316_10087056 | 3300031344 | Bacteria | 2387 |
| 411 | Ga0265316_10521747 | 3300031344 | Bacteria | 847 |
| 412 | Ga0265313_10006154 | 3300031595 | Bacteria | 8612 |
| 413 | Ga0265313_10007171 | 3300031595 | Bacteria | 7676 |
| 414 | Ga0265314_10015777 | 3300031711 | Bacteria | 5983 |
| 415 | Ga0265314_10094736 | 3300031711 | Bacteria | 1935 |
| 416 | Ga0265314_10154763 | 3300031711 | Bacteria | 1401 |
| 417 | Ga0265342_10059265 | 3300031712 | Bacteria | 2261 |
| 418 | Ga0265342_10284044 | 3300031712 | Bacteria | 875 |
| 419 | Ga0307516_10000003 | 3300031730 | Bacteria | 459377 |
| 420 | Ga0373959_0000257 | 3300034820 | Bacteria | 11596 |
| 421 | Ga0395899_0012731 | 3300037312 | Bacteria | 6444 |
| 422 | Ga0395899_0022434 | 3300037312 | Bacteria | 4787 |
| 423 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 424 | Ga0395900_0015980 | 3300037418 | Bacteria | 7649 |
| 425 | Ga0395900_0020197 | 3300037418 | Bacteria | 6797 |
| 426 | Ga0395900_0140243 | 3300037418 | Bacteria | 2476 |
| 427 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 428 | Ga0395898_0003154 | 3300037466 | Bacteria | 18614 |
| 429 | Ga0395898_0022091 | 3300037466 | Bacteria | 6446 |
| 430 | Ga0395905_0000937 | 3300037471 | Bacteria | 37558 |
| 431 | Ga0395905_0007157 | 3300037471 | Bacteria | 11150 |
| 432 | Ga0395905_0674372 | 3300037471 | Bacteria | 936 |
| 433 | Ga0395901_0000400 | 3300038443 | Bacteria | 51851 |
| 434 | Ga0395901_0008437 | 3300038443 | Bacteria | 10413 |
| 435 | Ga0395901_0013122 | 3300038443 | Bacteria | 8409 |
| 436 | Ga0395901_0323502 | 3300038443 | Bacteria | 1595 |
| 437 | Ga0451807_2470150 | 3300041486 | Bacteria | 1532 |
| 438 | Ga0439463_015078 | 3300042016 | Bacteria | 1910 |
| 439 | Ga0439446_0000005 | 3300042156 | Bacteria | 101649 |
| 440 | Ga0439434_0023735 | 3300042435 | Bacteria | 1847 |
| 441 | Ga0439464_0000002 | 3300042439 | Bacteria | 79371 |
| 442 | Ga0450918_001467 | 3300042531 | Bacteria | 4674 |
| 443 | Ga0466972_0012197 | 3300044658 | Bacteria | 4319 |
| 444 | Ga0453683_0017769 | 3300044673 | Bacteria | 4574 |
| 445 | Ga0466965_0000073 | 3300044683 | Bacteria | 29903 |
| 446 | Ga0451576_0001703 | 3300045051 | Bacteria | 36322 |
| 447 | Ga0451576_0017700 | 3300045051 | Bacteria | 7831 |
| 448 | Ga0451576_0018934 | 3300045051 | Bacteria | 7523 |
| 449 | Ga0451576_0057179 | 3300045051 | Bacteria | 4077 |
| 450 | Ga0466967_0121965 | 3300045976 | Bacteria | 2410 |
| 451 | Ga0466967_0595288 | 3300045976 | Bacteria | 1091 |
| 452 | Ga0466967_0958003 | 3300045976 | Bacteria | 852 |
| 453 | Ga0495629_0051043 | 3300046459 | Bacteria | 2895 |
| 454 | Ga0495582_0062085 | 3300046473 | Bacteria | 2064 |
| 455 | Ga0495622_0000051 | 3300046557 | Bacteria | 105674 |
| 456 | Ga0495588_0000173 | 3300046674 | Bacteria | 81355 |
| 457 | Ga0495658_0011473 | 3300046683 | Bacteria | 4459 |
| 458 | Ga0495671_0148775 | 3300046692 | Bacteria | 1140 |
| 459 | Ga0495600_0060789 | 3300046809 | Bacteria | 2467 |
| 460 | Ga0495660_0000035 | 3300046810 | Bacteria | 199140 |
| 461 | Ga0495660_0028356 | 3300046810 | Bacteria | 3164 |
| 462 | Ga0495672_0000016 | 3300047320 | Bacteria | 500601 |
| 463 | Ga0496100_0028735 | 3300048903 | Bacteria | 3433 |
| 464 | Ga0496112_0037761 | 3300048915 | Bacteria | 4715 |
| 465 | Ga0496125_0067969 | 3300048928 | Bacteria | 2805 |
| 466 | Ga0496126_0097051 | 3300048929 | Bacteria | 2583 |
| 467 | Ga0501031_0001257 | 3300049568 | Bacteria | 15525 |
| 468 | Ga0501032_0001296 | 3300049569 | Bacteria | 20042 |
| 469 | Ga0501033_0052542 | 3300049570 | Bacteria | 3020 |
| 470 | Ga0501033_0281110 | 3300049570 | Bacteria | 1175 |
| 471 | Ga0501034_0000333 | 3300049571 | Bacteria | 82475 |
| 472 | Ga0501034_0001363 | 3300049571 | Bacteria | 32981 |
| 473 | Ga0501034_0015860 | 3300049571 | Bacteria | 7736 |
| 474 | Ga0501034_0054932 | 3300049571 | Bacteria | 4008 |
| 475 | Ga0501036_0013424 | 3300049572 | Bacteria | 6806 |
| 476 | Ga0501037_0000001 | 3300049573 | Bacteria | 753276 |
| 477 | Ga0501037_0000141 | 3300049573 | Bacteria | 67142 |
| 478 | Ga0501038_0034445 | 3300049574 | Bacteria | 4452 |
| 479 | Ga0501038_0044082 | 3300049574 | Bacteria | 3877 |
| 480 | Ga0501038_0101656 | 3300049574 | Bacteria | 2393 |
| 481 | Ga0501040_0185357 | 3300049576 | Bacteria | 1476 |
| 482 | Ga0501042_0096853 | 3300049578 | Bacteria | 2120 |
| 483 | Ga0501043_0000145 | 3300049579 | Bacteria | 65943 |
| 484 | Ga0501046_0000065 | 3300049580 | Bacteria | 116095 |
| 485 | Ga0501047_0000119 | 3300049581 | Bacteria | 96051 |
| 486 | Ga0501047_0000375 | 3300049581 | Bacteria | 50494 |
| 487 | Ga0501048_0000133 | 3300049582 | Bacteria | 44300 |
| 488 | Ga0501048_0073309 | 3300049582 | Bacteria | 2416 |
| 489 | Ga0501067_0042834 | 3300049583 | Bacteria | 2514 |
| 490 | Ga0501068_0003920 | 3300049584 | Bacteria | 8091 |
| 491 | Ga0501069_0108128 | 3300049585 | Bacteria | 1582 |
| 492 | Ga0501070_0008113 | 3300049586 | Bacteria | 8888 |
| 493 | Ga0501070_0026381 | 3300049586 | Bacteria | 4875 |
| 494 | Ga0501070_0306841 | 3300049586 | Bacteria | 1292 |
| 495 | Ga0501071_0019256 | 3300049587 | Bacteria | 4735 |
| 496 | Ga0501073_0045525 | 3300049589 | Bacteria | 3090 |
| 497 | Ga0501073_0188936 | 3300049589 | Bacteria | 1425 |
| 498 | Ga0501080_0000893 | 3300049742 | Bacteria | 24429 |
| 499 | Ga0501080_0068883 | 3300049742 | Bacteria | 3291 |
| 500 | Ga0501083_0008094 | 3300049744 | Bacteria | 7434 |
| 501 | Ga0501083_0017659 | 3300049744 | Bacteria | 4974 |
| 502 | Ga0501083_0248465 | 3300049744 | Bacteria | 1158 |
| 503 | Ga0501035_0000211 | 3300049822 | Bacteria | 69883 |
| 504 | Ga0501035_0004250 | 3300049822 | Bacteria | 13597 |
| 505 | Ga0501035_0190609 | 3300049822 | Bacteria | 1763 |
| 506 | Ga0501044_0046803 | 3300049823 | Bacteria | 4477 |
| 507 | nmdc:mga03683_724_c1 | 3300050489 | Bacteria | 9442 |
| 508 | nmdc:mga03n38_33_c1 | 3300050490 | Bacteria | 30986 |
| 509 | nmdc:mga00v17_14983_c1 | 3300050491 | Bacteria | 4343 |
| 510 | nmdc:mga00v17_25497_c1 | 3300050491 | Bacteria | 3437 |
| 511 | nmdc:mga00v17_67780_c1 | 3300050491 | Bacteria | 2205 |
| 512 | nmdc:mga0yw44_13_c1 | 3300050492 | Bacteria | 120183 |
| 513 | nmdc:mga0yw44_31633_c1 | 3300050492 | Bacteria | 3078 |
| 514 | nmdc:mga0yw44_48789_c1 | 3300050492 | Bacteria | 2553 |
| 515 | nmdc:mga0yw44_92574_c1 | 3300050492 | Bacteria | 1913 |
| 516 | nmdc:mga0k408_113_c1 | 3300050493 | Bacteria | 39351 |
| 517 | nmdc:mga0k408_15872_c1 | 3300050493 | Bacteria | 4170 |
| 518 | nmdc:mga0k408_179_c1 | 3300050493 | Bacteria | 33243 |
| 519 | nmdc:mga0k408_1961_c2 | 3300050493 | Bacteria | 9850 |
| 520 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 521 | nmdc:mga0k408_2493_c1 | 3300050493 | Bacteria | 9792 |
| 522 | nmdc:mga0k408_3268_c1 | 3300050493 | Bacteria | 8575 |
| 523 | nmdc:mga06z11_224699_c1 | 3300050494 | Bacteria | 1098 |
| 524 | nmdc:mga06z11_31_c1 | 3300050494 | Bacteria | 57393 |
| 525 | nmdc:mga06z11_74_c1 | 3300050494 | Bacteria | 42014 |
| 526 | nmdc:mga04h51_2_c1 | 3300050495 | Bacteria | 215993 |
| 527 | nmdc:mga07m45_39184_c1 | 3300050496 | Bacteria | 2647 |
| 528 | nmdc:mga07m45_729_c1 | 3300050496 | Bacteria | 10864 |
| 529 | nmdc:mga07m45_7506_c1 | 3300050496 | Bacteria | 5573 |
| 530 | nmdc:mga07m45_827_c1 | 3300050496 | Bacteria | 13388 |
| 531 | nmdc:mga0qj67_13114_c1 | 3300050509 | Bacteria | 6259 |
| 532 | nmdc:mga08y16_2629_c1 | 3300050511 | Bacteria | 18453 |
| 533 | nmdc:mga08x19_215015_c1 | 3300050514 | Bacteria | 1320 |
| 534 | nmdc:mga0sz30_12962_c1 | 3300050516 | Bacteria | 3255 |
| 535 | nmdc:mga0sz30_139004_c1 | 3300050516 | Bacteria | 1072 |
| 536 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 537 | nmdc:mga0sz30_4_c1 | 3300050516 | Bacteria | 84956 |
| 538 | nmdc:mga0sz30_80399_c1 | 3300050516 | Bacteria | 1410 |
| 539 | Ga0500610_0000002 | 3300053079 | Bacteria | 166752 |
| 540 | Ga0500643_000010 | 3300053087 | Bacteria | 408084 |
| 541 | Ga0500643_000251 | 3300053087 | Bacteria | 49425 |
| 542 | Ga0500643_002124 | 3300053087 | Bacteria | 10505 |
| 543 | Ga0500643_022263 | 3300053087 | Bacteria | 2042 |
| 544 | Ga0500644_0000198 | 3300053088 | Bacteria | 36907 |
| 545 | Ga0500644_0001954 | 3300053088 | Bacteria | 5259 |
| 546 | Ga0500644_0021864 | 3300053088 | Bacteria | 1922 |
| 547 | Ga0500646_0000048 | 3300053090 | Bacteria | 33067 |
| 548 | Ga0500583_0000057 | 3300053092 | Bacteria | 71874 |
| 549 | Ga0500583_0004917 | 3300053092 | Bacteria | 4419 |
| 550 | Ga0500651_0000019 | 3300053093 | Bacteria | 141974 |
| 551 | Ga0500651_0000051 | 3300053093 | Bacteria | 76584 |
| 552 | Ga0500651_0002735 | 3300053093 | Bacteria | 9419 |
| 553 | Ga0500651_0122821 | 3300053093 | Bacteria | 1575 |
| 554 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 555 | Ga0500650_0000003 | 3300053098 | Bacteria | 164144 |
| 556 | Ga0500650_0012261 | 3300053098 | Bacteria | 3561 |
| 557 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 558 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 559 | Ga0500556_0000196 | 3300053104 | Bacteria | 49648 |
| 560 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 561 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 562 | Ga0500562_012684 | 3300053108 | Bacteria | 2146 |
| 563 | Ga0500593_000001 | 3300053117 | Bacteria | 784404 |
| 564 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 565 | Ga0500594_0000034 | 3300053118 | Bacteria | 44315 |
| 566 | Ga0500594_0000258 | 3300053118 | Bacteria | 12500 |
| 567 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 568 | Ga0500621_000694 | 3300053126 | Bacteria | 6546 |
| 569 | Ga0500628_000009 | 3300053129 | Bacteria | 122386 |
| 570 | Ga0500628_031681 | 3300053129 | Bacteria | 1152 |
| 571 | Ga0500652_000695 | 3300053131 | Bacteria | 11449 |
| 572 | Ga0500655_000327 | 3300053133 | Bacteria | 10462 |
| 573 | Ga0500559_0009237 | 3300053136 | Bacteria | 4279 |
| 574 | Ga0500561_0000001 | 3300053137 | Bacteria | 957685 |
| 575 | Ga0500568_0004845 | 3300053139 | Bacteria | 7106 |
| 576 | Ga0500577_0000357 | 3300053142 | Bacteria | 11677 |
| 577 | Ga0500577_0082762 | 3300053142 | Bacteria | 1283 |
| 578 | Ga0500579_006408 | 3300053143 | Bacteria | 7310 |
| 579 | Ga0500589_000002 | 3300053147 | Bacteria | 245055 |
| 580 | Ga0500589_042175 | 3300053147 | Bacteria | 2128 |
| 581 | Ga0500589_057551 | 3300053147 | Bacteria | 1790 |
| 582 | Ga0500603_013046 | 3300053150 | Bacteria | 1920 |
| 583 | Ga0500604_0032448 | 3300053151 | Bacteria | 1539 |
| 584 | Ga0500633_0016280 | 3300053160 | Bacteria | 2155 |
| 585 | Ga0500649_000002 | 3300053722 | Bacteria | 145889 |
| 586 | Ga0500570_000003 | 3300053724 | Bacteria | 149500 |
| 587 | Ga0500611_000897 | 3300053727 | Bacteria | 3107 |
| 588 | Ga0500611_003354 | 3300053727 | Bacteria | 2041 |
| 589 | Ga0501084_0023645 | 3300054114 | Bacteria | 5124 |
| 590 | Ga0501082_0051798 | 3300060353 | Bacteria | 3538 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053104 | Ga0500556_0000196 | Ga0500556_0000196_38539_39201 | 213 |
| 2 | 3300009993 | Ga0105028_101012 | Ga0105028_1010124 | 221 |
| 3 | 3300029957 | Ga0265324_10056860 | Ga0265324_100568601 | 223 |
| 4 | 3300031711 | Ga0265314_10154763 | Ga0265314_101547632 | 223 |
| 5 | 3300044673 | Ga0453683_0017769 | Ga0453683_0017769_1569_2249 | 223 |
| 6 | 3300045051 | Ga0451576_0001703 | Ga0451576_0001703_33853_34533 | 223 |
| 7 | 3300045051 | Ga0451576_0017700 | Ga0451576_0017700_1925_2605 | 223 |
| 8 | 3300045051 | Ga0451576_0057179 | Ga0451576_0057179_2367_3047 | 223 |
| 9 | 3300005367 | Ga0070667_100000001 | Ga0070667_1000000011094 | 224 |
| 10 | 3300005843 | Ga0068860_100007462 | Ga0068860_1000074625 | 224 |
| 11 | 3300025928 | Ga0207700_10239546 | Ga0207700_102395462 | 224 |
| 12 | 3300025949 | Ga0207667_10580571 | Ga0207667_105805712 | 224 |
| 13 | 3300025986 | Ga0207658_10000003 | Ga0207658_10000003288 | 224 |
| 14 | 3300028381 | Ga0268264_10041097 | Ga0268264_100410974 | 224 |
| 15 | 3300005329 | Ga0070683_100000130 | Ga0070683_10000013025 | 225 |
| 16 | 3300005445 | Ga0070708_100023930 | Ga0070708_1000239302 | 225 |
| 17 | 3300005535 | Ga0070684_100000623 | Ga0070684_1000006231 | 225 |
| 18 | 3300005535 | Ga0070684_100093331 | Ga0070684_1000933313 | 225 |
| 19 | 3300006237 | Ga0097621_100984273 | Ga0097621_1009842731 | 225 |
| 20 | 3300025944 | Ga0207661_10000118 | Ga0207661_1000011833 | 225 |
| 21 | 3300049574 | Ga0501038_0101656 | Ga0501038_0101656_1537_2316 | 225 |
| 22 | 3300049583 | Ga0501067_0042834 | Ga0501067_0042834_420_1199 | 225 |
| 23 | 3300049584 | Ga0501068_0003920 | Ga0501068_0003920_4435_5214 | 225 |
| 24 | 3300049585 | Ga0501069_0108128 | Ga0501069_0108128_644_1423 | 225 |
| 25 | 3300049586 | Ga0501070_0008113 | Ga0501070_0008113_6900_7679 | 225 |
| 26 | 3300049587 | Ga0501071_0019256 | Ga0501071_0019256_2445_3224 | 225 |
| 27 | 3300049589 | Ga0501073_0045525 | Ga0501073_0045525_838_1617 | 225 |
| 28 | 3300049742 | Ga0501080_0068883 | Ga0501080_0068883_494_1273 | 225 |
| 29 | 3300049822 | Ga0501035_0190609 | Ga0501035_0190609_278_1057 | 225 |
| 30 | 3300054114 | Ga0501084_0023645 | Ga0501084_0023645_2389_3168 | 225 |
| 31 | 3300003323 | rootH1_10121568 | rootH1_101215683 | 226 |
| 32 | 3300005335 | Ga0070666_10096277 | Ga0070666_100962773 | 226 |
| 33 | 3300005336 | Ga0070680_100398379 | Ga0070680_1003983792 | 226 |
| 34 | 3300005344 | Ga0070661_100019512 | Ga0070661_1000195123 | 226 |
| 35 | 3300005347 | Ga0070668_100099717 | Ga0070668_1000997172 | 226 |
| 36 | 3300005353 | Ga0070669_100083495 | Ga0070669_1000834952 | 226 |
| 37 | 3300005355 | Ga0070671_100000001 | Ga0070671_10000000197 | 226 |
| 38 | 3300005366 | Ga0070659_100201846 | Ga0070659_1002018462 | 226 |
| 39 | 3300005435 | Ga0070714_100001085 | Ga0070714_10000108514 | 226 |
| 40 | 3300005530 | Ga0070679_100000219 | Ga0070679_10000021938 | 226 |
| 41 | 3300005530 | Ga0070679_100278535 | Ga0070679_1002785352 | 226 |
| 42 | 3300005535 | Ga0070684_100207661 | Ga0070684_1002076612 | 226 |
| 43 | 3300005539 | Ga0068853_100017986 | Ga0068853_1000179862 | 226 |
| 44 | 3300005563 | Ga0068855_100050197 | Ga0068855_1000501975 | 226 |
| 45 | 3300005563 | Ga0068855_100329981 | Ga0068855_1003299812 | 226 |
| 46 | 3300005563 | Ga0068855_100429492 | Ga0068855_1004294922 | 226 |
| 47 | 3300005577 | Ga0068857_100021612 | Ga0068857_1000216123 | 226 |
| 48 | 3300005577 | Ga0068857_100119870 | Ga0068857_1001198703 | 226 |
| 49 | 3300005578 | Ga0068854_100245788 | Ga0068854_1002457882 | 226 |
| 50 | 3300005616 | Ga0068852_100530766 | Ga0068852_1005307662 | 226 |
| 51 | 3300005617 | Ga0068859_100101592 | Ga0068859_1001015922 | 226 |
| 52 | 3300005617 | Ga0068859_101492012 | Ga0068859_1014920121 | 226 |
| 53 | 3300005841 | Ga0068863_100629240 | Ga0068863_1006292401 | 226 |
| 54 | 3300005843 | Ga0068860_100024465 | Ga0068860_1000244653 | 226 |
| 55 | 3300005843 | Ga0068860_100167299 | Ga0068860_1001672992 | 226 |
| 56 | 3300005985 | Ga0081539_10001122 | Ga0081539_1000112245 | 226 |
| 57 | 3300006038 | Ga0075365_10022683 | Ga0075365_100226834 | 226 |
| 58 | 3300006237 | Ga0097621_100331720 | Ga0097621_1003317202 | 226 |
| 59 | 3300006358 | Ga0068871_100086325 | Ga0068871_1000863253 | 226 |
| 60 | 3300006931 | Ga0097620_100101590 | Ga0097620_1001015902 | 226 |
| 61 | 3300006931 | Ga0097620_101492097 | Ga0097620_1014920971 | 226 |
| 62 | 3300009093 | Ga0105240_10123197 | Ga0105240_101231972 | 226 |
| 63 | 3300009093 | Ga0105240_10427476 | Ga0105240_104274762 | 226 |
| 64 | 3300009093 | Ga0105240_10590074 | Ga0105240_105900742 | 226 |
| 65 | 3300009093 | Ga0105240_10741750 | Ga0105240_107417502 | 226 |
| 66 | 3300009098 | Ga0105245_10006458 | Ga0105245_100064587 | 226 |
| 67 | 3300009098 | Ga0105245_10959572 | Ga0105245_109595721 | 226 |
| 68 | 3300009101 | Ga0105247_10280856 | Ga0105247_102808561 | 226 |
| 69 | 3300009101 | Ga0105247_10287203 | Ga0105247_102872032 | 226 |
| 70 | 3300009174 | Ga0105241_10036701 | Ga0105241_100367013 | 226 |
| 71 | 3300013105 | Ga0157369_10050340 | Ga0157369_100503404 | 226 |
| 72 | 3300013307 | Ga0157372_10000553 | Ga0157372_1000055310 | 226 |
| 73 | 3300013307 | Ga0157372_10104511 | Ga0157372_101045112 | 226 |
| 74 | 3300025900 | Ga0207710_10151988 | Ga0207710_101519882 | 226 |
| 75 | 3300025903 | Ga0207680_10177620 | Ga0207680_101776202 | 226 |
| 76 | 3300025904 | Ga0207647_10001817 | Ga0207647_100018174 | 226 |
| 77 | 3300025912 | Ga0207707_10009816 | Ga0207707_100098165 | 226 |
| 78 | 3300025913 | Ga0207695_10313927 | Ga0207695_103139272 | 226 |
| 79 | 3300025913 | Ga0207695_10420121 | Ga0207695_104201212 | 226 |
| 80 | 3300025917 | Ga0207660_10153362 | Ga0207660_101533621 | 226 |
| 81 | 3300025919 | Ga0207657_10070357 | Ga0207657_100703574 | 226 |
| 82 | 3300025920 | Ga0207649_10028172 | Ga0207649_100281724 | 226 |
| 83 | 3300025921 | Ga0207652_10001284 | Ga0207652_1000128415 | 226 |
| 84 | 3300025921 | Ga0207652_10261285 | Ga0207652_102612852 | 226 |
| 85 | 3300025921 | Ga0207652_10269506 | Ga0207652_102695062 | 226 |
| 86 | 3300025923 | Ga0207681_10140070 | Ga0207681_101400702 | 226 |
| 87 | 3300025927 | Ga0207687_10010247 | Ga0207687_100102475 | 226 |
| 88 | 3300025929 | Ga0207664_10001077 | Ga0207664_100010774 | 226 |
| 89 | 3300025931 | Ga0207644_10000001 | Ga0207644_100000011335 | 226 |
| 90 | 3300025931 | Ga0207644_10008039 | Ga0207644_100080393 | 226 |
| 91 | 3300025932 | Ga0207690_10689037 | Ga0207690_106890371 | 226 |
| 92 | 3300025949 | Ga0207667_10014120 | Ga0207667_100141204 | 226 |
| 93 | 3300025949 | Ga0207667_10037504 | Ga0207667_100375044 | 226 |
| 94 | 3300025949 | Ga0207667_10170880 | Ga0207667_101708803 | 226 |
| 95 | 3300025949 | Ga0207667_10532935 | Ga0207667_105329351 | 226 |
| 96 | 3300025949 | Ga0207667_10654553 | Ga0207667_106545532 | 226 |
| 97 | 3300025981 | Ga0207640_10081458 | Ga0207640_100814582 | 226 |
| 98 | 3300025986 | Ga0207658_10021047 | Ga0207658_100210472 | 226 |
| 99 | 3300026041 | Ga0207639_10028883 | Ga0207639_100288832 | 226 |
| 100 | 3300026088 | Ga0207641_10020510 | Ga0207641_100205105 | 226 |
| 101 | 3300026088 | Ga0207641_10583998 | Ga0207641_105839981 | 226 |
| 102 | 3300026116 | Ga0207674_10003329 | Ga0207674_100033294 | 226 |
| 103 | 3300026116 | Ga0207674_10131856 | Ga0207674_101318562 | 226 |
| 104 | 3300026142 | Ga0207698_10025132 | Ga0207698_100251324 | 226 |
| 105 | 3300026142 | Ga0207698_10934730 | Ga0207698_109347302 | 226 |
| 106 | 3300028381 | Ga0268264_10033265 | Ga0268264_100332653 | 226 |
| 107 | 3300028556 | Ga0265337_1000080 | Ga0265337_100008016 | 226 |
| 108 | 3300028556 | Ga0265337_1000451 | Ga0265337_100045127 | 226 |
| 109 | 3300028556 | Ga0265337_1000834 | Ga0265337_100083416 | 226 |
| 110 | 3300028556 | Ga0265337_1001454 | Ga0265337_100145410 | 226 |
| 111 | 3300028556 | Ga0265337_1004106 | Ga0265337_10041064 | 226 |
| 112 | 3300028558 | Ga0265326_10001913 | Ga0265326_100019132 | 226 |
| 113 | 3300028558 | Ga0265326_10001956 | Ga0265326_100019563 | 226 |
| 114 | 3300028558 | Ga0265326_10002098 | Ga0265326_100020983 | 226 |
| 115 | 3300028558 | Ga0265326_10017846 | Ga0265326_100178463 | 226 |
| 116 | 3300028563 | Ga0265319_1002291 | Ga0265319_10022918 | 226 |
| 117 | 3300028563 | Ga0265319_1013897 | Ga0265319_10138972 | 226 |
| 118 | 3300028573 | Ga0265334_10000045 | Ga0265334_1000004568 | 226 |
| 119 | 3300028573 | Ga0265334_10000676 | Ga0265334_100006761 | 226 |
| 120 | 3300028573 | Ga0265334_10075579 | Ga0265334_100755791 | 226 |
| 121 | 3300028573 | Ga0265334_10168345 | Ga0265334_101683452 | 226 |
| 122 | 3300028577 | Ga0265318_10027653 | Ga0265318_100276532 | 226 |
| 123 | 3300028577 | Ga0265318_10053876 | Ga0265318_100538762 | 226 |
| 124 | 3300028577 | Ga0265318_10057872 | Ga0265318_100578722 | 226 |
| 125 | 3300028577 | Ga0265318_10059589 | Ga0265318_100595892 | 226 |
| 126 | 3300028653 | Ga0265323_10008089 | Ga0265323_100080892 | 226 |
| 127 | 3300028654 | Ga0265322_10001957 | Ga0265322_100019572 | 226 |
| 128 | 3300028654 | Ga0265322_10049354 | Ga0265322_100493542 | 226 |
| 129 | 3300028666 | Ga0265336_10002603 | Ga0265336_100026034 | 226 |
| 130 | 3300028666 | Ga0265336_10003039 | Ga0265336_100030394 | 226 |
| 131 | 3300028666 | Ga0265336_10009629 | Ga0265336_100096291 | 226 |
| 132 | 3300028800 | Ga0265338_10000003 | Ga0265338_10000003642 | 226 |
| 133 | 3300028800 | Ga0265338_10000195 | Ga0265338_1000019553 | 226 |
| 134 | 3300028800 | Ga0265338_10000412 | Ga0265338_1000041255 | 226 |
| 135 | 3300028800 | Ga0265338_10001293 | Ga0265338_1000129327 | 226 |
| 136 | 3300028800 | Ga0265338_10001463 | Ga0265338_1000146320 | 226 |
| 137 | 3300028800 | Ga0265338_10009158 | Ga0265338_100091582 | 226 |
| 138 | 3300028800 | Ga0265338_10016351 | Ga0265338_100163513 | 226 |
| 139 | 3300028800 | Ga0265338_10060422 | Ga0265338_100604221 | 226 |
| 140 | 3300028800 | Ga0265338_10095622 | Ga0265338_100956221 | 226 |
| 141 | 3300029957 | Ga0265324_10011905 | Ga0265324_100119051 | 226 |
| 142 | 3300031235 | Ga0265330_10004861 | Ga0265330_100048615 | 226 |
| 143 | 3300031238 | Ga0265332_10010841 | Ga0265332_100108413 | 226 |
| 144 | 3300031239 | Ga0265328_10003567 | Ga0265328_100035672 | 226 |
| 145 | 3300031240 | Ga0265320_10055310 | Ga0265320_100553102 | 226 |
| 146 | 3300031240 | Ga0265320_10062134 | Ga0265320_100621342 | 226 |
| 147 | 3300031241 | Ga0265325_10012313 | Ga0265325_100123134 | 226 |
| 148 | 3300031241 | Ga0265325_10089688 | Ga0265325_100896882 | 226 |
| 149 | 3300031241 | Ga0265325_10180322 | Ga0265325_101803221 | 226 |
| 150 | 3300031242 | Ga0265329_10014059 | Ga0265329_100140592 | 226 |
| 151 | 3300031247 | Ga0265340_10002239 | Ga0265340_100022394 | 226 |
| 152 | 3300031249 | Ga0265339_10010518 | Ga0265339_100105182 | 226 |
| 153 | 3300031250 | Ga0265331_10006997 | Ga0265331_100069972 | 226 |
| 154 | 3300031251 | Ga0265327_10020579 | Ga0265327_100205792 | 226 |
| 155 | 3300031251 | Ga0265327_10048902 | Ga0265327_100489023 | 226 |
| 156 | 3300031251 | Ga0265327_10163183 | Ga0265327_101631831 | 226 |
| 157 | 3300031344 | Ga0265316_10028506 | Ga0265316_100285063 | 226 |
| 158 | 3300031344 | Ga0265316_10048984 | Ga0265316_100489841 | 226 |
| 159 | 3300031344 | Ga0265316_10087056 | Ga0265316_100870562 | 226 |
| 160 | 3300031344 | Ga0265316_10521747 | Ga0265316_105217471 | 226 |
| 161 | 3300031595 | Ga0265313_10006154 | Ga0265313_100061542 | 226 |
| 162 | 3300031595 | Ga0265313_10007171 | Ga0265313_100071713 | 226 |
| 163 | 3300031711 | Ga0265314_10015777 | Ga0265314_100157775 | 226 |
| 164 | 3300031711 | Ga0265314_10094736 | Ga0265314_100947362 | 226 |
| 165 | 3300031712 | Ga0265342_10059265 | Ga0265342_100592652 | 226 |
| 166 | 3300031712 | Ga0265342_10284044 | Ga0265342_102840441 | 226 |
| 167 | 3300037418 | Ga0395900_0020197 | Ga0395900_0020197_1053_1736 | 226 |
| 168 | 3300037466 | Ga0395898_0003154 | Ga0395898_0003154_6927_7610 | 226 |
| 169 | 3300041486 | Ga0451807_2470150 | Ga0451807_2470150_374_1057 | 226 |
| 170 | 3300047320 | Ga0495672_0000016 | Ga0495672_0000016_365908_366591 | 226 |
| 171 | 3300048928 | Ga0496125_0067969 | Ga0496125_0067969_940_1758 | 226 |
| 172 | 3300049744 | Ga0501083_0008094 | Ga0501083_0008094_6578_7267 | 226 |
| 173 | 3300050492 | nmdc:mga0yw44_48789_c1 | nmdc:mga0yw44_48789_c1_1292_1972 | 226 |
| 174 | 3300053087 | Ga0500643_000010 | Ga0500643_000010_53907_54587 | 226 |
| 175 | 3300053087 | Ga0500643_000251 | Ga0500643_000251_14478_15161 | 226 |
| 176 | 3300053117 | Ga0500593_000001 | Ga0500593_000001_352846_353532 | 226 |
| 177 | 3300053139 | Ga0500568_0004845 | Ga0500568_0004845_3946_4626 | 226 |
| 178 | 3300053147 | Ga0500589_042175 | Ga0500589_042175_314_997 | 226 |
| 179 | 3300053147 | Ga0500589_057551 | Ga0500589_057551_255_935 | 226 |
| 180 | 3300053724 | Ga0500570_000003 | Ga0500570_000003_142212_142934 | 226 |
| 181 | 3300053727 | Ga0500611_000897 | Ga0500611_000897_333_1016 | 226 |
| 182 | 2162886007 | SwRhRL2b_contig_1328258 | SwRhRL2b_0798.00001750 | 227 |
| 183 | 3300001904 | JGI24736J21556_1018298 | JGI24736J21556_10182982 | 227 |
| 184 | 3300001915 | JGI24741J21665_1000674 | JGI24741J21665_10006742 | 227 |
| 185 | 3300001915 | JGI24741J21665_1002268 | JGI24741J21665_10022686 | 227 |
| 186 | 3300001979 | JGI24740J21852_10006266 | JGI24740J21852_100062664 | 227 |
| 187 | 3300001979 | JGI24740J21852_10037935 | JGI24740J21852_100379352 | 227 |
| 188 | 3300001989 | JGI24739J22299_10005648 | JGI24739J22299_100056483 | 227 |
| 189 | 3300001990 | JGI24737J22298_10000002 | JGI24737J22298_1000000243 | 227 |
| 190 | 3300001991 | JGI24743J22301_10008310 | JGI24743J22301_100083102 | 227 |
| 191 | 3300002067 | JGI24735J21928_10000026 | JGI24735J21928_1000002614 | 227 |
| 192 | 3300002067 | JGI24735J21928_10000042 | JGI24735J21928_1000004220 | 227 |
| 193 | 3300002067 | JGI24735J21928_10000107 | JGI24735J21928_1000010724 | 227 |
| 194 | 3300002075 | JGI24738J21930_10016672 | JGI24738J21930_100166721 | 227 |
| 195 | 3300003320 | rootH2_10078746 | rootH2_100787463 | 227 |
| 196 | 3300003323 | rootH1_10034957 | rootH1_100349572 | 227 |
| 197 | 3300005289 | Ga0065704_10101481 | Ga0065704_101014812 | 227 |
| 198 | 3300005327 | Ga0070658_10000035 | Ga0070658_1000003599 | 227 |
| 199 | 3300005327 | Ga0070658_10002131 | Ga0070658_100021319 | 227 |
| 200 | 3300005327 | Ga0070658_10005656 | Ga0070658_100056565 | 227 |
| 201 | 3300005327 | Ga0070658_10010220 | Ga0070658_100102204 | 227 |
| 202 | 3300005327 | Ga0070658_10175623 | Ga0070658_101756231 | 227 |
| 203 | 3300005328 | Ga0070676_10014686 | Ga0070676_100146864 | 227 |
| 204 | 3300005328 | Ga0070676_10145950 | Ga0070676_101459502 | 227 |
| 205 | 3300005329 | Ga0070683_100211638 | Ga0070683_1002116382 | 227 |
| 206 | 3300005329 | Ga0070683_100665668 | Ga0070683_1006656681 | 227 |
| 207 | 3300005330 | Ga0070690_100003312 | Ga0070690_1000033123 | 227 |
| 208 | 3300005336 | Ga0070680_100109873 | Ga0070680_1001098732 | 227 |
| 209 | 3300005336 | Ga0070680_100489041 | Ga0070680_1004890412 | 227 |
| 210 | 3300005337 | Ga0070682_100005661 | Ga0070682_1000056614 | 227 |
| 211 | 3300005337 | Ga0070682_100229875 | Ga0070682_1002298752 | 227 |
| 212 | 3300005339 | Ga0070660_100000099 | Ga0070660_1000000995 | 227 |
| 213 | 3300005339 | Ga0070660_100002635 | Ga0070660_10000263511 | 227 |
| 214 | 3300005339 | Ga0070660_100049994 | Ga0070660_1000499942 | 227 |
| 215 | 3300005341 | Ga0070691_10091496 | Ga0070691_100914962 | 227 |
| 216 | 3300005343 | Ga0070687_100295550 | Ga0070687_1002955502 | 227 |
| 217 | 3300005344 | Ga0070661_100014870 | Ga0070661_1000148704 | 227 |
| 218 | 3300005344 | Ga0070661_100169657 | Ga0070661_1001696572 | 227 |
| 219 | 3300005355 | Ga0070671_100313225 | Ga0070671_1003132252 | 227 |
| 220 | 3300005356 | Ga0070674_100003164 | Ga0070674_1000031647 | 227 |
| 221 | 3300005364 | Ga0070673_100008713 | Ga0070673_1000087133 | 227 |
| 222 | 3300005366 | Ga0070659_100000797 | Ga0070659_1000007976 | 227 |
| 223 | 3300005366 | Ga0070659_100007446 | Ga0070659_1000074465 | 227 |
| 224 | 3300005366 | Ga0070659_100019205 | Ga0070659_1000192055 | 227 |
| 225 | 3300005367 | Ga0070667_100072118 | Ga0070667_1000721182 | 227 |
| 226 | 3300005455 | Ga0070663_100355392 | Ga0070663_1003553921 | 227 |
| 227 | 3300005456 | Ga0070678_100000867 | Ga0070678_1000008674 | 227 |
| 228 | 3300005456 | Ga0070678_100086943 | Ga0070678_1000869432 | 227 |
| 229 | 3300005457 | Ga0070662_100022040 | Ga0070662_1000220402 | 227 |
| 230 | 3300005458 | Ga0070681_10003503 | Ga0070681_100035035 | 227 |
| 231 | 3300005458 | Ga0070681_10513697 | Ga0070681_105136971 | 227 |
| 232 | 3300005466 | Ga0070685_10002389 | Ga0070685_100023894 | 227 |
| 233 | 3300005466 | Ga0070685_10007413 | Ga0070685_100074134 | 227 |
| 234 | 3300005530 | Ga0070679_100127789 | Ga0070679_1001277893 | 227 |
| 235 | 3300005530 | Ga0070679_100199551 | Ga0070679_1001995512 | 227 |
| 236 | 3300005530 | Ga0070679_100378726 | Ga0070679_1003787262 | 227 |
| 237 | 3300005535 | Ga0070684_100081415 | Ga0070684_1000814152 | 227 |
| 238 | 3300005539 | Ga0068853_100491870 | Ga0068853_1004918702 | 227 |
| 239 | 3300005543 | Ga0070672_100057775 | Ga0070672_1000577753 | 227 |
| 240 | 3300005544 | Ga0070686_100038924 | Ga0070686_1000389244 | 227 |
| 241 | 3300005563 | Ga0068855_100000003 | Ga0068855_100000003591 | 227 |
| 242 | 3300005563 | Ga0068855_100001636 | Ga0068855_10000163626 | 227 |
| 243 | 3300005563 | Ga0068855_100002650 | Ga0068855_1000026505 | 227 |
| 244 | 3300005563 | Ga0068855_100003265 | Ga0068855_10000326518 | 227 |
| 245 | 3300005563 | Ga0068855_100070845 | Ga0068855_1000708454 | 227 |
| 246 | 3300005563 | Ga0068855_100072054 | Ga0068855_1000720544 | 227 |
| 247 | 3300005564 | Ga0070664_100001018 | Ga0070664_10000101817 | 227 |
| 248 | 3300005577 | Ga0068857_100000040 | Ga0068857_10000004065 | 227 |
| 249 | 3300005577 | Ga0068857_100014858 | Ga0068857_1000148587 | 227 |
| 250 | 3300005577 | Ga0068857_100023099 | Ga0068857_1000230992 | 227 |
| 251 | 3300005577 | Ga0068857_100066918 | Ga0068857_1000669182 | 227 |
| 252 | 3300005577 | Ga0068857_100097858 | Ga0068857_1000978583 | 227 |
| 253 | 3300005577 | Ga0068857_100100416 | Ga0068857_1001004164 | 227 |
| 254 | 3300005577 | Ga0068857_100313187 | Ga0068857_1003131872 | 227 |
| 255 | 3300005614 | Ga0068856_100000001 | Ga0068856_100000001607 | 227 |
| 256 | 3300005614 | Ga0068856_100000354 | Ga0068856_10000035431 | 227 |
| 257 | 3300005614 | Ga0068856_100040232 | Ga0068856_1000402323 | 227 |
| 258 | 3300005614 | Ga0068856_100237680 | Ga0068856_1002376802 | 227 |
| 259 | 3300005614 | Ga0068856_100485696 | Ga0068856_1004856962 | 227 |
| 260 | 3300005614 | Ga0068856_100679211 | Ga0068856_1006792111 | 227 |
| 261 | 3300005616 | Ga0068852_100133713 | Ga0068852_1001337132 | 227 |
| 262 | 3300005841 | Ga0068863_100248954 | Ga0068863_1002489542 | 227 |
| 263 | 3300005843 | Ga0068860_100500189 | Ga0068860_1005001891 | 227 |
| 264 | 3300005843 | Ga0068860_100677181 | Ga0068860_1006771811 | 227 |
| 265 | 3300006038 | Ga0075365_10000021 | Ga0075365_1000002152 | 227 |
| 266 | 3300006038 | Ga0075365_10111393 | Ga0075365_101113932 | 227 |
| 267 | 3300006038 | Ga0075365_10218429 | Ga0075365_102184291 | 227 |
| 268 | 3300006042 | Ga0075368_10000062 | Ga0075368_1000006226 | 227 |
| 269 | 3300006048 | Ga0075363_100000019 | Ga0075363_10000001929 | 227 |
| 270 | 3300006051 | Ga0075364_10013648 | Ga0075364_100136484 | 227 |
| 271 | 3300006051 | Ga0075364_10031430 | Ga0075364_100314303 | 227 |
| 272 | 3300006178 | Ga0075367_10000012 | Ga0075367_1000001224 | 227 |
| 273 | 3300006178 | Ga0075367_10003115 | Ga0075367_100031153 | 227 |
| 274 | 3300006178 | Ga0075367_10061567 | Ga0075367_100615673 | 227 |
| 275 | 3300006186 | Ga0075369_10000012 | Ga0075369_100000122 | 227 |
| 276 | 3300006186 | Ga0075369_10016321 | Ga0075369_100163213 | 227 |
| 277 | 3300006186 | Ga0075369_10148160 | Ga0075369_101481602 | 227 |
| 278 | 3300006195 | Ga0075366_10000011 | Ga0075366_1000001133 | 227 |
| 279 | 3300006195 | Ga0075366_10000134 | Ga0075366_1000013419 | 227 |
| 280 | 3300006195 | Ga0075366_10000959 | Ga0075366_100009598 | 227 |
| 281 | 3300006195 | Ga0075366_10002255 | Ga0075366_1000225510 | 227 |
| 282 | 3300006195 | Ga0075366_10003146 | Ga0075366_100031464 | 227 |
| 283 | 3300006237 | Ga0097621_100000001 | Ga0097621_100000001102 | 227 |
| 284 | 3300006353 | Ga0075370_10000866 | Ga0075370_1000086610 | 227 |
| 285 | 3300006353 | Ga0075370_10007565 | Ga0075370_100075651 | 227 |
| 286 | 3300006353 | Ga0075370_10008017 | Ga0075370_100080174 | 227 |
| 287 | 3300006353 | Ga0075370_10039890 | Ga0075370_100398902 | 227 |
| 288 | 3300006358 | Ga0068871_100000005 | Ga0068871_10000000586 | 227 |
| 289 | 3300006844 | Ga0075428_100016057 | Ga0075428_1000160575 | 227 |
| 290 | 3300006846 | Ga0075430_100042755 | Ga0075430_1000427553 | 227 |
| 291 | 3300006881 | Ga0068865_100000316 | Ga0068865_1000003166 | 227 |
| 292 | 3300006881 | Ga0068865_100622667 | Ga0068865_1006226672 | 227 |
| 293 | 3300006914 | Ga0075436_100242621 | Ga0075436_1002426212 | 227 |
| 294 | 3300009093 | Ga0105240_10000003 | Ga0105240_100000031217 | 227 |
| 295 | 3300009093 | Ga0105240_10000004 | Ga0105240_10000004704 | 227 |
| 296 | 3300009093 | Ga0105240_10023637 | Ga0105240_100236376 | 227 |
| 297 | 3300009094 | Ga0111539_10000492 | Ga0111539_1000049250 | 227 |
| 298 | 3300009098 | Ga0105245_10000001 | Ga0105245_1000000168 | 227 |
| 299 | 3300009098 | Ga0105245_10000093 | Ga0105245_1000009356 | 227 |
| 300 | 3300009098 | Ga0105245_10035287 | Ga0105245_100352873 | 227 |
| 301 | 3300009098 | Ga0105245_10061797 | Ga0105245_100617973 | 227 |
| 302 | 3300009098 | Ga0105245_10072265 | Ga0105245_100722653 | 227 |
| 303 | 3300009098 | Ga0105245_10266082 | Ga0105245_102660822 | 227 |
| 304 | 3300009098 | Ga0105245_10340574 | Ga0105245_103405742 | 227 |
| 305 | 3300009148 | Ga0105243_10000001 | Ga0105243_1000000162 | 227 |
| 306 | 3300009148 | Ga0105243_10001490 | Ga0105243_1000149023 | 227 |
| 307 | 3300009174 | Ga0105241_10000007 | Ga0105241_1000000776 | 227 |
| 308 | 3300009174 | Ga0105241_10012054 | Ga0105241_100120546 | 227 |
| 309 | 3300009176 | Ga0105242_10000002 | Ga0105242_10000002220 | 227 |
| 310 | 3300009176 | Ga0105242_10001924 | Ga0105242_100019247 | 227 |
| 311 | 3300009176 | Ga0105242_10028406 | Ga0105242_100284064 | 227 |
| 312 | 3300009176 | Ga0105242_10114405 | Ga0105242_101144052 | 227 |
| 313 | 3300009177 | Ga0105248_10432176 | Ga0105248_104321762 | 227 |
| 314 | 3300009545 | Ga0105237_10000001 | Ga0105237_100000011136 | 227 |
| 315 | 3300009545 | Ga0105237_10010322 | Ga0105237_1001032210 | 227 |
| 316 | 3300009545 | Ga0105237_10332270 | Ga0105237_103322702 | 227 |
| 317 | 3300009551 | Ga0105238_10092416 | Ga0105238_100924163 | 227 |
| 318 | 3300009551 | Ga0105238_10283075 | Ga0105238_102830752 | 227 |
| 319 | 3300009553 | Ga0105249_10004977 | Ga0105249_1000497710 | 227 |
| 320 | 3300009553 | Ga0105249_10134697 | Ga0105249_101346973 | 227 |
| 321 | 3300009984 | Ga0105029_100172 | Ga0105029_1001724 | 227 |
| 322 | 3300010375 | Ga0105239_10020947 | Ga0105239_100209477 | 227 |
| 323 | 3300010375 | Ga0105239_10021841 | Ga0105239_100218413 | 227 |
| 324 | 3300010375 | Ga0105239_10040288 | Ga0105239_100402885 | 227 |
| 325 | 3300011119 | Ga0105246_10001734 | Ga0105246_100017347 | 227 |
| 326 | 3300011119 | Ga0105246_10006713 | Ga0105246_100067133 | 227 |
| 327 | 3300013100 | Ga0157373_10000433 | Ga0157373_1000043333 | 227 |
| 328 | 3300013100 | Ga0157373_10029275 | Ga0157373_100292754 | 227 |
| 329 | 3300013100 | Ga0157373_10229700 | Ga0157373_102297002 | 227 |
| 330 | 3300013102 | Ga0157371_10001803 | Ga0157371_100018038 | 227 |
| 331 | 3300013102 | Ga0157371_10004875 | Ga0157371_100048759 | 227 |
| 332 | 3300013104 | Ga0157370_10000924 | Ga0157370_1000092414 | 227 |
| 333 | 3300013104 | Ga0157370_10001253 | Ga0157370_1000125325 | 227 |
| 334 | 3300013104 | Ga0157370_10546709 | Ga0157370_105467092 | 227 |
| 335 | 3300013104 | Ga0157370_10599917 | Ga0157370_105999172 | 227 |
| 336 | 3300013105 | Ga0157369_10000024 | Ga0157369_1000002464 | 227 |
| 337 | 3300013105 | Ga0157369_10000104 | Ga0157369_1000010452 | 227 |
| 338 | 3300013105 | Ga0157369_10000444 | Ga0157369_1000044421 | 227 |
| 339 | 3300013105 | Ga0157369_10012770 | Ga0157369_100127705 | 227 |
| 340 | 3300013105 | Ga0157369_10539388 | Ga0157369_105393882 | 227 |
| 341 | 3300013296 | Ga0157374_10000225 | Ga0157374_1000022531 | 227 |
| 342 | 3300013296 | Ga0157374_10000501 | Ga0157374_1000050122 | 227 |
| 343 | 3300013296 | Ga0157374_10000509 | Ga0157374_100005094 | 227 |
| 344 | 3300013296 | Ga0157374_10001467 | Ga0157374_100014673 | 227 |
| 345 | 3300013296 | Ga0157374_10005951 | Ga0157374_1000595111 | 227 |
| 346 | 3300013296 | Ga0157374_10183376 | Ga0157374_101833762 | 227 |
| 347 | 3300013296 | Ga0157374_10195970 | Ga0157374_101959702 | 227 |
| 348 | 3300013296 | Ga0157374_10375658 | Ga0157374_103756582 | 227 |
| 349 | 3300013297 | Ga0157378_10220560 | Ga0157378_102205603 | 227 |
| 350 | 3300013306 | Ga0163162_10119428 | Ga0163162_101194283 | 227 |
| 351 | 3300013307 | Ga0157372_10000002 | Ga0157372_10000002681 | 227 |
| 352 | 3300014325 | Ga0163163_10008888 | Ga0163163_100088885 | 227 |
| 353 | 3300014745 | Ga0157377_10002625 | Ga0157377_100026256 | 227 |
| 354 | 3300014969 | Ga0157376_10000007 | Ga0157376_1000000779 | 227 |
| 355 | 3300025901 | Ga0207688_10172618 | Ga0207688_101726182 | 227 |
| 356 | 3300025904 | Ga0207647_10000315 | Ga0207647_1000031532 | 227 |
| 357 | 3300025909 | Ga0207705_10000010 | Ga0207705_10000010103 | 227 |
| 358 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011529 | 227 |
| 359 | 3300025909 | Ga0207705_10000065 | Ga0207705_10000065139 | 227 |
| 360 | 3300025909 | Ga0207705_10004833 | Ga0207705_100048335 | 227 |
| 361 | 3300025909 | Ga0207705_10022207 | Ga0207705_100222074 | 227 |
| 362 | 3300025909 | Ga0207705_10024571 | Ga0207705_100245713 | 227 |
| 363 | 3300025911 | Ga0207654_10000002 | Ga0207654_100000021470 | 227 |
| 364 | 3300025911 | Ga0207654_10024380 | Ga0207654_100243802 | 227 |
| 365 | 3300025911 | Ga0207654_10140097 | Ga0207654_101400972 | 227 |
| 366 | 3300025912 | Ga0207707_10005260 | Ga0207707_1000526010 | 227 |
| 367 | 3300025912 | Ga0207707_10242777 | Ga0207707_102427771 | 227 |
| 368 | 3300025913 | Ga0207695_10000005 | Ga0207695_100000051228 | 227 |
| 369 | 3300025913 | Ga0207695_10000009 | Ga0207695_100000091086 | 227 |
| 370 | 3300025913 | Ga0207695_10028809 | Ga0207695_100288093 | 227 |
| 371 | 3300025914 | Ga0207671_10000003 | Ga0207671_100000031142 | 227 |
| 372 | 3300025914 | Ga0207671_10009916 | Ga0207671_100099163 | 227 |
| 373 | 3300025918 | Ga0207662_10301310 | Ga0207662_103013101 | 227 |
| 374 | 3300025919 | Ga0207657_10001204 | Ga0207657_1000120426 | 227 |
| 375 | 3300025919 | Ga0207657_10001496 | Ga0207657_1000149621 | 227 |
| 376 | 3300025919 | Ga0207657_10008411 | Ga0207657_100084113 | 227 |
| 377 | 3300025920 | Ga0207649_10010995 | Ga0207649_100109954 | 227 |
| 378 | 3300025921 | Ga0207652_10065247 | Ga0207652_100652472 | 227 |
| 379 | 3300025921 | Ga0207652_10079483 | Ga0207652_100794832 | 227 |
| 380 | 3300025921 | Ga0207652_10218195 | Ga0207652_102181953 | 227 |
| 381 | 3300025921 | Ga0207652_10592734 | Ga0207652_105927341 | 227 |
| 382 | 3300025927 | Ga0207687_10000004 | Ga0207687_10000004199 | 227 |
| 383 | 3300025927 | Ga0207687_10000907 | Ga0207687_1000090718 | 227 |
| 384 | 3300025927 | Ga0207687_10020599 | Ga0207687_100205993 | 227 |
| 385 | 3300025927 | Ga0207687_10297871 | Ga0207687_102978712 | 227 |
| 386 | 3300025931 | Ga0207644_10172178 | Ga0207644_101721782 | 227 |
| 387 | 3300025932 | Ga0207690_10004353 | Ga0207690_100043536 | 227 |
| 388 | 3300025933 | Ga0207706_10000053 | Ga0207706_1000005377 | 227 |
| 389 | 3300025934 | Ga0207686_10000001 | Ga0207686_100000011082 | 227 |
| 390 | 3300025934 | Ga0207686_10001050 | Ga0207686_1000105012 | 227 |
| 391 | 3300025934 | Ga0207686_10209077 | Ga0207686_102090773 | 227 |
| 392 | 3300025935 | Ga0207709_10000002 | Ga0207709_100000021199 | 227 |
| 393 | 3300025935 | Ga0207709_10011294 | Ga0207709_100112945 | 227 |
| 394 | 3300025936 | Ga0207670_10676325 | Ga0207670_106763251 | 227 |
| 395 | 3300025937 | Ga0207669_10400095 | Ga0207669_104000951 | 227 |
| 396 | 3300025938 | Ga0207704_10000843 | Ga0207704_100008439 | 227 |
| 397 | 3300025940 | Ga0207691_10018821 | Ga0207691_100188213 | 227 |
| 398 | 3300025941 | Ga0207711_10377392 | Ga0207711_103773922 | 227 |
| 399 | 3300025944 | Ga0207661_10028558 | Ga0207661_100285582 | 227 |
| 400 | 3300025944 | Ga0207661_10064196 | Ga0207661_100641962 | 227 |
| 401 | 3300025944 | Ga0207661_10305996 | Ga0207661_103059962 | 227 |
| 402 | 3300025945 | Ga0207679_10000193 | Ga0207679_100001933 | 227 |
| 403 | 3300025945 | Ga0207679_10126487 | Ga0207679_101264872 | 227 |
| 404 | 3300025945 | Ga0207679_10614706 | Ga0207679_106147061 | 227 |
| 405 | 3300025949 | Ga0207667_10000008 | Ga0207667_10000008581 | 227 |
| 406 | 3300025949 | Ga0207667_10000784 | Ga0207667_1000078440 | 227 |
| 407 | 3300025949 | Ga0207667_10003751 | Ga0207667_1000375118 | 227 |
| 408 | 3300025949 | Ga0207667_10004748 | Ga0207667_1000474822 | 227 |
| 409 | 3300025949 | Ga0207667_10058970 | Ga0207667_100589704 | 227 |
| 410 | 3300025960 | Ga0207651_10004852 | Ga0207651_100048523 | 227 |
| 411 | 3300025961 | Ga0207712_10064727 | Ga0207712_100647273 | 227 |
| 412 | 3300025961 | Ga0207712_10089008 | Ga0207712_100890083 | 227 |
| 413 | 3300026067 | Ga0207678_10378798 | Ga0207678_103787982 | 227 |
| 414 | 3300026078 | Ga0207702_10000062 | Ga0207702_1000006253 | 227 |
| 415 | 3300026078 | Ga0207702_10000190 | Ga0207702_100001906 | 227 |
| 416 | 3300026078 | Ga0207702_10028752 | Ga0207702_100287524 | 227 |
| 417 | 3300026078 | Ga0207702_10633074 | Ga0207702_106330741 | 227 |
| 418 | 3300026088 | Ga0207641_10194486 | Ga0207641_101944862 | 227 |
| 419 | 3300026089 | Ga0207648_10012947 | Ga0207648_100129474 | 227 |
| 420 | 3300026116 | Ga0207674_10000001 | Ga0207674_1000000164 | 227 |
| 421 | 3300026116 | Ga0207674_10034987 | Ga0207674_100349871 | 227 |
| 422 | 3300026116 | Ga0207674_10092451 | Ga0207674_100924512 | 227 |
| 423 | 3300026116 | Ga0207674_10285130 | Ga0207674_102851302 | 227 |
| 424 | 3300026116 | Ga0207674_10339089 | Ga0207674_103390892 | 227 |
| 425 | 3300026121 | Ga0207683_10001083 | Ga0207683_1000108321 | 227 |
| 426 | 3300026121 | Ga0207683_10272951 | Ga0207683_102729512 | 227 |
| 427 | 3300026142 | Ga0207698_10080372 | Ga0207698_100803724 | 227 |
| 428 | 3300027866 | Ga0209813_10000002 | Ga0209813_10000002111 | 227 |
| 429 | 3300027907 | Ga0207428_10031187 | Ga0207428_100311872 | 227 |
| 430 | 3300028379 | Ga0268266_10004953 | Ga0268266_100049534 | 227 |
| 431 | 3300028381 | Ga0268264_10573062 | Ga0268264_105730621 | 227 |
| 432 | 3300028573 | Ga0265334_10000403 | Ga0265334_100004036 | 227 |
| 433 | 3300028800 | Ga0265338_10000323 | Ga0265338_1000032316 | 227 |
| 434 | 3300028800 | Ga0265338_10000891 | Ga0265338_1000089142 | 227 |
| 435 | 3300028800 | Ga0265338_10035468 | Ga0265338_100354682 | 227 |
| 436 | 3300028800 | Ga0265338_10115914 | Ga0265338_101159142 | 227 |
| 437 | 3300028800 | Ga0265338_10241590 | Ga0265338_102415902 | 227 |
| 438 | 3300030734 | Ga0316179_1039080 | Ga0316179_10390803 | 227 |
| 439 | 3300030742 | Ga0316183_1044371 | Ga0316183_104437110 | 227 |
| 440 | 3300030742 | Ga0316183_1116204 | Ga0316183_11162048 | 227 |
| 441 | 3300030744 | Ga0316181_1063761 | Ga0316181_106376155 | 227 |
| 442 | 3300030745 | Ga0316182_1011253 | Ga0316182_10112534 | 227 |
| 443 | 3300030745 | Ga0316182_1167866 | Ga0316182_11678663 | 227 |
| 444 | 3300030745 | Ga0316182_1313426 | Ga0316182_131342610 | 227 |
| 445 | 3300031247 | Ga0265340_10012961 | Ga0265340_100129615 | 227 |
| 446 | 3300031251 | Ga0265327_10000017 | Ga0265327_10000017447 | 227 |
| 447 | 3300031251 | Ga0265327_10003876 | Ga0265327_1000387614 | 227 |
| 448 | 3300031251 | Ga0265327_10016060 | Ga0265327_100160601 | 227 |
| 449 | 3300031730 | Ga0307516_10000003 | Ga0307516_10000003366 | 227 |
| 450 | 3300034820 | Ga0373959_0000257 | Ga0373959_0000257_6348_7040 | 227 |
| 451 | 3300037312 | Ga0395899_0012731 | Ga0395899_0012731_2379_3062 | 227 |
| 452 | 3300037312 | Ga0395899_0022434 | Ga0395899_0022434_1882_2565 | 227 |
| 453 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_776081_776764 | 227 |
| 454 | 3300037418 | Ga0395900_0015980 | Ga0395900_0015980_2460_3143 | 227 |
| 455 | 3300037418 | Ga0395900_0140243 | Ga0395900_0140243_631_1437 | 227 |
| 456 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_329242_329925 | 227 |
| 457 | 3300037466 | Ga0395898_0022091 | Ga0395898_0022091_5625_6308 | 227 |
| 458 | 3300037471 | Ga0395905_0000937 | Ga0395905_0000937_32956_33648 | 227 |
| 459 | 3300037471 | Ga0395905_0007157 | Ga0395905_0007157_4622_5305 | 227 |
| 460 | 3300037471 | Ga0395905_0674372 | Ga0395905_0674372_11_694 | 227 |
| 461 | 3300038443 | Ga0395901_0000400 | Ga0395901_0000400_26642_27325 | 227 |
| 462 | 3300038443 | Ga0395901_0008437 | Ga0395901_0008437_8598_9284 | 227 |
| 463 | 3300038443 | Ga0395901_0013122 | Ga0395901_0013122_190_873 | 227 |
| 464 | 3300038443 | Ga0395901_0323502 | Ga0395901_0323502_175_861 | 227 |
| 465 | 3300042016 | Ga0439463_015078 | Ga0439463_015078_280_963 | 227 |
| 466 | 3300042156 | Ga0439446_0000005 | Ga0439446_0000005_58503_59186 | 227 |
| 467 | 3300042435 | Ga0439434_0023735 | Ga0439434_0023735_553_1236 | 227 |
| 468 | 3300042439 | Ga0439464_0000002 | Ga0439464_0000002_18225_18908 | 227 |
| 469 | 3300042531 | Ga0450918_001467 | Ga0450918_001467_2415_3098 | 227 |
| 470 | 3300044658 | Ga0466972_0012197 | Ga0466972_0012197_2476_3159 | 227 |
| 471 | 3300044683 | Ga0466965_0000073 | Ga0466965_0000073_941_1624 | 227 |
| 472 | 3300045051 | Ga0451576_0018934 | Ga0451576_0018934_6147_6830 | 227 |
| 473 | 3300045976 | Ga0466967_0121965 | Ga0466967_0121965_1044_1727 | 227 |
| 474 | 3300045976 | Ga0466967_0595288 | Ga0466967_0595288_395_1078 | 227 |
| 475 | 3300045976 | Ga0466967_0958003 | Ga0466967_0958003_55_738 | 227 |
| 476 | 3300046459 | Ga0495629_0051043 | Ga0495629_0051043_328_1011 | 227 |
| 477 | 3300046473 | Ga0495582_0062085 | Ga0495582_0062085_744_1427 | 227 |
| 478 | 3300046557 | Ga0495622_0000051 | Ga0495622_0000051_57643_58326 | 227 |
| 479 | 3300046674 | Ga0495588_0000173 | Ga0495588_0000173_77927_78610 | 227 |
| 480 | 3300046683 | Ga0495658_0011473 | Ga0495658_0011473_2718_3401 | 227 |
| 481 | 3300046692 | Ga0495671_0148775 | Ga0495671_0148775_254_937 | 227 |
| 482 | 3300046809 | Ga0495600_0060789 | Ga0495600_0060789_723_1406 | 227 |
| 483 | 3300046810 | Ga0495660_0000035 | Ga0495660_0000035_72926_73609 | 227 |
| 484 | 3300046810 | Ga0495660_0028356 | Ga0495660_0028356_1410_2096 | 227 |
| 485 | 3300048903 | Ga0496100_0028735 | Ga0496100_0028735_1387_2073 | 227 |
| 486 | 3300048915 | Ga0496112_0037761 | Ga0496112_0037761_3944_4630 | 227 |
| 487 | 3300048929 | Ga0496126_0097051 | Ga0496126_0097051_1811_2494 | 227 |
| 488 | 3300049568 | Ga0501031_0001257 | Ga0501031_0001257_3161_3844 | 227 |
| 489 | 3300049569 | Ga0501032_0001296 | Ga0501032_0001296_3896_4579 | 227 |
| 490 | 3300049570 | Ga0501033_0052542 | Ga0501033_0052542_2281_2973 | 227 |
| 491 | 3300049570 | Ga0501033_0281110 | Ga0501033_0281110_267_959 | 227 |
| 492 | 3300049571 | Ga0501034_0000333 | Ga0501034_0000333_26227_26910 | 227 |
| 493 | 3300049571 | Ga0501034_0001363 | Ga0501034_0001363_9572_10264 | 227 |
| 494 | 3300049571 | Ga0501034_0015860 | Ga0501034_0015860_6396_7082 | 227 |
| 495 | 3300049571 | Ga0501034_0054932 | Ga0501034_0054932_974_1657 | 227 |
| 496 | 3300049572 | Ga0501036_0013424 | Ga0501036_0013424_2582_3265 | 227 |
| 497 | 3300049573 | Ga0501037_0000001 | Ga0501037_0000001_577736_578419 | 227 |
| 498 | 3300049573 | Ga0501037_0000141 | Ga0501037_0000141_23383_24066 | 227 |
| 499 | 3300049574 | Ga0501038_0034445 | Ga0501038_0034445_1079_1762 | 227 |
| 500 | 3300049574 | Ga0501038_0044082 | Ga0501038_0044082_2504_3187 | 227 |
| 501 | 3300049576 | Ga0501040_0185357 | Ga0501040_0185357_10_693 | 227 |
| 502 | 3300049578 | Ga0501042_0096853 | Ga0501042_0096853_457_1140 | 227 |
| 503 | 3300049579 | Ga0501043_0000145 | Ga0501043_0000145_40830_41513 | 227 |
| 504 | 3300049580 | Ga0501046_0000065 | Ga0501046_0000065_95858_96541 | 227 |
| 505 | 3300049581 | Ga0501047_0000119 | Ga0501047_0000119_31897_32589 | 227 |
| 506 | 3300049581 | Ga0501047_0000375 | Ga0501047_0000375_36696_37379 | 227 |
| 507 | 3300049582 | Ga0501048_0000133 | Ga0501048_0000133_27785_28468 | 227 |
| 508 | 3300049582 | Ga0501048_0073309 | Ga0501048_0073309_425_1117 | 227 |
| 509 | 3300049586 | Ga0501070_0026381 | Ga0501070_0026381_3863_4546 | 227 |
| 510 | 3300049586 | Ga0501070_0306841 | Ga0501070_0306841_290_973 | 227 |
| 511 | 3300049589 | Ga0501073_0188936 | Ga0501073_0188936_490_1179 | 227 |
| 512 | 3300049742 | Ga0501080_0000893 | Ga0501080_0000893_12396_13079 | 227 |
| 513 | 3300049744 | Ga0501083_0017659 | Ga0501083_0017659_657_1358 | 227 |
| 514 | 3300049744 | Ga0501083_0248465 | Ga0501083_0248465_38_730 | 227 |
| 515 | 3300049822 | Ga0501035_0000211 | Ga0501035_0000211_63476_64168 | 227 |
| 516 | 3300049822 | Ga0501035_0004250 | Ga0501035_0004250_479_1162 | 227 |
| 517 | 3300049823 | Ga0501044_0046803 | Ga0501044_0046803_3147_3830 | 227 |
| 518 | 3300050489 | nmdc:mga03683_724_c1 | nmdc:mga03683_724_c1_4686_5369 | 227 |
| 519 | 3300050490 | nmdc:mga03n38_33_c1 | nmdc:mga03n38_33_c1_26723_27406 | 227 |
| 520 | 3300050491 | nmdc:mga00v17_14983_c1 | nmdc:mga00v17_14983_c1_3303_3986 | 227 |
| 521 | 3300050491 | nmdc:mga00v17_25497_c1 | nmdc:mga00v17_25497_c1_1713_2396 | 227 |
| 522 | 3300050491 | nmdc:mga00v17_67780_c1 | nmdc:mga00v17_67780_c1_1499_2182 | 227 |
| 523 | 3300050492 | nmdc:mga0yw44_13_c1 | nmdc:mga0yw44_13_c1_33427_34110 | 227 |
| 524 | 3300050492 | nmdc:mga0yw44_31633_c1 | nmdc:mga0yw44_31633_c1_720_1403 | 227 |
| 525 | 3300050492 | nmdc:mga0yw44_92574_c1 | nmdc:mga0yw44_92574_c1_218_901 | 227 |
| 526 | 3300050493 | nmdc:mga0k408_113_c1 | nmdc:mga0k408_113_c1_19989_20672 | 227 |
| 527 | 3300050493 | nmdc:mga0k408_15872_c1 | nmdc:mga0k408_15872_c1_1096_1779 | 227 |
| 528 | 3300050493 | nmdc:mga0k408_179_c1 | nmdc:mga0k408_179_c1_19247_19930 | 227 |
| 529 | 3300050493 | nmdc:mga0k408_1961_c2 | nmdc:mga0k408_1961_c2_7468_8151 | 227 |
| 530 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_1012993_1013676 | 227 |
| 531 | 3300050493 | nmdc:mga0k408_2493_c1 | nmdc:mga0k408_2493_c1_6554_7240 | 227 |
| 532 | 3300050493 | nmdc:mga0k408_3268_c1 | nmdc:mga0k408_3268_c1_4070_4762 | 227 |
| 533 | 3300050494 | nmdc:mga06z11_224699_c1 | nmdc:mga06z11_224699_c1_19_702 | 227 |
| 534 | 3300050494 | nmdc:mga06z11_31_c1 | nmdc:mga06z11_31_c1_48715_49398 | 227 |
| 535 | 3300050494 | nmdc:mga06z11_74_c1 | nmdc:mga06z11_74_c1_18172_18858 | 227 |
| 536 | 3300050495 | nmdc:mga04h51_2_c1 | nmdc:mga04h51_2_c1_113848_114531 | 227 |
| 537 | 3300050496 | nmdc:mga07m45_39184_c1 | nmdc:mga07m45_39184_c1_204_887 | 227 |
| 538 | 3300050496 | nmdc:mga07m45_729_c1 | nmdc:mga07m45_729_c1_5866_6549 | 227 |
| 539 | 3300050496 | nmdc:mga07m45_7506_c1 | nmdc:mga07m45_7506_c1_4811_5494 | 227 |
| 540 | 3300050496 | nmdc:mga07m45_827_c1 | nmdc:mga07m45_827_c1_4739_5422 | 227 |
| 541 | 3300050509 | nmdc:mga0qj67_13114_c1 | nmdc:mga0qj67_13114_c1_2237_2920 | 227 |
| 542 | 3300050511 | nmdc:mga08y16_2629_c1 | nmdc:mga08y16_2629_c1_14757_15440 | 227 |
| 543 | 3300050514 | nmdc:mga08x19_215015_c1 | nmdc:mga08x19_215015_c1_293_976 | 227 |
| 544 | 3300050516 | nmdc:mga0sz30_12962_c1 | nmdc:mga0sz30_12962_c1_2066_2749 | 227 |
| 545 | 3300050516 | nmdc:mga0sz30_139004_c1 | nmdc:mga0sz30_139004_c1_293_976 | 227 |
| 546 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_743103_743786 | 227 |
| 547 | 3300050516 | nmdc:mga0sz30_4_c1 | nmdc:mga0sz30_4_c1_73657_74340 | 227 |
| 548 | 3300050516 | nmdc:mga0sz30_80399_c1 | nmdc:mga0sz30_80399_c1_371_1054 | 227 |
| 549 | 3300053079 | Ga0500610_0000002 | Ga0500610_0000002_61370_62053 | 227 |
| 550 | 3300053087 | Ga0500643_002124 | Ga0500643_002124_8943_9626 | 227 |
| 551 | 3300053087 | Ga0500643_022263 | Ga0500643_022263_150_833 | 227 |
| 552 | 3300053088 | Ga0500644_0000198 | Ga0500644_0000198_20453_21136 | 227 |
| 553 | 3300053088 | Ga0500644_0001954 | Ga0500644_0001954_1253_1936 | 227 |
| 554 | 3300053088 | Ga0500644_0021864 | Ga0500644_0021864_801_1484 | 227 |
| 555 | 3300053090 | Ga0500646_0000048 | Ga0500646_0000048_27881_28585 | 227 |
| 556 | 3300053092 | Ga0500583_0000057 | Ga0500583_0000057_49820_50503 | 227 |
| 557 | 3300053092 | Ga0500583_0004917 | Ga0500583_0004917_1123_1827 | 227 |
| 558 | 3300053093 | Ga0500651_0000019 | Ga0500651_0000019_66425_67108 | 227 |
| 559 | 3300053093 | Ga0500651_0000051 | Ga0500651_0000051_4793_5479 | 227 |
| 560 | 3300053093 | Ga0500651_0002735 | Ga0500651_0002735_7669_8355 | 227 |
| 561 | 3300053093 | Ga0500651_0122821 | Ga0500651_0122821_201_905 | 227 |
| 562 | 3300053094 | Ga0500566_0000001 | Ga0500566_0000001_989666_990349 | 227 |
| 563 | 3300053098 | Ga0500650_0000003 | Ga0500650_0000003_966_1670 | 227 |
| 564 | 3300053098 | Ga0500650_0012261 | Ga0500650_0012261_467_1150 | 227 |
| 565 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_1231250_1231936 | 227 |
| 566 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_100507_101190 | 227 |
| 567 | 3300053108 | Ga0500562_000001 | Ga0500562_000001_616602_617288 | 227 |
| 568 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_136825_137508 | 227 |
| 569 | 3300053108 | Ga0500562_012684 | Ga0500562_012684_445_1149 | 227 |
| 570 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_303128_303832 | 227 |
| 571 | 3300053118 | Ga0500594_0000034 | Ga0500594_0000034_39916_40599 | 227 |
| 572 | 3300053118 | Ga0500594_0000258 | Ga0500594_0000258_7420_8103 | 227 |
| 573 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_1153407_1154090 | 227 |
| 574 | 3300053126 | Ga0500621_000694 | Ga0500621_000694_2459_3142 | 227 |
| 575 | 3300053129 | Ga0500628_000009 | Ga0500628_000009_57770_58453 | 227 |
| 576 | 3300053129 | Ga0500628_031681 | Ga0500628_031681_385_1068 | 227 |
| 577 | 3300053131 | Ga0500652_000695 | Ga0500652_000695_4432_5115 | 227 |
| 578 | 3300053133 | Ga0500655_000327 | Ga0500655_000327_8796_9500 | 227 |
| 579 | 3300053136 | Ga0500559_0009237 | Ga0500559_0009237_2689_3372 | 227 |
| 580 | 3300053137 | Ga0500561_0000001 | Ga0500561_0000001_98958_99641 | 227 |
| 581 | 3300053142 | Ga0500577_0000357 | Ga0500577_0000357_2596_3279 | 227 |
| 582 | 3300053142 | Ga0500577_0082762 | Ga0500577_0082762_212_928 | 227 |
| 583 | 3300053143 | Ga0500579_006408 | Ga0500579_006408_3533_4237 | 227 |
| 584 | 3300053147 | Ga0500589_000002 | Ga0500589_000002_122507_123190 | 227 |
| 585 | 3300053150 | Ga0500603_013046 | Ga0500603_013046_203_886 | 227 |
| 586 | 3300053151 | Ga0500604_0032448 | Ga0500604_0032448_156_839 | 227 |
| 587 | 3300053160 | Ga0500633_0016280 | Ga0500633_0016280_745_1449 | 227 |
| 588 | 3300053722 | Ga0500649_000002 | Ga0500649_000002_36104_36787 | 227 |
| 589 | 3300053727 | Ga0500611_003354 | Ga0500611_003354_921_1604 | 227 |
| 590 | 3300060353 | Ga0501082_0051798 | Ga0501082_0051798_2749_3432 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9833 | 2 | 227 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9798 | 2 | 227 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9705 | 2 | 227 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9671 | 2 | 227 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.96 | 2 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05779_1_226_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9834 | 1 | 225 | 3.40.50.300 |
| af_O05779_1_226_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9748 | 1 | 225 | 3.40.50.300 |
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.951 | 2 | 222 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9499 | 2 | 221 | 3.40.50.300 |
| af_P0A9R7_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9447 | 1 | 216 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A087A2T3-F1-model_v4 | Cell division ATP-binding protein FtsE | 0.9861 | 2 | 226 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0051301 |
| AF-A0A6J6SH26-F1-model_v4 | Cell division ATP-binding protein FtsE | 0.9855 | 1 | 227 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0051301 |
| AF-A0A249L385-F1-model_v4 | Cell division ATP-binding protein FtsE | 0.9842 | 1 | 227 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0051301 |
| AF-A0A6J6SH26-F1-model_v4 | Cell division ATP-binding protein FtsE | 0.9812 | 1 | 227 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0051301 |
| AF-A0A2I1LMG1-F1-model_v4 | deleted | 0.9811 | 1 | 226 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar