F466963

General Info

Members Datasets Scaffolds Average Seq Length
590 266 590 229

Family's Representative Sequence

Representative Sequence 3300009993|Ga0105028_101012|Ga0105028_1010124
Length 222
Sequence MILLDRVTKTYGRVATPALDRISLHVEPKEFVIVVGQSGAGKSTLLKLLTREERPSTGKIIVGGIDYDKLKDRDIPLLRRKIGVVFQDFKLLPNRTVFENVSFALEIVGMGNREIRHTVPKLKGKEKRMPLELSGGERQRVAIARAIVRQPKILIADEPTGNLDPKHAWDVISVLEKINRYGTTVLLTTHNQEIVNKLKRRVVTIQHGQIASDRAGASYKVV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
80 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
152 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
153 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
154 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
236 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
246 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
247 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
248 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
249 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
252 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
257 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
258 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
259 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
262 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
263 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
264 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.46
Nodule 0
Rhizoplane 0.51
Rhizosphere 81.02
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1328258 2162886007 Bacteria 2061
2 JGI24736J21556_1018298 3300001904 Bacteria 1109
3 JGI24741J21665_1000674 3300001915 Bacteria 10264
4 JGI24741J21665_1002268 3300001915 Bacteria 5068
5 JGI24740J21852_10006266 3300001979 Bacteria 4943
6 JGI24740J21852_10037935 3300001979 Bacteria 1483
7 JGI24739J22299_10005648 3300001989 Bacteria 4740
8 JGI24737J22298_10000002 3300001990 Bacteria 76949
9 JGI24743J22301_10008310 3300001991 Bacteria 1819
10 JGI24735J21928_10000026 3300002067 Bacteria 88519
11 JGI24735J21928_10000042 3300002067 Bacteria 58971
12 JGI24735J21928_10000107 3300002067 Bacteria 30612
13 JGI24738J21930_10016672 3300002075 Bacteria 1549
14 rootH2_10078746 3300003320 Bacteria 3138
15 rootH1_10034957 3300003323 Bacteria 1611
16 rootH1_10121568 3300003323 Bacteria 4153
17 Ga0065704_10101481 3300005289 Bacteria 2236
18 Ga0070658_10000035 3300005327 Bacteria 145828
19 Ga0070658_10002131 3300005327 Bacteria 16615
20 Ga0070658_10005656 3300005327 Bacteria 10134
21 Ga0070658_10010220 3300005327 Bacteria 7526
22 Ga0070658_10175623 3300005327 Bacteria 1801
23 Ga0070676_10014686 3300005328 Bacteria 4307
24 Ga0070676_10145950 3300005328 Bacteria 1510
25 Ga0070683_100000130 3300005329 Bacteria 48482
26 Ga0070683_100211638 3300005329 Bacteria 1842
27 Ga0070683_100665668 3300005329 Bacteria 997
28 Ga0070690_100003312 3300005330 Bacteria 8790
29 Ga0070666_10096277 3300005335 Bacteria 2037
30 Ga0070680_100109873 3300005336 Bacteria 2295
31 Ga0070680_100398379 3300005336 Bacteria 1173
32 Ga0070680_100489041 3300005336 Bacteria 1052
33 Ga0070682_100005661 3300005337 Bacteria 6967
34 Ga0070682_100229875 3300005337 Bacteria 1325
35 Ga0070660_100000099 3300005339 Bacteria 52371
36 Ga0070660_100002635 3300005339 Bacteria 12338
37 Ga0070660_100049994 3300005339 Bacteria 3216
38 Ga0070691_10091496 3300005341 Bacteria 1500
39 Ga0070687_100295550 3300005343 Bacteria 1025
40 Ga0070661_100014870 3300005344 Bacteria 5490
41 Ga0070661_100019512 3300005344 Bacteria 4832
42 Ga0070661_100169657 3300005344 Bacteria 1656
43 Ga0070668_100099717 3300005347 Bacteria 2300
44 Ga0070669_100083495 3300005353 Bacteria 2382
45 Ga0070671_100000001 3300005355 Bacteria 1228151
46 Ga0070671_100313225 3300005355 Bacteria 1337
47 Ga0070674_100003164 3300005356 Bacteria 9175
48 Ga0070673_100008713 3300005364 Bacteria 6767
49 Ga0070659_100000797 3300005366 Bacteria 22983
50 Ga0070659_100007446 3300005366 Bacteria 7955
51 Ga0070659_100019205 3300005366 Bacteria 5174
52 Ga0070659_100201846 3300005366 Bacteria 1637
53 Ga0070667_100000001 3300005367 Bacteria 1108638
54 Ga0070667_100072118 3300005367 Bacteria 2942
55 Ga0070714_100001085 3300005435 Bacteria 19461
56 Ga0070708_100023930 3300005445 Bacteria 5199
57 Ga0070663_100355392 3300005455 Bacteria 1187
58 Ga0070678_100000867 3300005456 Bacteria 15459
59 Ga0070678_100086943 3300005456 Bacteria 2386
60 Ga0070662_100022040 3300005457 Bacteria 4356
61 Ga0070681_10003503 3300005458 Bacteria 14697
62 Ga0070681_10513697 3300005458 Bacteria 1111
63 Ga0070685_10002389 3300005466 Bacteria 9659
64 Ga0070685_10007413 3300005466 Bacteria 5613
65 Ga0070679_100000219 3300005530 Bacteria 46654
66 Ga0070679_100127789 3300005530 Bacteria 2523
67 Ga0070679_100199551 3300005530 Bacteria 1967
68 Ga0070679_100278535 3300005530 Bacteria 1625
69 Ga0070679_100378726 3300005530 Bacteria 1362
70 Ga0070684_100000623 3300005535 Bacteria 24450
71 Ga0070684_100081415 3300005535 Bacteria 2865
72 Ga0070684_100093331 3300005535 Bacteria 2679
73 Ga0070684_100207661 3300005535 Bacteria 1785
74 Ga0068853_100017986 3300005539 Bacteria 5842
75 Ga0068853_100491870 3300005539 Bacteria 1157
76 Ga0070672_100057775 3300005543 Bacteria 3047
77 Ga0070686_100038924 3300005544 Bacteria 2960
78 Ga0068855_100000003 3300005563 Bacteria 589862
79 Ga0068855_100001636 3300005563 Bacteria 28089
80 Ga0068855_100002650 3300005563 Bacteria 22058
81 Ga0068855_100003265 3300005563 Bacteria 19847
82 Ga0068855_100050197 3300005563 Bacteria 4918
83 Ga0068855_100070845 3300005563 Bacteria 4055
84 Ga0068855_100072054 3300005563 Bacteria 4016
85 Ga0068855_100329981 3300005563 Bacteria 1684
86 Ga0068855_100429492 3300005563 Bacteria 1444
87 Ga0070664_100001018 3300005564 Bacteria 22010
88 Ga0068857_100000040 3300005577 Bacteria 70513
89 Ga0068857_100014858 3300005577 Bacteria 6790
90 Ga0068857_100021612 3300005577 Bacteria 5662
91 Ga0068857_100023099 3300005577 Bacteria 5470
92 Ga0068857_100066918 3300005577 Bacteria 3197
93 Ga0068857_100097858 3300005577 Bacteria 2631
94 Ga0068857_100100416 3300005577 Bacteria 2596
95 Ga0068857_100119870 3300005577 Bacteria 2368
96 Ga0068857_100313187 3300005577 Bacteria 1448
97 Ga0068854_100245788 3300005578 Bacteria 1427
98 Ga0068856_100000001 3300005614 Bacteria 565602
99 Ga0068856_100000354 3300005614 Bacteria 50023
100 Ga0068856_100040232 3300005614 Bacteria 4591
101 Ga0068856_100237680 3300005614 Bacteria 1837
102 Ga0068856_100485696 3300005614 Bacteria 1256
103 Ga0068856_100679211 3300005614 Bacteria 1050
104 Ga0068852_100133713 3300005616 Bacteria 2287
105 Ga0068852_100530766 3300005616 Bacteria 1175
106 Ga0068859_100101592 3300005617 Bacteria 2933
107 Ga0068859_101492012 3300005617 Bacteria 746
108 Ga0068863_100248954 3300005841 Bacteria 1716
109 Ga0068863_100629240 3300005841 Bacteria 1063
110 Ga0068860_100007462 3300005843 Bacteria 10936
111 Ga0068860_100024465 3300005843 Bacteria 5834
112 Ga0068860_100167299 3300005843 Bacteria 2123
113 Ga0068860_100500189 3300005843 Bacteria 1213
114 Ga0068860_100677181 3300005843 Bacteria 1040
115 Ga0081539_10001122 3300005985 Bacteria 48598
116 Ga0075365_10000021 3300006038 Bacteria 64483
117 Ga0075365_10022683 3300006038 Bacteria 3937
118 Ga0075365_10111393 3300006038 Bacteria 1881
119 Ga0075365_10218429 3300006038 Bacteria 1337
120 Ga0075368_10000062 3300006042 Bacteria 25855
121 Ga0075363_100000019 3300006048 Bacteria 34359
122 Ga0075364_10013648 3300006051 Bacteria 5001
123 Ga0075364_10031430 3300006051 Bacteria 3411
124 Ga0075367_10000012 3300006178 Bacteria 42001
125 Ga0075367_10003115 3300006178 Bacteria 7802
126 Ga0075367_10061567 3300006178 Bacteria 2240
127 Ga0075369_10000012 3300006186 Bacteria 74833
128 Ga0075369_10016321 3300006186 Bacteria 2995
129 Ga0075369_10148160 3300006186 Bacteria 1072
130 Ga0075366_10000011 3300006195 Bacteria 79037
131 Ga0075366_10000134 3300006195 Bacteria 30925
132 Ga0075366_10000959 3300006195 Bacteria 14075
133 Ga0075366_10002255 3300006195 Bacteria 9851
134 Ga0075366_10003146 3300006195 Bacteria 8640
135 Ga0097621_100000001 3300006237 Bacteria 632268
136 Ga0097621_100331720 3300006237 Bacteria 1349
137 Ga0097621_100984273 3300006237 Bacteria 788
138 Ga0075370_10000866 3300006353 Bacteria 12318
139 Ga0075370_10007565 3300006353 Bacteria 5539
140 Ga0075370_10008017 3300006353 Bacteria 5415
141 Ga0075370_10039890 3300006353 Bacteria 2647
142 Ga0068871_100000005 3300006358 Bacteria 123210
143 Ga0068871_100086325 3300006358 Bacteria 2607
144 Ga0075428_100016057 3300006844 Bacteria 8280
145 Ga0075430_100042755 3300006846 Bacteria 3831
146 Ga0068865_100000316 3300006881 Bacteria 26705
147 Ga0068865_100622667 3300006881 Bacteria 914
148 Ga0075436_100242621 3300006914 Bacteria 1282
149 Ga0097620_100101590 3300006931 Bacteria 2933
150 Ga0097620_101492097 3300006931 Bacteria 746
151 Ga0105240_10000003 3300009093 Bacteria 1183681
152 Ga0105240_10000004 3300009093 Bacteria 708156
153 Ga0105240_10023637 3300009093 Bacteria 8119
154 Ga0105240_10123197 3300009093 Bacteria 3119
155 Ga0105240_10427476 3300009093 Bacteria 1487
156 Ga0105240_10590074 3300009093 Bacteria 1224
157 Ga0105240_10741750 3300009093 Bacteria 1068
158 Ga0111539_10000492 3300009094 Bacteria 50138
159 Ga0105245_10000001 3300009098 Bacteria 939270
160 Ga0105245_10000093 3300009098 Bacteria 86866
161 Ga0105245_10006458 3300009098 Bacteria 10315
162 Ga0105245_10035287 3300009098 Bacteria 4438
163 Ga0105245_10061797 3300009098 Bacteria 3378
164 Ga0105245_10072265 3300009098 Bacteria 3133
165 Ga0105245_10266082 3300009098 Bacteria 1670
166 Ga0105245_10340574 3300009098 Bacteria 1483
167 Ga0105245_10959572 3300009098 Bacteria 898
168 Ga0105247_10280856 3300009101 Bacteria 1149
169 Ga0105247_10287203 3300009101 Unclassified 1137
170 Ga0105243_10000001 3300009148 Bacteria 1156578
171 Ga0105243_10001490 3300009148 Bacteria 20502
172 Ga0105241_10000007 3300009174 Bacteria 343524
173 Ga0105241_10012054 3300009174 Bacteria 6349
174 Ga0105241_10036701 3300009174 Bacteria 3689
175 Ga0105242_10000002 3300009176 Bacteria 262559
176 Ga0105242_10001924 3300009176 Bacteria 16329
177 Ga0105242_10028406 3300009176 Bacteria 4453
178 Ga0105242_10114405 3300009176 Bacteria 2305
179 Ga0105248_10432176 3300009177 Bacteria 1483
180 Ga0105237_10000001 3300009545 Bacteria 1009213
181 Ga0105237_10010322 3300009545 Bacteria 9950
182 Ga0105237_10332270 3300009545 Bacteria 1524
183 Ga0105238_10092416 3300009551 Bacteria 3013
184 Ga0105238_10283075 3300009551 Bacteria 1639
185 Ga0105249_10004977 3300009553 Bacteria 11464
186 Ga0105249_10134697 3300009553 Bacteria 2362
187 Ga0105029_100172 3300009984 Bacteria 3263
188 Ga0105028_101012 3300009993 Bacteria 2960
189 Ga0105239_10020947 3300010375 Bacteria 7213
190 Ga0105239_10021841 3300010375 Bacteria 7055
191 Ga0105239_10040288 3300010375 Bacteria 5118
192 Ga0105246_10001734 3300011119 Bacteria 13031
193 Ga0105246_10006713 3300011119 Bacteria 7037
194 Ga0157373_10000433 3300013100 Bacteria 33251
195 Ga0157373_10029275 3300013100 Bacteria 3968
196 Ga0157373_10229700 3300013100 Bacteria 1310
197 Ga0157371_10001803 3300013102 Bacteria 21647
198 Ga0157371_10004875 3300013102 Bacteria 11537
199 Ga0157370_10000924 3300013104 Bacteria 37267
200 Ga0157370_10001253 3300013104 Bacteria 31691
201 Ga0157370_10546709 3300013104 Bacteria 1062
202 Ga0157370_10599917 3300013104 Bacteria 1008
203 Ga0157369_10000024 3300013105 Bacteria 225851
204 Ga0157369_10000104 3300013105 Bacteria 118133
205 Ga0157369_10000444 3300013105 Bacteria 54827
206 Ga0157369_10012770 3300013105 Bacteria 9524
207 Ga0157369_10050340 3300013105 Bacteria 4512
208 Ga0157369_10539388 3300013105 Bacteria 1206
209 Ga0157374_10000225 3300013296 Bacteria 52365
210 Ga0157374_10000501 3300013296 Bacteria 35418
211 Ga0157374_10000509 3300013296 Bacteria 35015
212 Ga0157374_10001467 3300013296 Bacteria 19900
213 Ga0157374_10005951 3300013296 Bacteria 10312
214 Ga0157374_10183376 3300013296 Bacteria 2046
215 Ga0157374_10195970 3300013296 Bacteria 1977
216 Ga0157374_10375658 3300013296 Unclassified 1415
217 Ga0157378_10220560 3300013297 Bacteria 1802
218 Ga0163162_10119428 3300013306 Bacteria 2739
219 Ga0157372_10000002 3300013307 Bacteria 687862
220 Ga0157372_10000553 3300013307 Bacteria 41144
221 Ga0157372_10104511 3300013307 Bacteria 3238
222 Ga0163163_10008888 3300014325 Bacteria 8946
223 Ga0157377_10002625 3300014745 Bacteria 7976
224 Ga0157376_10000007 3300014969 Bacteria 368004
225 Ga0207710_10151988 3300025900 Unclassified 1123
226 Ga0207688_10172618 3300025901 Bacteria 1286
227 Ga0207680_10177620 3300025903 Bacteria 1438
228 Ga0207647_10000315 3300025904 Bacteria 40274
229 Ga0207647_10001817 3300025904 Bacteria 16373
230 Ga0207705_10000010 3300025909 Bacteria 518023
231 Ga0207705_10000011 3300025909 Bacteria 517768
232 Ga0207705_10000065 3300025909 Bacteria 137123
233 Ga0207705_10004833 3300025909 Bacteria 10139
234 Ga0207705_10022207 3300025909 Bacteria 4527
235 Ga0207705_10024571 3300025909 Bacteria 4299
236 Ga0207654_10000002 3300025911 Bacteria 1460142
237 Ga0207654_10024380 3300025911 Bacteria 3251
238 Ga0207654_10140097 3300025911 Bacteria 1541
239 Ga0207707_10005260 3300025912 Bacteria 11333
240 Ga0207707_10009816 3300025912 Bacteria 8302
241 Ga0207707_10242777 3300025912 Bacteria 1566
242 Ga0207695_10000005 3300025913 Bacteria 1196715
243 Ga0207695_10000009 3300025913 Bacteria 1034276
244 Ga0207695_10028809 3300025913 Bacteria 6148
245 Ga0207695_10313927 3300025913 Bacteria 1457
246 Ga0207695_10420121 3300025913 Bacteria 1221
247 Ga0207671_10000003 3300025914 Bacteria 1065461
248 Ga0207671_10009916 3300025914 Bacteria 7917
249 Ga0207660_10153362 3300025917 Bacteria 1772
250 Ga0207662_10301310 3300025918 Bacteria 1066
251 Ga0207657_10001204 3300025919 Bacteria 27540
252 Ga0207657_10001496 3300025919 Bacteria 24997
253 Ga0207657_10008411 3300025919 Bacteria 10475
254 Ga0207657_10070357 3300025919 Bacteria 2966
255 Ga0207649_10010995 3300025920 Bacteria 4978
256 Ga0207649_10028172 3300025920 Bacteria 3305
257 Ga0207652_10001284 3300025921 Bacteria 22377
258 Ga0207652_10065247 3300025921 Bacteria 3152
259 Ga0207652_10079483 3300025921 Bacteria 2865
260 Ga0207652_10218195 3300025921 Bacteria 1718
261 Ga0207652_10261285 3300025921 Bacteria 1562
262 Ga0207652_10269506 3300025921 Bacteria 1536
263 Ga0207652_10592734 3300025921 Bacteria 994
264 Ga0207681_10140070 3300025923 Bacteria 1800
265 Ga0207687_10000004 3300025927 Bacteria 841177
266 Ga0207687_10000907 3300025927 Bacteria 20171
267 Ga0207687_10010247 3300025927 Bacteria 6123
268 Ga0207687_10020599 3300025927 Bacteria 4376
269 Ga0207687_10297871 3300025927 Bacteria 1298
270 Ga0207700_10239546 3300025928 Bacteria 1546
271 Ga0207664_10001077 3300025929 Bacteria 18198
272 Ga0207644_10000001 3300025931 Bacteria 1243214
273 Ga0207644_10008039 3300025931 Bacteria 6901
274 Ga0207644_10172178 3300025931 Bacteria 1691
275 Ga0207690_10004353 3300025932 Bacteria 8359
276 Ga0207690_10689037 3300025932 Bacteria 839
277 Ga0207706_10000053 3300025933 Bacteria 114286
278 Ga0207686_10000001 3300025934 Bacteria 1169580
279 Ga0207686_10001050 3300025934 Bacteria 16339
280 Ga0207686_10209077 3300025934 Bacteria 1402
281 Ga0207709_10000002 3300025935 Bacteria 1171536
282 Ga0207709_10011294 3300025935 Bacteria 4926
283 Ga0207670_10676325 3300025936 Bacteria 853
284 Ga0207669_10400095 3300025937 Bacteria 1075
285 Ga0207704_10000843 3300025938 Bacteria 13602
286 Ga0207691_10018821 3300025940 Bacteria 6541
287 Ga0207711_10377392 3300025941 Bacteria 1315
288 Ga0207661_10000118 3300025944 Bacteria 50730
289 Ga0207661_10028558 3300025944 Bacteria 4273
290 Ga0207661_10064196 3300025944 Bacteria 2976
291 Ga0207661_10305996 3300025944 Bacteria 1426
292 Ga0207679_10000193 3300025945 Bacteria 49103
293 Ga0207679_10126487 3300025945 Bacteria 2043
294 Ga0207679_10614706 3300025945 Bacteria 980
295 Ga0207667_10000008 3300025949 Bacteria 625138
296 Ga0207667_10000784 3300025949 Bacteria 41252
297 Ga0207667_10003751 3300025949 Bacteria 18715
298 Ga0207667_10004748 3300025949 Bacteria 16618
299 Ga0207667_10014120 3300025949 Bacteria 9116
300 Ga0207667_10037504 3300025949 Bacteria 5180
301 Ga0207667_10058970 3300025949 Bacteria 4023
302 Ga0207667_10170880 3300025949 Bacteria 2234
303 Ga0207667_10532935 3300025949 Bacteria 1189
304 Ga0207667_10580571 3300025949 Bacteria 1132
305 Ga0207667_10654553 3300025949 Bacteria 1056
306 Ga0207651_10004852 3300025960 Bacteria 6848
307 Ga0207712_10064727 3300025961 Bacteria 2608
308 Ga0207712_10089008 3300025961 Bacteria 2268
309 Ga0207640_10081458 3300025981 Bacteria 2213
310 Ga0207658_10000003 3300025986 Bacteria 1151934
311 Ga0207658_10021047 3300025986 Bacteria 4522
312 Ga0207639_10028883 3300026041 Bacteria 4054
313 Ga0207678_10378798 3300026067 Unclassified 1223
314 Ga0207702_10000062 3300026078 Bacteria 124850
315 Ga0207702_10000190 3300026078 Bacteria 73848
316 Ga0207702_10028752 3300026078 Bacteria 4623
317 Ga0207702_10633074 3300026078 Bacteria 1051
318 Ga0207641_10020510 3300026088 Bacteria 5429
319 Ga0207641_10194486 3300026088 Bacteria 1866
320 Ga0207641_10583998 3300026088 Bacteria 1092
321 Ga0207648_10012947 3300026089 Bacteria 7791
322 Ga0207674_10000001 3300026116 Bacteria 616581
323 Ga0207674_10003329 3300026116 Bacteria 19756
324 Ga0207674_10034987 3300026116 Bacteria 5245
325 Ga0207674_10092451 3300026116 Bacteria 3015
326 Ga0207674_10131856 3300026116 Bacteria 2462
327 Ga0207674_10285130 3300026116 Bacteria 1600
328 Ga0207674_10339089 3300026116 Bacteria 1453
329 Ga0207683_10001083 3300026121 Bacteria 24823
330 Ga0207683_10272951 3300026121 Bacteria 1545
331 Ga0207698_10025132 3300026142 Bacteria 4190
332 Ga0207698_10080372 3300026142 Bacteria 2626
333 Ga0207698_10934730 3300026142 Bacteria 876
334 Ga0209813_10000002 3300027866 Bacteria 215993
335 Ga0207428_10031187 3300027907 Bacteria 4402
336 Ga0268266_10004953 3300028379 Bacteria 12601
337 Ga0268264_10033265 3300028381 Bacteria 4234
338 Ga0268264_10041097 3300028381 Bacteria 3823
339 Ga0268264_10573062 3300028381 Bacteria 1110
340 Ga0265337_1000080 3300028556 Bacteria 45887
341 Ga0265337_1000451 3300028556 Bacteria 21825
342 Ga0265337_1000834 3300028556 Bacteria 16183
343 Ga0265337_1001454 3300028556 Bacteria 11616
344 Ga0265337_1004106 3300028556 Bacteria 6116
345 Ga0265326_10001913 3300028558 Bacteria 7128
346 Ga0265326_10001956 3300028558 Bacteria 7053
347 Ga0265326_10002098 3300028558 Bacteria 6784
348 Ga0265326_10017846 3300028558 Bacteria 2044
349 Ga0265319_1002291 3300028563 Bacteria 10563
350 Ga0265319_1013897 3300028563 Bacteria 3180
351 Ga0265334_10000045 3300028573 Bacteria 93663
352 Ga0265334_10000403 3300028573 Bacteria 22701
353 Ga0265334_10000676 3300028573 Bacteria 17067
354 Ga0265334_10075579 3300028573 Bacteria 1248
355 Ga0265334_10168345 3300028573 Bacteria 768
356 Ga0265318_10027653 3300028577 Bacteria 2226
357 Ga0265318_10053876 3300028577 Bacteria 1508
358 Ga0265318_10057872 3300028577 Bacteria 1448
359 Ga0265318_10059589 3300028577 Bacteria 1423
360 Ga0265323_10008089 3300028653 Bacteria 4350
361 Ga0265322_10001957 3300028654 Bacteria 6514
362 Ga0265322_10049354 3300028654 Bacteria 1195
363 Ga0265336_10002603 3300028666 Bacteria 7360
364 Ga0265336_10003039 3300028666 Bacteria 6692
365 Ga0265336_10009629 3300028666 Bacteria 3333
366 Ga0265338_10000003 3300028800 Bacteria 733923
367 Ga0265338_10000195 3300028800 Bacteria 114621
368 Ga0265338_10000323 3300028800 Bacteria 87009
369 Ga0265338_10000412 3300028800 Bacteria 76488
370 Ga0265338_10000891 3300028800 Bacteria 50269
371 Ga0265338_10001293 3300028800 Bacteria 41034
372 Ga0265338_10001463 3300028800 Bacteria 38257
373 Ga0265338_10009158 3300028800 Bacteria 11878
374 Ga0265338_10016351 3300028800 Bacteria 8079
375 Ga0265338_10035468 3300028800 Bacteria 4794
376 Ga0265338_10060422 3300028800 Bacteria 3330
377 Ga0265338_10095622 3300028800 Bacteria 2439
378 Ga0265338_10115914 3300028800 Bacteria 2147
379 Ga0265338_10241590 3300028800 Bacteria 1337
380 Ga0265324_10011905 3300029957 Bacteria 3302
381 Ga0265324_10056860 3300029957 Bacteria 1340
382 Ga0316179_1039080 3300030734 Bacteria 1656
383 Ga0316183_1044371 3300030742 Bacteria 23716
384 Ga0316183_1116204 3300030742 Bacteria 23360
385 Ga0316181_1063761 3300030744 Bacteria 284591
386 Ga0316182_1011253 3300030745 Bacteria 3630
387 Ga0316182_1167866 3300030745 Bacteria 4453
388 Ga0316182_1313426 3300030745 Bacteria 15981
389 Ga0265330_10004861 3300031235 Bacteria 6768
390 Ga0265332_10010841 3300031238 Bacteria 4048
391 Ga0265328_10003567 3300031239 Bacteria 6859
392 Ga0265320_10055310 3300031240 Bacteria 1910
393 Ga0265320_10062134 3300031240 Bacteria 1779
394 Ga0265325_10012313 3300031241 Bacteria 4893
395 Ga0265325_10089688 3300031241 Bacteria 1518
396 Ga0265325_10180322 3300031241 Bacteria 984
397 Ga0265329_10014059 3300031242 Bacteria 2834
398 Ga0265340_10002239 3300031247 Bacteria 11055
399 Ga0265340_10012961 3300031247 Bacteria 4392
400 Ga0265339_10010518 3300031249 Bacteria 5746
401 Ga0265331_10006997 3300031250 Bacteria 6584
402 Ga0265327_10000017 3300031251 Bacteria 445264
403 Ga0265327_10003876 3300031251 Bacteria 13782
404 Ga0265327_10016060 3300031251 Bacteria 4786
405 Ga0265327_10020579 3300031251 Bacteria 4012
406 Ga0265327_10048902 3300031251 Bacteria 2220
407 Ga0265327_10163183 3300031251 Bacteria 1028
408 Ga0265316_10028506 3300031344 Bacteria 4605
409 Ga0265316_10048984 3300031344 Bacteria 3330
410 Ga0265316_10087056 3300031344 Bacteria 2387
411 Ga0265316_10521747 3300031344 Bacteria 847
412 Ga0265313_10006154 3300031595 Bacteria 8612
413 Ga0265313_10007171 3300031595 Bacteria 7676
414 Ga0265314_10015777 3300031711 Bacteria 5983
415 Ga0265314_10094736 3300031711 Bacteria 1935
416 Ga0265314_10154763 3300031711 Bacteria 1401
417 Ga0265342_10059265 3300031712 Bacteria 2261
418 Ga0265342_10284044 3300031712 Bacteria 875
419 Ga0307516_10000003 3300031730 Bacteria 459377
420 Ga0373959_0000257 3300034820 Bacteria 11596
421 Ga0395899_0012731 3300037312 Bacteria 6444
422 Ga0395899_0022434 3300037312 Bacteria 4787
423 Ga0395900_0000001 3300037418 Bacteria 931146
424 Ga0395900_0015980 3300037418 Bacteria 7649
425 Ga0395900_0020197 3300037418 Bacteria 6797
426 Ga0395900_0140243 3300037418 Bacteria 2476
427 Ga0395898_0000002 3300037466 Bacteria 931013
428 Ga0395898_0003154 3300037466 Bacteria 18614
429 Ga0395898_0022091 3300037466 Bacteria 6446
430 Ga0395905_0000937 3300037471 Bacteria 37558
431 Ga0395905_0007157 3300037471 Bacteria 11150
432 Ga0395905_0674372 3300037471 Bacteria 936
433 Ga0395901_0000400 3300038443 Bacteria 51851
434 Ga0395901_0008437 3300038443 Bacteria 10413
435 Ga0395901_0013122 3300038443 Bacteria 8409
436 Ga0395901_0323502 3300038443 Bacteria 1595
437 Ga0451807_2470150 3300041486 Bacteria 1532
438 Ga0439463_015078 3300042016 Bacteria 1910
439 Ga0439446_0000005 3300042156 Bacteria 101649
440 Ga0439434_0023735 3300042435 Bacteria 1847
441 Ga0439464_0000002 3300042439 Bacteria 79371
442 Ga0450918_001467 3300042531 Bacteria 4674
443 Ga0466972_0012197 3300044658 Bacteria 4319
444 Ga0453683_0017769 3300044673 Bacteria 4574
445 Ga0466965_0000073 3300044683 Bacteria 29903
446 Ga0451576_0001703 3300045051 Bacteria 36322
447 Ga0451576_0017700 3300045051 Bacteria 7831
448 Ga0451576_0018934 3300045051 Bacteria 7523
449 Ga0451576_0057179 3300045051 Bacteria 4077
450 Ga0466967_0121965 3300045976 Bacteria 2410
451 Ga0466967_0595288 3300045976 Bacteria 1091
452 Ga0466967_0958003 3300045976 Bacteria 852
453 Ga0495629_0051043 3300046459 Bacteria 2895
454 Ga0495582_0062085 3300046473 Bacteria 2064
455 Ga0495622_0000051 3300046557 Bacteria 105674
456 Ga0495588_0000173 3300046674 Bacteria 81355
457 Ga0495658_0011473 3300046683 Bacteria 4459
458 Ga0495671_0148775 3300046692 Bacteria 1140
459 Ga0495600_0060789 3300046809 Bacteria 2467
460 Ga0495660_0000035 3300046810 Bacteria 199140
461 Ga0495660_0028356 3300046810 Bacteria 3164
462 Ga0495672_0000016 3300047320 Bacteria 500601
463 Ga0496100_0028735 3300048903 Bacteria 3433
464 Ga0496112_0037761 3300048915 Bacteria 4715
465 Ga0496125_0067969 3300048928 Bacteria 2805
466 Ga0496126_0097051 3300048929 Bacteria 2583
467 Ga0501031_0001257 3300049568 Bacteria 15525
468 Ga0501032_0001296 3300049569 Bacteria 20042
469 Ga0501033_0052542 3300049570 Bacteria 3020
470 Ga0501033_0281110 3300049570 Bacteria 1175
471 Ga0501034_0000333 3300049571 Bacteria 82475
472 Ga0501034_0001363 3300049571 Bacteria 32981
473 Ga0501034_0015860 3300049571 Bacteria 7736
474 Ga0501034_0054932 3300049571 Bacteria 4008
475 Ga0501036_0013424 3300049572 Bacteria 6806
476 Ga0501037_0000001 3300049573 Bacteria 753276
477 Ga0501037_0000141 3300049573 Bacteria 67142
478 Ga0501038_0034445 3300049574 Bacteria 4452
479 Ga0501038_0044082 3300049574 Bacteria 3877
480 Ga0501038_0101656 3300049574 Bacteria 2393
481 Ga0501040_0185357 3300049576 Bacteria 1476
482 Ga0501042_0096853 3300049578 Bacteria 2120
483 Ga0501043_0000145 3300049579 Bacteria 65943
484 Ga0501046_0000065 3300049580 Bacteria 116095
485 Ga0501047_0000119 3300049581 Bacteria 96051
486 Ga0501047_0000375 3300049581 Bacteria 50494
487 Ga0501048_0000133 3300049582 Bacteria 44300
488 Ga0501048_0073309 3300049582 Bacteria 2416
489 Ga0501067_0042834 3300049583 Bacteria 2514
490 Ga0501068_0003920 3300049584 Bacteria 8091
491 Ga0501069_0108128 3300049585 Bacteria 1582
492 Ga0501070_0008113 3300049586 Bacteria 8888
493 Ga0501070_0026381 3300049586 Bacteria 4875
494 Ga0501070_0306841 3300049586 Bacteria 1292
495 Ga0501071_0019256 3300049587 Bacteria 4735
496 Ga0501073_0045525 3300049589 Bacteria 3090
497 Ga0501073_0188936 3300049589 Bacteria 1425
498 Ga0501080_0000893 3300049742 Bacteria 24429
499 Ga0501080_0068883 3300049742 Bacteria 3291
500 Ga0501083_0008094 3300049744 Bacteria 7434
501 Ga0501083_0017659 3300049744 Bacteria 4974
502 Ga0501083_0248465 3300049744 Bacteria 1158
503 Ga0501035_0000211 3300049822 Bacteria 69883
504 Ga0501035_0004250 3300049822 Bacteria 13597
505 Ga0501035_0190609 3300049822 Bacteria 1763
506 Ga0501044_0046803 3300049823 Bacteria 4477
507 nmdc:mga03683_724_c1 3300050489 Bacteria 9442
508 nmdc:mga03n38_33_c1 3300050490 Bacteria 30986
509 nmdc:mga00v17_14983_c1 3300050491 Bacteria 4343
510 nmdc:mga00v17_25497_c1 3300050491 Bacteria 3437
511 nmdc:mga00v17_67780_c1 3300050491 Bacteria 2205
512 nmdc:mga0yw44_13_c1 3300050492 Bacteria 120183
513 nmdc:mga0yw44_31633_c1 3300050492 Bacteria 3078
514 nmdc:mga0yw44_48789_c1 3300050492 Bacteria 2553
515 nmdc:mga0yw44_92574_c1 3300050492 Bacteria 1913
516 nmdc:mga0k408_113_c1 3300050493 Bacteria 39351
517 nmdc:mga0k408_15872_c1 3300050493 Bacteria 4170
518 nmdc:mga0k408_179_c1 3300050493 Bacteria 33243
519 nmdc:mga0k408_1961_c2 3300050493 Bacteria 9850
520 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
521 nmdc:mga0k408_2493_c1 3300050493 Bacteria 9792
522 nmdc:mga0k408_3268_c1 3300050493 Bacteria 8575
523 nmdc:mga06z11_224699_c1 3300050494 Bacteria 1098
524 nmdc:mga06z11_31_c1 3300050494 Bacteria 57393
525 nmdc:mga06z11_74_c1 3300050494 Bacteria 42014
526 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
527 nmdc:mga07m45_39184_c1 3300050496 Bacteria 2647
528 nmdc:mga07m45_729_c1 3300050496 Bacteria 10864
529 nmdc:mga07m45_7506_c1 3300050496 Bacteria 5573
530 nmdc:mga07m45_827_c1 3300050496 Bacteria 13388
531 nmdc:mga0qj67_13114_c1 3300050509 Bacteria 6259
532 nmdc:mga08y16_2629_c1 3300050511 Bacteria 18453
533 nmdc:mga08x19_215015_c1 3300050514 Bacteria 1320
534 nmdc:mga0sz30_12962_c1 3300050516 Bacteria 3255
535 nmdc:mga0sz30_139004_c1 3300050516 Bacteria 1072
536 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
537 nmdc:mga0sz30_4_c1 3300050516 Bacteria 84956
538 nmdc:mga0sz30_80399_c1 3300050516 Bacteria 1410
539 Ga0500610_0000002 3300053079 Bacteria 166752
540 Ga0500643_000010 3300053087 Bacteria 408084
541 Ga0500643_000251 3300053087 Bacteria 49425
542 Ga0500643_002124 3300053087 Bacteria 10505
543 Ga0500643_022263 3300053087 Bacteria 2042
544 Ga0500644_0000198 3300053088 Bacteria 36907
545 Ga0500644_0001954 3300053088 Bacteria 5259
546 Ga0500644_0021864 3300053088 Bacteria 1922
547 Ga0500646_0000048 3300053090 Bacteria 33067
548 Ga0500583_0000057 3300053092 Bacteria 71874
549 Ga0500583_0004917 3300053092 Bacteria 4419
550 Ga0500651_0000019 3300053093 Bacteria 141974
551 Ga0500651_0000051 3300053093 Bacteria 76584
552 Ga0500651_0002735 3300053093 Bacteria 9419
553 Ga0500651_0122821 3300053093 Bacteria 1575
554 Ga0500566_0000001 3300053094 Bacteria 1101031
555 Ga0500650_0000003 3300053098 Bacteria 164144
556 Ga0500650_0012261 3300053098 Bacteria 3561
557 Ga0500555_000001 3300053103 Bacteria 1353713
558 Ga0500555_000002 3300053103 Bacteria 1314346
559 Ga0500556_0000196 3300053104 Bacteria 49648
560 Ga0500562_000001 3300053108 Bacteria 1178987
561 Ga0500562_000002 3300053108 Bacteria 977234
562 Ga0500562_012684 3300053108 Bacteria 2146
563 Ga0500593_000001 3300053117 Bacteria 784404
564 Ga0500594_0000001 3300053118 Bacteria 1178472
565 Ga0500594_0000034 3300053118 Bacteria 44315
566 Ga0500594_0000258 3300053118 Bacteria 12500
567 Ga0500614_000001 3300053123 Bacteria 1274484
568 Ga0500621_000694 3300053126 Bacteria 6546
569 Ga0500628_000009 3300053129 Bacteria 122386
570 Ga0500628_031681 3300053129 Bacteria 1152
571 Ga0500652_000695 3300053131 Bacteria 11449
572 Ga0500655_000327 3300053133 Bacteria 10462
573 Ga0500559_0009237 3300053136 Bacteria 4279
574 Ga0500561_0000001 3300053137 Bacteria 957685
575 Ga0500568_0004845 3300053139 Bacteria 7106
576 Ga0500577_0000357 3300053142 Bacteria 11677
577 Ga0500577_0082762 3300053142 Bacteria 1283
578 Ga0500579_006408 3300053143 Bacteria 7310
579 Ga0500589_000002 3300053147 Bacteria 245055
580 Ga0500589_042175 3300053147 Bacteria 2128
581 Ga0500589_057551 3300053147 Bacteria 1790
582 Ga0500603_013046 3300053150 Bacteria 1920
583 Ga0500604_0032448 3300053151 Bacteria 1539
584 Ga0500633_0016280 3300053160 Bacteria 2155
585 Ga0500649_000002 3300053722 Bacteria 145889
586 Ga0500570_000003 3300053724 Bacteria 149500
587 Ga0500611_000897 3300053727 Bacteria 3107
588 Ga0500611_003354 3300053727 Bacteria 2041
589 Ga0501084_0023645 3300054114 Bacteria 5124
590 Ga0501082_0051798 3300060353 Bacteria 3538

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053104 Ga0500556_0000196 Ga0500556_0000196_38539_39201 213
2 3300009993 Ga0105028_101012 Ga0105028_1010124 221
3 3300029957 Ga0265324_10056860 Ga0265324_100568601 223
4 3300031711 Ga0265314_10154763 Ga0265314_101547632 223
5 3300044673 Ga0453683_0017769 Ga0453683_0017769_1569_2249 223
6 3300045051 Ga0451576_0001703 Ga0451576_0001703_33853_34533 223
7 3300045051 Ga0451576_0017700 Ga0451576_0017700_1925_2605 223
8 3300045051 Ga0451576_0057179 Ga0451576_0057179_2367_3047 223
9 3300005367 Ga0070667_100000001 Ga0070667_1000000011094 224
10 3300005843 Ga0068860_100007462 Ga0068860_1000074625 224
11 3300025928 Ga0207700_10239546 Ga0207700_102395462 224
12 3300025949 Ga0207667_10580571 Ga0207667_105805712 224
13 3300025986 Ga0207658_10000003 Ga0207658_10000003288 224
14 3300028381 Ga0268264_10041097 Ga0268264_100410974 224
15 3300005329 Ga0070683_100000130 Ga0070683_10000013025 225
16 3300005445 Ga0070708_100023930 Ga0070708_1000239302 225
17 3300005535 Ga0070684_100000623 Ga0070684_1000006231 225
18 3300005535 Ga0070684_100093331 Ga0070684_1000933313 225
19 3300006237 Ga0097621_100984273 Ga0097621_1009842731 225
20 3300025944 Ga0207661_10000118 Ga0207661_1000011833 225
21 3300049574 Ga0501038_0101656 Ga0501038_0101656_1537_2316 225
22 3300049583 Ga0501067_0042834 Ga0501067_0042834_420_1199 225
23 3300049584 Ga0501068_0003920 Ga0501068_0003920_4435_5214 225
24 3300049585 Ga0501069_0108128 Ga0501069_0108128_644_1423 225
25 3300049586 Ga0501070_0008113 Ga0501070_0008113_6900_7679 225
26 3300049587 Ga0501071_0019256 Ga0501071_0019256_2445_3224 225
27 3300049589 Ga0501073_0045525 Ga0501073_0045525_838_1617 225
28 3300049742 Ga0501080_0068883 Ga0501080_0068883_494_1273 225
29 3300049822 Ga0501035_0190609 Ga0501035_0190609_278_1057 225
30 3300054114 Ga0501084_0023645 Ga0501084_0023645_2389_3168 225
31 3300003323 rootH1_10121568 rootH1_101215683 226
32 3300005335 Ga0070666_10096277 Ga0070666_100962773 226
33 3300005336 Ga0070680_100398379 Ga0070680_1003983792 226
34 3300005344 Ga0070661_100019512 Ga0070661_1000195123 226
35 3300005347 Ga0070668_100099717 Ga0070668_1000997172 226
36 3300005353 Ga0070669_100083495 Ga0070669_1000834952 226
37 3300005355 Ga0070671_100000001 Ga0070671_10000000197 226
38 3300005366 Ga0070659_100201846 Ga0070659_1002018462 226
39 3300005435 Ga0070714_100001085 Ga0070714_10000108514 226
40 3300005530 Ga0070679_100000219 Ga0070679_10000021938 226
41 3300005530 Ga0070679_100278535 Ga0070679_1002785352 226
42 3300005535 Ga0070684_100207661 Ga0070684_1002076612 226
43 3300005539 Ga0068853_100017986 Ga0068853_1000179862 226
44 3300005563 Ga0068855_100050197 Ga0068855_1000501975 226
45 3300005563 Ga0068855_100329981 Ga0068855_1003299812 226
46 3300005563 Ga0068855_100429492 Ga0068855_1004294922 226
47 3300005577 Ga0068857_100021612 Ga0068857_1000216123 226
48 3300005577 Ga0068857_100119870 Ga0068857_1001198703 226
49 3300005578 Ga0068854_100245788 Ga0068854_1002457882 226
50 3300005616 Ga0068852_100530766 Ga0068852_1005307662 226
51 3300005617 Ga0068859_100101592 Ga0068859_1001015922 226
52 3300005617 Ga0068859_101492012 Ga0068859_1014920121 226
53 3300005841 Ga0068863_100629240 Ga0068863_1006292401 226
54 3300005843 Ga0068860_100024465 Ga0068860_1000244653 226
55 3300005843 Ga0068860_100167299 Ga0068860_1001672992 226
56 3300005985 Ga0081539_10001122 Ga0081539_1000112245 226
57 3300006038 Ga0075365_10022683 Ga0075365_100226834 226
58 3300006237 Ga0097621_100331720 Ga0097621_1003317202 226
59 3300006358 Ga0068871_100086325 Ga0068871_1000863253 226
60 3300006931 Ga0097620_100101590 Ga0097620_1001015902 226
61 3300006931 Ga0097620_101492097 Ga0097620_1014920971 226
62 3300009093 Ga0105240_10123197 Ga0105240_101231972 226
63 3300009093 Ga0105240_10427476 Ga0105240_104274762 226
64 3300009093 Ga0105240_10590074 Ga0105240_105900742 226
65 3300009093 Ga0105240_10741750 Ga0105240_107417502 226
66 3300009098 Ga0105245_10006458 Ga0105245_100064587 226
67 3300009098 Ga0105245_10959572 Ga0105245_109595721 226
68 3300009101 Ga0105247_10280856 Ga0105247_102808561 226
69 3300009101 Ga0105247_10287203 Ga0105247_102872032 226
70 3300009174 Ga0105241_10036701 Ga0105241_100367013 226
71 3300013105 Ga0157369_10050340 Ga0157369_100503404 226
72 3300013307 Ga0157372_10000553 Ga0157372_1000055310 226
73 3300013307 Ga0157372_10104511 Ga0157372_101045112 226
74 3300025900 Ga0207710_10151988 Ga0207710_101519882 226
75 3300025903 Ga0207680_10177620 Ga0207680_101776202 226
76 3300025904 Ga0207647_10001817 Ga0207647_100018174 226
77 3300025912 Ga0207707_10009816 Ga0207707_100098165 226
78 3300025913 Ga0207695_10313927 Ga0207695_103139272 226
79 3300025913 Ga0207695_10420121 Ga0207695_104201212 226
80 3300025917 Ga0207660_10153362 Ga0207660_101533621 226
81 3300025919 Ga0207657_10070357 Ga0207657_100703574 226
82 3300025920 Ga0207649_10028172 Ga0207649_100281724 226
83 3300025921 Ga0207652_10001284 Ga0207652_1000128415 226
84 3300025921 Ga0207652_10261285 Ga0207652_102612852 226
85 3300025921 Ga0207652_10269506 Ga0207652_102695062 226
86 3300025923 Ga0207681_10140070 Ga0207681_101400702 226
87 3300025927 Ga0207687_10010247 Ga0207687_100102475 226
88 3300025929 Ga0207664_10001077 Ga0207664_100010774 226
89 3300025931 Ga0207644_10000001 Ga0207644_100000011335 226
90 3300025931 Ga0207644_10008039 Ga0207644_100080393 226
91 3300025932 Ga0207690_10689037 Ga0207690_106890371 226
92 3300025949 Ga0207667_10014120 Ga0207667_100141204 226
93 3300025949 Ga0207667_10037504 Ga0207667_100375044 226
94 3300025949 Ga0207667_10170880 Ga0207667_101708803 226
95 3300025949 Ga0207667_10532935 Ga0207667_105329351 226
96 3300025949 Ga0207667_10654553 Ga0207667_106545532 226
97 3300025981 Ga0207640_10081458 Ga0207640_100814582 226
98 3300025986 Ga0207658_10021047 Ga0207658_100210472 226
99 3300026041 Ga0207639_10028883 Ga0207639_100288832 226
100 3300026088 Ga0207641_10020510 Ga0207641_100205105 226
101 3300026088 Ga0207641_10583998 Ga0207641_105839981 226
102 3300026116 Ga0207674_10003329 Ga0207674_100033294 226
103 3300026116 Ga0207674_10131856 Ga0207674_101318562 226
104 3300026142 Ga0207698_10025132 Ga0207698_100251324 226
105 3300026142 Ga0207698_10934730 Ga0207698_109347302 226
106 3300028381 Ga0268264_10033265 Ga0268264_100332653 226
107 3300028556 Ga0265337_1000080 Ga0265337_100008016 226
108 3300028556 Ga0265337_1000451 Ga0265337_100045127 226
109 3300028556 Ga0265337_1000834 Ga0265337_100083416 226
110 3300028556 Ga0265337_1001454 Ga0265337_100145410 226
111 3300028556 Ga0265337_1004106 Ga0265337_10041064 226
112 3300028558 Ga0265326_10001913 Ga0265326_100019132 226
113 3300028558 Ga0265326_10001956 Ga0265326_100019563 226
114 3300028558 Ga0265326_10002098 Ga0265326_100020983 226
115 3300028558 Ga0265326_10017846 Ga0265326_100178463 226
116 3300028563 Ga0265319_1002291 Ga0265319_10022918 226
117 3300028563 Ga0265319_1013897 Ga0265319_10138972 226
118 3300028573 Ga0265334_10000045 Ga0265334_1000004568 226
119 3300028573 Ga0265334_10000676 Ga0265334_100006761 226
120 3300028573 Ga0265334_10075579 Ga0265334_100755791 226
121 3300028573 Ga0265334_10168345 Ga0265334_101683452 226
122 3300028577 Ga0265318_10027653 Ga0265318_100276532 226
123 3300028577 Ga0265318_10053876 Ga0265318_100538762 226
124 3300028577 Ga0265318_10057872 Ga0265318_100578722 226
125 3300028577 Ga0265318_10059589 Ga0265318_100595892 226
126 3300028653 Ga0265323_10008089 Ga0265323_100080892 226
127 3300028654 Ga0265322_10001957 Ga0265322_100019572 226
128 3300028654 Ga0265322_10049354 Ga0265322_100493542 226
129 3300028666 Ga0265336_10002603 Ga0265336_100026034 226
130 3300028666 Ga0265336_10003039 Ga0265336_100030394 226
131 3300028666 Ga0265336_10009629 Ga0265336_100096291 226
132 3300028800 Ga0265338_10000003 Ga0265338_10000003642 226
133 3300028800 Ga0265338_10000195 Ga0265338_1000019553 226
134 3300028800 Ga0265338_10000412 Ga0265338_1000041255 226
135 3300028800 Ga0265338_10001293 Ga0265338_1000129327 226
136 3300028800 Ga0265338_10001463 Ga0265338_1000146320 226
137 3300028800 Ga0265338_10009158 Ga0265338_100091582 226
138 3300028800 Ga0265338_10016351 Ga0265338_100163513 226
139 3300028800 Ga0265338_10060422 Ga0265338_100604221 226
140 3300028800 Ga0265338_10095622 Ga0265338_100956221 226
141 3300029957 Ga0265324_10011905 Ga0265324_100119051 226
142 3300031235 Ga0265330_10004861 Ga0265330_100048615 226
143 3300031238 Ga0265332_10010841 Ga0265332_100108413 226
144 3300031239 Ga0265328_10003567 Ga0265328_100035672 226
145 3300031240 Ga0265320_10055310 Ga0265320_100553102 226
146 3300031240 Ga0265320_10062134 Ga0265320_100621342 226
147 3300031241 Ga0265325_10012313 Ga0265325_100123134 226
148 3300031241 Ga0265325_10089688 Ga0265325_100896882 226
149 3300031241 Ga0265325_10180322 Ga0265325_101803221 226
150 3300031242 Ga0265329_10014059 Ga0265329_100140592 226
151 3300031247 Ga0265340_10002239 Ga0265340_100022394 226
152 3300031249 Ga0265339_10010518 Ga0265339_100105182 226
153 3300031250 Ga0265331_10006997 Ga0265331_100069972 226
154 3300031251 Ga0265327_10020579 Ga0265327_100205792 226
155 3300031251 Ga0265327_10048902 Ga0265327_100489023 226
156 3300031251 Ga0265327_10163183 Ga0265327_101631831 226
157 3300031344 Ga0265316_10028506 Ga0265316_100285063 226
158 3300031344 Ga0265316_10048984 Ga0265316_100489841 226
159 3300031344 Ga0265316_10087056 Ga0265316_100870562 226
160 3300031344 Ga0265316_10521747 Ga0265316_105217471 226
161 3300031595 Ga0265313_10006154 Ga0265313_100061542 226
162 3300031595 Ga0265313_10007171 Ga0265313_100071713 226
163 3300031711 Ga0265314_10015777 Ga0265314_100157775 226
164 3300031711 Ga0265314_10094736 Ga0265314_100947362 226
165 3300031712 Ga0265342_10059265 Ga0265342_100592652 226
166 3300031712 Ga0265342_10284044 Ga0265342_102840441 226
167 3300037418 Ga0395900_0020197 Ga0395900_0020197_1053_1736 226
168 3300037466 Ga0395898_0003154 Ga0395898_0003154_6927_7610 226
169 3300041486 Ga0451807_2470150 Ga0451807_2470150_374_1057 226
170 3300047320 Ga0495672_0000016 Ga0495672_0000016_365908_366591 226
171 3300048928 Ga0496125_0067969 Ga0496125_0067969_940_1758 226
172 3300049744 Ga0501083_0008094 Ga0501083_0008094_6578_7267 226
173 3300050492 nmdc:mga0yw44_48789_c1 nmdc:mga0yw44_48789_c1_1292_1972 226
174 3300053087 Ga0500643_000010 Ga0500643_000010_53907_54587 226
175 3300053087 Ga0500643_000251 Ga0500643_000251_14478_15161 226
176 3300053117 Ga0500593_000001 Ga0500593_000001_352846_353532 226
177 3300053139 Ga0500568_0004845 Ga0500568_0004845_3946_4626 226
178 3300053147 Ga0500589_042175 Ga0500589_042175_314_997 226
179 3300053147 Ga0500589_057551 Ga0500589_057551_255_935 226
180 3300053724 Ga0500570_000003 Ga0500570_000003_142212_142934 226
181 3300053727 Ga0500611_000897 Ga0500611_000897_333_1016 226
182 2162886007 SwRhRL2b_contig_1328258 SwRhRL2b_0798.00001750 227
183 3300001904 JGI24736J21556_1018298 JGI24736J21556_10182982 227
184 3300001915 JGI24741J21665_1000674 JGI24741J21665_10006742 227
185 3300001915 JGI24741J21665_1002268 JGI24741J21665_10022686 227
186 3300001979 JGI24740J21852_10006266 JGI24740J21852_100062664 227
187 3300001979 JGI24740J21852_10037935 JGI24740J21852_100379352 227
188 3300001989 JGI24739J22299_10005648 JGI24739J22299_100056483 227
189 3300001990 JGI24737J22298_10000002 JGI24737J22298_1000000243 227
190 3300001991 JGI24743J22301_10008310 JGI24743J22301_100083102 227
191 3300002067 JGI24735J21928_10000026 JGI24735J21928_1000002614 227
192 3300002067 JGI24735J21928_10000042 JGI24735J21928_1000004220 227
193 3300002067 JGI24735J21928_10000107 JGI24735J21928_1000010724 227
194 3300002075 JGI24738J21930_10016672 JGI24738J21930_100166721 227
195 3300003320 rootH2_10078746 rootH2_100787463 227
196 3300003323 rootH1_10034957 rootH1_100349572 227
197 3300005289 Ga0065704_10101481 Ga0065704_101014812 227
198 3300005327 Ga0070658_10000035 Ga0070658_1000003599 227
199 3300005327 Ga0070658_10002131 Ga0070658_100021319 227
200 3300005327 Ga0070658_10005656 Ga0070658_100056565 227
201 3300005327 Ga0070658_10010220 Ga0070658_100102204 227
202 3300005327 Ga0070658_10175623 Ga0070658_101756231 227
203 3300005328 Ga0070676_10014686 Ga0070676_100146864 227
204 3300005328 Ga0070676_10145950 Ga0070676_101459502 227
205 3300005329 Ga0070683_100211638 Ga0070683_1002116382 227
206 3300005329 Ga0070683_100665668 Ga0070683_1006656681 227
207 3300005330 Ga0070690_100003312 Ga0070690_1000033123 227
208 3300005336 Ga0070680_100109873 Ga0070680_1001098732 227
209 3300005336 Ga0070680_100489041 Ga0070680_1004890412 227
210 3300005337 Ga0070682_100005661 Ga0070682_1000056614 227
211 3300005337 Ga0070682_100229875 Ga0070682_1002298752 227
212 3300005339 Ga0070660_100000099 Ga0070660_1000000995 227
213 3300005339 Ga0070660_100002635 Ga0070660_10000263511 227
214 3300005339 Ga0070660_100049994 Ga0070660_1000499942 227
215 3300005341 Ga0070691_10091496 Ga0070691_100914962 227
216 3300005343 Ga0070687_100295550 Ga0070687_1002955502 227
217 3300005344 Ga0070661_100014870 Ga0070661_1000148704 227
218 3300005344 Ga0070661_100169657 Ga0070661_1001696572 227
219 3300005355 Ga0070671_100313225 Ga0070671_1003132252 227
220 3300005356 Ga0070674_100003164 Ga0070674_1000031647 227
221 3300005364 Ga0070673_100008713 Ga0070673_1000087133 227
222 3300005366 Ga0070659_100000797 Ga0070659_1000007976 227
223 3300005366 Ga0070659_100007446 Ga0070659_1000074465 227
224 3300005366 Ga0070659_100019205 Ga0070659_1000192055 227
225 3300005367 Ga0070667_100072118 Ga0070667_1000721182 227
226 3300005455 Ga0070663_100355392 Ga0070663_1003553921 227
227 3300005456 Ga0070678_100000867 Ga0070678_1000008674 227
228 3300005456 Ga0070678_100086943 Ga0070678_1000869432 227
229 3300005457 Ga0070662_100022040 Ga0070662_1000220402 227
230 3300005458 Ga0070681_10003503 Ga0070681_100035035 227
231 3300005458 Ga0070681_10513697 Ga0070681_105136971 227
232 3300005466 Ga0070685_10002389 Ga0070685_100023894 227
233 3300005466 Ga0070685_10007413 Ga0070685_100074134 227
234 3300005530 Ga0070679_100127789 Ga0070679_1001277893 227
235 3300005530 Ga0070679_100199551 Ga0070679_1001995512 227
236 3300005530 Ga0070679_100378726 Ga0070679_1003787262 227
237 3300005535 Ga0070684_100081415 Ga0070684_1000814152 227
238 3300005539 Ga0068853_100491870 Ga0068853_1004918702 227
239 3300005543 Ga0070672_100057775 Ga0070672_1000577753 227
240 3300005544 Ga0070686_100038924 Ga0070686_1000389244 227
241 3300005563 Ga0068855_100000003 Ga0068855_100000003591 227
242 3300005563 Ga0068855_100001636 Ga0068855_10000163626 227
243 3300005563 Ga0068855_100002650 Ga0068855_1000026505 227
244 3300005563 Ga0068855_100003265 Ga0068855_10000326518 227
245 3300005563 Ga0068855_100070845 Ga0068855_1000708454 227
246 3300005563 Ga0068855_100072054 Ga0068855_1000720544 227
247 3300005564 Ga0070664_100001018 Ga0070664_10000101817 227
248 3300005577 Ga0068857_100000040 Ga0068857_10000004065 227
249 3300005577 Ga0068857_100014858 Ga0068857_1000148587 227
250 3300005577 Ga0068857_100023099 Ga0068857_1000230992 227
251 3300005577 Ga0068857_100066918 Ga0068857_1000669182 227
252 3300005577 Ga0068857_100097858 Ga0068857_1000978583 227
253 3300005577 Ga0068857_100100416 Ga0068857_1001004164 227
254 3300005577 Ga0068857_100313187 Ga0068857_1003131872 227
255 3300005614 Ga0068856_100000001 Ga0068856_100000001607 227
256 3300005614 Ga0068856_100000354 Ga0068856_10000035431 227
257 3300005614 Ga0068856_100040232 Ga0068856_1000402323 227
258 3300005614 Ga0068856_100237680 Ga0068856_1002376802 227
259 3300005614 Ga0068856_100485696 Ga0068856_1004856962 227
260 3300005614 Ga0068856_100679211 Ga0068856_1006792111 227
261 3300005616 Ga0068852_100133713 Ga0068852_1001337132 227
262 3300005841 Ga0068863_100248954 Ga0068863_1002489542 227
263 3300005843 Ga0068860_100500189 Ga0068860_1005001891 227
264 3300005843 Ga0068860_100677181 Ga0068860_1006771811 227
265 3300006038 Ga0075365_10000021 Ga0075365_1000002152 227
266 3300006038 Ga0075365_10111393 Ga0075365_101113932 227
267 3300006038 Ga0075365_10218429 Ga0075365_102184291 227
268 3300006042 Ga0075368_10000062 Ga0075368_1000006226 227
269 3300006048 Ga0075363_100000019 Ga0075363_10000001929 227
270 3300006051 Ga0075364_10013648 Ga0075364_100136484 227
271 3300006051 Ga0075364_10031430 Ga0075364_100314303 227
272 3300006178 Ga0075367_10000012 Ga0075367_1000001224 227
273 3300006178 Ga0075367_10003115 Ga0075367_100031153 227
274 3300006178 Ga0075367_10061567 Ga0075367_100615673 227
275 3300006186 Ga0075369_10000012 Ga0075369_100000122 227
276 3300006186 Ga0075369_10016321 Ga0075369_100163213 227
277 3300006186 Ga0075369_10148160 Ga0075369_101481602 227
278 3300006195 Ga0075366_10000011 Ga0075366_1000001133 227
279 3300006195 Ga0075366_10000134 Ga0075366_1000013419 227
280 3300006195 Ga0075366_10000959 Ga0075366_100009598 227
281 3300006195 Ga0075366_10002255 Ga0075366_1000225510 227
282 3300006195 Ga0075366_10003146 Ga0075366_100031464 227
283 3300006237 Ga0097621_100000001 Ga0097621_100000001102 227
284 3300006353 Ga0075370_10000866 Ga0075370_1000086610 227
285 3300006353 Ga0075370_10007565 Ga0075370_100075651 227
286 3300006353 Ga0075370_10008017 Ga0075370_100080174 227
287 3300006353 Ga0075370_10039890 Ga0075370_100398902 227
288 3300006358 Ga0068871_100000005 Ga0068871_10000000586 227
289 3300006844 Ga0075428_100016057 Ga0075428_1000160575 227
290 3300006846 Ga0075430_100042755 Ga0075430_1000427553 227
291 3300006881 Ga0068865_100000316 Ga0068865_1000003166 227
292 3300006881 Ga0068865_100622667 Ga0068865_1006226672 227
293 3300006914 Ga0075436_100242621 Ga0075436_1002426212 227
294 3300009093 Ga0105240_10000003 Ga0105240_100000031217 227
295 3300009093 Ga0105240_10000004 Ga0105240_10000004704 227
296 3300009093 Ga0105240_10023637 Ga0105240_100236376 227
297 3300009094 Ga0111539_10000492 Ga0111539_1000049250 227
298 3300009098 Ga0105245_10000001 Ga0105245_1000000168 227
299 3300009098 Ga0105245_10000093 Ga0105245_1000009356 227
300 3300009098 Ga0105245_10035287 Ga0105245_100352873 227
301 3300009098 Ga0105245_10061797 Ga0105245_100617973 227
302 3300009098 Ga0105245_10072265 Ga0105245_100722653 227
303 3300009098 Ga0105245_10266082 Ga0105245_102660822 227
304 3300009098 Ga0105245_10340574 Ga0105245_103405742 227
305 3300009148 Ga0105243_10000001 Ga0105243_1000000162 227
306 3300009148 Ga0105243_10001490 Ga0105243_1000149023 227
307 3300009174 Ga0105241_10000007 Ga0105241_1000000776 227
308 3300009174 Ga0105241_10012054 Ga0105241_100120546 227
309 3300009176 Ga0105242_10000002 Ga0105242_10000002220 227
310 3300009176 Ga0105242_10001924 Ga0105242_100019247 227
311 3300009176 Ga0105242_10028406 Ga0105242_100284064 227
312 3300009176 Ga0105242_10114405 Ga0105242_101144052 227
313 3300009177 Ga0105248_10432176 Ga0105248_104321762 227
314 3300009545 Ga0105237_10000001 Ga0105237_100000011136 227
315 3300009545 Ga0105237_10010322 Ga0105237_1001032210 227
316 3300009545 Ga0105237_10332270 Ga0105237_103322702 227
317 3300009551 Ga0105238_10092416 Ga0105238_100924163 227
318 3300009551 Ga0105238_10283075 Ga0105238_102830752 227
319 3300009553 Ga0105249_10004977 Ga0105249_1000497710 227
320 3300009553 Ga0105249_10134697 Ga0105249_101346973 227
321 3300009984 Ga0105029_100172 Ga0105029_1001724 227
322 3300010375 Ga0105239_10020947 Ga0105239_100209477 227
323 3300010375 Ga0105239_10021841 Ga0105239_100218413 227
324 3300010375 Ga0105239_10040288 Ga0105239_100402885 227
325 3300011119 Ga0105246_10001734 Ga0105246_100017347 227
326 3300011119 Ga0105246_10006713 Ga0105246_100067133 227
327 3300013100 Ga0157373_10000433 Ga0157373_1000043333 227
328 3300013100 Ga0157373_10029275 Ga0157373_100292754 227
329 3300013100 Ga0157373_10229700 Ga0157373_102297002 227
330 3300013102 Ga0157371_10001803 Ga0157371_100018038 227
331 3300013102 Ga0157371_10004875 Ga0157371_100048759 227
332 3300013104 Ga0157370_10000924 Ga0157370_1000092414 227
333 3300013104 Ga0157370_10001253 Ga0157370_1000125325 227
334 3300013104 Ga0157370_10546709 Ga0157370_105467092 227
335 3300013104 Ga0157370_10599917 Ga0157370_105999172 227
336 3300013105 Ga0157369_10000024 Ga0157369_1000002464 227
337 3300013105 Ga0157369_10000104 Ga0157369_1000010452 227
338 3300013105 Ga0157369_10000444 Ga0157369_1000044421 227
339 3300013105 Ga0157369_10012770 Ga0157369_100127705 227
340 3300013105 Ga0157369_10539388 Ga0157369_105393882 227
341 3300013296 Ga0157374_10000225 Ga0157374_1000022531 227
342 3300013296 Ga0157374_10000501 Ga0157374_1000050122 227
343 3300013296 Ga0157374_10000509 Ga0157374_100005094 227
344 3300013296 Ga0157374_10001467 Ga0157374_100014673 227
345 3300013296 Ga0157374_10005951 Ga0157374_1000595111 227
346 3300013296 Ga0157374_10183376 Ga0157374_101833762 227
347 3300013296 Ga0157374_10195970 Ga0157374_101959702 227
348 3300013296 Ga0157374_10375658 Ga0157374_103756582 227
349 3300013297 Ga0157378_10220560 Ga0157378_102205603 227
350 3300013306 Ga0163162_10119428 Ga0163162_101194283 227
351 3300013307 Ga0157372_10000002 Ga0157372_10000002681 227
352 3300014325 Ga0163163_10008888 Ga0163163_100088885 227
353 3300014745 Ga0157377_10002625 Ga0157377_100026256 227
354 3300014969 Ga0157376_10000007 Ga0157376_1000000779 227
355 3300025901 Ga0207688_10172618 Ga0207688_101726182 227
356 3300025904 Ga0207647_10000315 Ga0207647_1000031532 227
357 3300025909 Ga0207705_10000010 Ga0207705_10000010103 227
358 3300025909 Ga0207705_10000011 Ga0207705_10000011529 227
359 3300025909 Ga0207705_10000065 Ga0207705_10000065139 227
360 3300025909 Ga0207705_10004833 Ga0207705_100048335 227
361 3300025909 Ga0207705_10022207 Ga0207705_100222074 227
362 3300025909 Ga0207705_10024571 Ga0207705_100245713 227
363 3300025911 Ga0207654_10000002 Ga0207654_100000021470 227
364 3300025911 Ga0207654_10024380 Ga0207654_100243802 227
365 3300025911 Ga0207654_10140097 Ga0207654_101400972 227
366 3300025912 Ga0207707_10005260 Ga0207707_1000526010 227
367 3300025912 Ga0207707_10242777 Ga0207707_102427771 227
368 3300025913 Ga0207695_10000005 Ga0207695_100000051228 227
369 3300025913 Ga0207695_10000009 Ga0207695_100000091086 227
370 3300025913 Ga0207695_10028809 Ga0207695_100288093 227
371 3300025914 Ga0207671_10000003 Ga0207671_100000031142 227
372 3300025914 Ga0207671_10009916 Ga0207671_100099163 227
373 3300025918 Ga0207662_10301310 Ga0207662_103013101 227
374 3300025919 Ga0207657_10001204 Ga0207657_1000120426 227
375 3300025919 Ga0207657_10001496 Ga0207657_1000149621 227
376 3300025919 Ga0207657_10008411 Ga0207657_100084113 227
377 3300025920 Ga0207649_10010995 Ga0207649_100109954 227
378 3300025921 Ga0207652_10065247 Ga0207652_100652472 227
379 3300025921 Ga0207652_10079483 Ga0207652_100794832 227
380 3300025921 Ga0207652_10218195 Ga0207652_102181953 227
381 3300025921 Ga0207652_10592734 Ga0207652_105927341 227
382 3300025927 Ga0207687_10000004 Ga0207687_10000004199 227
383 3300025927 Ga0207687_10000907 Ga0207687_1000090718 227
384 3300025927 Ga0207687_10020599 Ga0207687_100205993 227
385 3300025927 Ga0207687_10297871 Ga0207687_102978712 227
386 3300025931 Ga0207644_10172178 Ga0207644_101721782 227
387 3300025932 Ga0207690_10004353 Ga0207690_100043536 227
388 3300025933 Ga0207706_10000053 Ga0207706_1000005377 227
389 3300025934 Ga0207686_10000001 Ga0207686_100000011082 227
390 3300025934 Ga0207686_10001050 Ga0207686_1000105012 227
391 3300025934 Ga0207686_10209077 Ga0207686_102090773 227
392 3300025935 Ga0207709_10000002 Ga0207709_100000021199 227
393 3300025935 Ga0207709_10011294 Ga0207709_100112945 227
394 3300025936 Ga0207670_10676325 Ga0207670_106763251 227
395 3300025937 Ga0207669_10400095 Ga0207669_104000951 227
396 3300025938 Ga0207704_10000843 Ga0207704_100008439 227
397 3300025940 Ga0207691_10018821 Ga0207691_100188213 227
398 3300025941 Ga0207711_10377392 Ga0207711_103773922 227
399 3300025944 Ga0207661_10028558 Ga0207661_100285582 227
400 3300025944 Ga0207661_10064196 Ga0207661_100641962 227
401 3300025944 Ga0207661_10305996 Ga0207661_103059962 227
402 3300025945 Ga0207679_10000193 Ga0207679_100001933 227
403 3300025945 Ga0207679_10126487 Ga0207679_101264872 227
404 3300025945 Ga0207679_10614706 Ga0207679_106147061 227
405 3300025949 Ga0207667_10000008 Ga0207667_10000008581 227
406 3300025949 Ga0207667_10000784 Ga0207667_1000078440 227
407 3300025949 Ga0207667_10003751 Ga0207667_1000375118 227
408 3300025949 Ga0207667_10004748 Ga0207667_1000474822 227
409 3300025949 Ga0207667_10058970 Ga0207667_100589704 227
410 3300025960 Ga0207651_10004852 Ga0207651_100048523 227
411 3300025961 Ga0207712_10064727 Ga0207712_100647273 227
412 3300025961 Ga0207712_10089008 Ga0207712_100890083 227
413 3300026067 Ga0207678_10378798 Ga0207678_103787982 227
414 3300026078 Ga0207702_10000062 Ga0207702_1000006253 227
415 3300026078 Ga0207702_10000190 Ga0207702_100001906 227
416 3300026078 Ga0207702_10028752 Ga0207702_100287524 227
417 3300026078 Ga0207702_10633074 Ga0207702_106330741 227
418 3300026088 Ga0207641_10194486 Ga0207641_101944862 227
419 3300026089 Ga0207648_10012947 Ga0207648_100129474 227
420 3300026116 Ga0207674_10000001 Ga0207674_1000000164 227
421 3300026116 Ga0207674_10034987 Ga0207674_100349871 227
422 3300026116 Ga0207674_10092451 Ga0207674_100924512 227
423 3300026116 Ga0207674_10285130 Ga0207674_102851302 227
424 3300026116 Ga0207674_10339089 Ga0207674_103390892 227
425 3300026121 Ga0207683_10001083 Ga0207683_1000108321 227
426 3300026121 Ga0207683_10272951 Ga0207683_102729512 227
427 3300026142 Ga0207698_10080372 Ga0207698_100803724 227
428 3300027866 Ga0209813_10000002 Ga0209813_10000002111 227
429 3300027907 Ga0207428_10031187 Ga0207428_100311872 227
430 3300028379 Ga0268266_10004953 Ga0268266_100049534 227
431 3300028381 Ga0268264_10573062 Ga0268264_105730621 227
432 3300028573 Ga0265334_10000403 Ga0265334_100004036 227
433 3300028800 Ga0265338_10000323 Ga0265338_1000032316 227
434 3300028800 Ga0265338_10000891 Ga0265338_1000089142 227
435 3300028800 Ga0265338_10035468 Ga0265338_100354682 227
436 3300028800 Ga0265338_10115914 Ga0265338_101159142 227
437 3300028800 Ga0265338_10241590 Ga0265338_102415902 227
438 3300030734 Ga0316179_1039080 Ga0316179_10390803 227
439 3300030742 Ga0316183_1044371 Ga0316183_104437110 227
440 3300030742 Ga0316183_1116204 Ga0316183_11162048 227
441 3300030744 Ga0316181_1063761 Ga0316181_106376155 227
442 3300030745 Ga0316182_1011253 Ga0316182_10112534 227
443 3300030745 Ga0316182_1167866 Ga0316182_11678663 227
444 3300030745 Ga0316182_1313426 Ga0316182_131342610 227
445 3300031247 Ga0265340_10012961 Ga0265340_100129615 227
446 3300031251 Ga0265327_10000017 Ga0265327_10000017447 227
447 3300031251 Ga0265327_10003876 Ga0265327_1000387614 227
448 3300031251 Ga0265327_10016060 Ga0265327_100160601 227
449 3300031730 Ga0307516_10000003 Ga0307516_10000003366 227
450 3300034820 Ga0373959_0000257 Ga0373959_0000257_6348_7040 227
451 3300037312 Ga0395899_0012731 Ga0395899_0012731_2379_3062 227
452 3300037312 Ga0395899_0022434 Ga0395899_0022434_1882_2565 227
453 3300037418 Ga0395900_0000001 Ga0395900_0000001_776081_776764 227
454 3300037418 Ga0395900_0015980 Ga0395900_0015980_2460_3143 227
455 3300037418 Ga0395900_0140243 Ga0395900_0140243_631_1437 227
456 3300037466 Ga0395898_0000002 Ga0395898_0000002_329242_329925 227
457 3300037466 Ga0395898_0022091 Ga0395898_0022091_5625_6308 227
458 3300037471 Ga0395905_0000937 Ga0395905_0000937_32956_33648 227
459 3300037471 Ga0395905_0007157 Ga0395905_0007157_4622_5305 227
460 3300037471 Ga0395905_0674372 Ga0395905_0674372_11_694 227
461 3300038443 Ga0395901_0000400 Ga0395901_0000400_26642_27325 227
462 3300038443 Ga0395901_0008437 Ga0395901_0008437_8598_9284 227
463 3300038443 Ga0395901_0013122 Ga0395901_0013122_190_873 227
464 3300038443 Ga0395901_0323502 Ga0395901_0323502_175_861 227
465 3300042016 Ga0439463_015078 Ga0439463_015078_280_963 227
466 3300042156 Ga0439446_0000005 Ga0439446_0000005_58503_59186 227
467 3300042435 Ga0439434_0023735 Ga0439434_0023735_553_1236 227
468 3300042439 Ga0439464_0000002 Ga0439464_0000002_18225_18908 227
469 3300042531 Ga0450918_001467 Ga0450918_001467_2415_3098 227
470 3300044658 Ga0466972_0012197 Ga0466972_0012197_2476_3159 227
471 3300044683 Ga0466965_0000073 Ga0466965_0000073_941_1624 227
472 3300045051 Ga0451576_0018934 Ga0451576_0018934_6147_6830 227
473 3300045976 Ga0466967_0121965 Ga0466967_0121965_1044_1727 227
474 3300045976 Ga0466967_0595288 Ga0466967_0595288_395_1078 227
475 3300045976 Ga0466967_0958003 Ga0466967_0958003_55_738 227
476 3300046459 Ga0495629_0051043 Ga0495629_0051043_328_1011 227
477 3300046473 Ga0495582_0062085 Ga0495582_0062085_744_1427 227
478 3300046557 Ga0495622_0000051 Ga0495622_0000051_57643_58326 227
479 3300046674 Ga0495588_0000173 Ga0495588_0000173_77927_78610 227
480 3300046683 Ga0495658_0011473 Ga0495658_0011473_2718_3401 227
481 3300046692 Ga0495671_0148775 Ga0495671_0148775_254_937 227
482 3300046809 Ga0495600_0060789 Ga0495600_0060789_723_1406 227
483 3300046810 Ga0495660_0000035 Ga0495660_0000035_72926_73609 227
484 3300046810 Ga0495660_0028356 Ga0495660_0028356_1410_2096 227
485 3300048903 Ga0496100_0028735 Ga0496100_0028735_1387_2073 227
486 3300048915 Ga0496112_0037761 Ga0496112_0037761_3944_4630 227
487 3300048929 Ga0496126_0097051 Ga0496126_0097051_1811_2494 227
488 3300049568 Ga0501031_0001257 Ga0501031_0001257_3161_3844 227
489 3300049569 Ga0501032_0001296 Ga0501032_0001296_3896_4579 227
490 3300049570 Ga0501033_0052542 Ga0501033_0052542_2281_2973 227
491 3300049570 Ga0501033_0281110 Ga0501033_0281110_267_959 227
492 3300049571 Ga0501034_0000333 Ga0501034_0000333_26227_26910 227
493 3300049571 Ga0501034_0001363 Ga0501034_0001363_9572_10264 227
494 3300049571 Ga0501034_0015860 Ga0501034_0015860_6396_7082 227
495 3300049571 Ga0501034_0054932 Ga0501034_0054932_974_1657 227
496 3300049572 Ga0501036_0013424 Ga0501036_0013424_2582_3265 227
497 3300049573 Ga0501037_0000001 Ga0501037_0000001_577736_578419 227
498 3300049573 Ga0501037_0000141 Ga0501037_0000141_23383_24066 227
499 3300049574 Ga0501038_0034445 Ga0501038_0034445_1079_1762 227
500 3300049574 Ga0501038_0044082 Ga0501038_0044082_2504_3187 227
501 3300049576 Ga0501040_0185357 Ga0501040_0185357_10_693 227
502 3300049578 Ga0501042_0096853 Ga0501042_0096853_457_1140 227
503 3300049579 Ga0501043_0000145 Ga0501043_0000145_40830_41513 227
504 3300049580 Ga0501046_0000065 Ga0501046_0000065_95858_96541 227
505 3300049581 Ga0501047_0000119 Ga0501047_0000119_31897_32589 227
506 3300049581 Ga0501047_0000375 Ga0501047_0000375_36696_37379 227
507 3300049582 Ga0501048_0000133 Ga0501048_0000133_27785_28468 227
508 3300049582 Ga0501048_0073309 Ga0501048_0073309_425_1117 227
509 3300049586 Ga0501070_0026381 Ga0501070_0026381_3863_4546 227
510 3300049586 Ga0501070_0306841 Ga0501070_0306841_290_973 227
511 3300049589 Ga0501073_0188936 Ga0501073_0188936_490_1179 227
512 3300049742 Ga0501080_0000893 Ga0501080_0000893_12396_13079 227
513 3300049744 Ga0501083_0017659 Ga0501083_0017659_657_1358 227
514 3300049744 Ga0501083_0248465 Ga0501083_0248465_38_730 227
515 3300049822 Ga0501035_0000211 Ga0501035_0000211_63476_64168 227
516 3300049822 Ga0501035_0004250 Ga0501035_0004250_479_1162 227
517 3300049823 Ga0501044_0046803 Ga0501044_0046803_3147_3830 227
518 3300050489 nmdc:mga03683_724_c1 nmdc:mga03683_724_c1_4686_5369 227
519 3300050490 nmdc:mga03n38_33_c1 nmdc:mga03n38_33_c1_26723_27406 227
520 3300050491 nmdc:mga00v17_14983_c1 nmdc:mga00v17_14983_c1_3303_3986 227
521 3300050491 nmdc:mga00v17_25497_c1 nmdc:mga00v17_25497_c1_1713_2396 227
522 3300050491 nmdc:mga00v17_67780_c1 nmdc:mga00v17_67780_c1_1499_2182 227
523 3300050492 nmdc:mga0yw44_13_c1 nmdc:mga0yw44_13_c1_33427_34110 227
524 3300050492 nmdc:mga0yw44_31633_c1 nmdc:mga0yw44_31633_c1_720_1403 227
525 3300050492 nmdc:mga0yw44_92574_c1 nmdc:mga0yw44_92574_c1_218_901 227
526 3300050493 nmdc:mga0k408_113_c1 nmdc:mga0k408_113_c1_19989_20672 227
527 3300050493 nmdc:mga0k408_15872_c1 nmdc:mga0k408_15872_c1_1096_1779 227
528 3300050493 nmdc:mga0k408_179_c1 nmdc:mga0k408_179_c1_19247_19930 227
529 3300050493 nmdc:mga0k408_1961_c2 nmdc:mga0k408_1961_c2_7468_8151 227
530 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_1012993_1013676 227
531 3300050493 nmdc:mga0k408_2493_c1 nmdc:mga0k408_2493_c1_6554_7240 227
532 3300050493 nmdc:mga0k408_3268_c1 nmdc:mga0k408_3268_c1_4070_4762 227
533 3300050494 nmdc:mga06z11_224699_c1 nmdc:mga06z11_224699_c1_19_702 227
534 3300050494 nmdc:mga06z11_31_c1 nmdc:mga06z11_31_c1_48715_49398 227
535 3300050494 nmdc:mga06z11_74_c1 nmdc:mga06z11_74_c1_18172_18858 227
536 3300050495 nmdc:mga04h51_2_c1 nmdc:mga04h51_2_c1_113848_114531 227
537 3300050496 nmdc:mga07m45_39184_c1 nmdc:mga07m45_39184_c1_204_887 227
538 3300050496 nmdc:mga07m45_729_c1 nmdc:mga07m45_729_c1_5866_6549 227
539 3300050496 nmdc:mga07m45_7506_c1 nmdc:mga07m45_7506_c1_4811_5494 227
540 3300050496 nmdc:mga07m45_827_c1 nmdc:mga07m45_827_c1_4739_5422 227
541 3300050509 nmdc:mga0qj67_13114_c1 nmdc:mga0qj67_13114_c1_2237_2920 227
542 3300050511 nmdc:mga08y16_2629_c1 nmdc:mga08y16_2629_c1_14757_15440 227
543 3300050514 nmdc:mga08x19_215015_c1 nmdc:mga08x19_215015_c1_293_976 227
544 3300050516 nmdc:mga0sz30_12962_c1 nmdc:mga0sz30_12962_c1_2066_2749 227
545 3300050516 nmdc:mga0sz30_139004_c1 nmdc:mga0sz30_139004_c1_293_976 227
546 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_743103_743786 227
547 3300050516 nmdc:mga0sz30_4_c1 nmdc:mga0sz30_4_c1_73657_74340 227
548 3300050516 nmdc:mga0sz30_80399_c1 nmdc:mga0sz30_80399_c1_371_1054 227
549 3300053079 Ga0500610_0000002 Ga0500610_0000002_61370_62053 227
550 3300053087 Ga0500643_002124 Ga0500643_002124_8943_9626 227
551 3300053087 Ga0500643_022263 Ga0500643_022263_150_833 227
552 3300053088 Ga0500644_0000198 Ga0500644_0000198_20453_21136 227
553 3300053088 Ga0500644_0001954 Ga0500644_0001954_1253_1936 227
554 3300053088 Ga0500644_0021864 Ga0500644_0021864_801_1484 227
555 3300053090 Ga0500646_0000048 Ga0500646_0000048_27881_28585 227
556 3300053092 Ga0500583_0000057 Ga0500583_0000057_49820_50503 227
557 3300053092 Ga0500583_0004917 Ga0500583_0004917_1123_1827 227
558 3300053093 Ga0500651_0000019 Ga0500651_0000019_66425_67108 227
559 3300053093 Ga0500651_0000051 Ga0500651_0000051_4793_5479 227
560 3300053093 Ga0500651_0002735 Ga0500651_0002735_7669_8355 227
561 3300053093 Ga0500651_0122821 Ga0500651_0122821_201_905 227
562 3300053094 Ga0500566_0000001 Ga0500566_0000001_989666_990349 227
563 3300053098 Ga0500650_0000003 Ga0500650_0000003_966_1670 227
564 3300053098 Ga0500650_0012261 Ga0500650_0012261_467_1150 227
565 3300053103 Ga0500555_000001 Ga0500555_000001_1231250_1231936 227
566 3300053103 Ga0500555_000002 Ga0500555_000002_100507_101190 227
567 3300053108 Ga0500562_000001 Ga0500562_000001_616602_617288 227
568 3300053108 Ga0500562_000002 Ga0500562_000002_136825_137508 227
569 3300053108 Ga0500562_012684 Ga0500562_012684_445_1149 227
570 3300053118 Ga0500594_0000001 Ga0500594_0000001_303128_303832 227
571 3300053118 Ga0500594_0000034 Ga0500594_0000034_39916_40599 227
572 3300053118 Ga0500594_0000258 Ga0500594_0000258_7420_8103 227
573 3300053123 Ga0500614_000001 Ga0500614_000001_1153407_1154090 227
574 3300053126 Ga0500621_000694 Ga0500621_000694_2459_3142 227
575 3300053129 Ga0500628_000009 Ga0500628_000009_57770_58453 227
576 3300053129 Ga0500628_031681 Ga0500628_031681_385_1068 227
577 3300053131 Ga0500652_000695 Ga0500652_000695_4432_5115 227
578 3300053133 Ga0500655_000327 Ga0500655_000327_8796_9500 227
579 3300053136 Ga0500559_0009237 Ga0500559_0009237_2689_3372 227
580 3300053137 Ga0500561_0000001 Ga0500561_0000001_98958_99641 227
581 3300053142 Ga0500577_0000357 Ga0500577_0000357_2596_3279 227
582 3300053142 Ga0500577_0082762 Ga0500577_0082762_212_928 227
583 3300053143 Ga0500579_006408 Ga0500579_006408_3533_4237 227
584 3300053147 Ga0500589_000002 Ga0500589_000002_122507_123190 227
585 3300053150 Ga0500603_013046 Ga0500603_013046_203_886 227
586 3300053151 Ga0500604_0032448 Ga0500604_0032448_156_839 227
587 3300053160 Ga0500633_0016280 Ga0500633_0016280_745_1449 227
588 3300053722 Ga0500649_000002 Ga0500649_000002_36104_36787 227
589 3300053727 Ga0500611_003354 Ga0500611_003354_921_1604 227
590 3300060353 Ga0501082_0051798 Ga0501082_0051798_2749_3432 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

19

161

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9833 2 227
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9798 2 227
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9705 2 227
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9671 2 227
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.96 2 227
ID Description Score Start End Superfamily
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9834 1 225 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9748 1 225 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.951 2 222 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9499 2 221 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 1 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A087A2T3-F1-model_v4 Cell division ATP-binding protein FtsE 0.9861 2 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A6J6SH26-F1-model_v4 Cell division ATP-binding protein FtsE 0.9855 1 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A249L385-F1-model_v4 Cell division ATP-binding protein FtsE 0.9842 1 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A6J6SH26-F1-model_v4 Cell division ATP-binding protein FtsE 0.9812 1 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A2I1LMG1-F1-model_v4 deleted 0.9811 1 226

Feature Viewer

pLDDT pTM Quality
92.19 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map