F466941

General Info

Members Datasets Scaffolds Average Seq Length
590 236 590 247

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100170098|Ga0070660_1001700982
Length 258
Sequence VPGIPGGAAVNSGGVDTTVIAAFAVGFVSFISPCVLPLVPGYLSAVTGLSINEMKTGERSLLKILLPSIVFCLSFTVVFVALGMTATGIGSTLQSSKGTLDKIAGLVIIALGVFFLLTPFVPILNKEWRPDALISRAGSGGPLVAGAAFAVAWTPCIGPTLGSILSAAATQDTVGKGGILLAFYSLGLAVPFLLTAIAFTRMTTAFRWLRDRYLIVTAISGFVLIVMGLLLFTGELTQLNIKAQSWLDDLGLNFFKSV

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 6.95
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10040850 3300001990 Bacteria 1423
2 JGI25406J46586_10002467 3300003203 Bacteria 8744
3 JGI25407J50210_10008507 3300003373 Bacteria 2588
4 JGI25407J50210_10009070 3300003373 Bacteria 2514
5 JGI25407J50210_10018012 3300003373 Bacteria 1835
6 JGI25407J50210_10023460 3300003373 Bacteria 1601
7 JGI25407J50210_10036156 3300003373 Bacteria 1271
8 Ga0070658_10298391 3300005327 Bacteria 1374
9 Ga0070676_10068908 3300005328 Bacteria 2119
10 Ga0070683_100003128 3300005329 Bacteria 13332
11 Ga0070683_100082217 3300005329 Bacteria 3016
12 Ga0070683_100653778 3300005329 Bacteria 1006
13 Ga0070670_100079952 3300005331 Bacteria 2810
14 Ga0068869_100156531 3300005334 Bacteria 1771
15 Ga0068869_100177377 3300005334 Bacteria 1669
16 Ga0068869_100331155 3300005334 Bacteria 1237
17 Ga0068869_100403438 3300005334 Bacteria 1125
18 Ga0070680_100133213 3300005336 Bacteria 2080
19 Ga0070682_100008003 3300005337 Bacteria 5951
20 Ga0070682_100193034 3300005337 Bacteria 1431
21 Ga0068868_100036527 3300005338 Bacteria 3803
22 Ga0070660_100170098 3300005339 Bacteria 1760
23 Ga0070660_100254115 3300005339 Bacteria 1434
24 Ga0070689_100242936 3300005340 Bacteria 1483
25 Ga0070691_10013616 3300005341 Bacteria 3727
26 Ga0070687_100058870 3300005343 Bacteria 2020
27 Ga0070687_100061403 3300005343 Bacteria 1987
28 Ga0070661_100086896 3300005344 Bacteria 2312
29 Ga0070661_100171412 3300005344 Bacteria 1648
30 Ga0070661_100469862 3300005344 Bacteria 1003
31 Ga0070692_10029858 3300005345 Bacteria 2721
32 Ga0070668_100050855 3300005347 Bacteria 3192
33 Ga0070668_100265874 3300005347 Bacteria 1428
34 Ga0070668_100332451 3300005347 Bacteria 1282
35 Ga0070668_100748613 3300005347 Bacteria 865
36 Ga0070675_100122758 3300005354 Bacteria 2208
37 Ga0070674_100345025 3300005356 Bacteria 1201
38 Ga0070673_100210860 3300005364 Bacteria 1677
39 Ga0070659_100046843 3300005366 Bacteria 3390
40 Ga0070659_100403879 3300005366 Bacteria 1154
41 Ga0070705_100205798 3300005440 Bacteria 1353
42 Ga0070700_100247280 3300005441 Bacteria 1277
43 Ga0070700_100269391 3300005441 Bacteria 1230
44 Ga0070663_100125413 3300005455 Bacteria 1944
45 Ga0070663_100262323 3300005455 Bacteria 1371
46 Ga0070678_100091674 3300005456 Bacteria 2332
47 Ga0070678_100318190 3300005456 Bacteria 1328
48 Ga0070662_100004913 3300005457 Bacteria 8491
49 Ga0070662_100313544 3300005457 Bacteria 1277
50 Ga0070662_100375669 3300005457 Bacteria 1169
51 Ga0070662_100610517 3300005457 Bacteria 918
52 Ga0070681_10111935 3300005458 Bacteria 2669
53 Ga0070681_10153818 3300005458 Bacteria 2226
54 Ga0068867_100290692 3300005459 Bacteria 1343
55 Ga0068867_100351565 3300005459 Bacteria 1230
56 Ga0070685_10059210 3300005466 Bacteria 2235
57 Ga0070685_10099129 3300005466 Bacteria 1777
58 Ga0070679_100020722 3300005530 Bacteria 6415
59 Ga0070684_100001766 3300005535 Bacteria 15773
60 Ga0070684_100170373 3300005535 Bacteria 1977
61 Ga0070684_100256214 3300005535 Bacteria 1600
62 Ga0070684_100446156 3300005535 Bacteria 1196
63 Ga0070684_100673698 3300005535 Bacteria 964
64 Ga0068853_100167558 3300005539 Bacteria 1986
65 Ga0070672_100127968 3300005543 Bacteria 2085
66 Ga0070672_100150432 3300005543 Bacteria 1925
67 Ga0070686_100122771 3300005544 Bacteria 1785
68 Ga0070686_100376193 3300005544 Bacteria 1074
69 Ga0070686_100626948 3300005544 Bacteria 850
70 Ga0070695_100101975 3300005545 Bacteria 1934
71 Ga0070693_100075446 3300005547 Bacteria 1997
72 Ga0070693_100118322 3300005547 Bacteria 1640
73 Ga0070665_100016871 3300005548 Bacteria 7322
74 Ga0070665_100073421 3300005548 Bacteria 3427
75 Ga0070664_100399397 3300005564 Bacteria 1257
76 Ga0068854_100013176 3300005578 Bacteria 5420
77 Ga0068854_100070737 3300005578 Bacteria 2550
78 Ga0068854_100313992 3300005578 Bacteria 1272
79 Ga0068854_100576211 3300005578 Bacteria 958
80 Ga0068856_100018365 3300005614 Bacteria 6778
81 Ga0068856_100033740 3300005614 Bacteria 5012
82 Ga0068856_100148578 3300005614 Bacteria 2351
83 Ga0068856_100425693 3300005614 Bacteria 1348
84 Ga0068856_100500882 3300005614 Bacteria 1236
85 Ga0068856_100530242 3300005614 Bacteria 1199
86 Ga0070702_100054854 3300005615 Bacteria 2295
87 Ga0070702_100082249 3300005615 Bacteria 1932
88 Ga0070702_100116300 3300005615 Bacteria 1667
89 Ga0070702_100257569 3300005615 Bacteria 1186
90 Ga0068852_100007636 3300005616 Bacteria 7910
91 Ga0068852_100014730 3300005616 Bacteria 6034
92 Ga0068852_100048782 3300005616 Bacteria 3619
93 Ga0068852_100081895 3300005616 Bacteria 2866
94 Ga0068859_100232803 3300005617 Bacteria 1930
95 Ga0068864_100003127 3300005618 Bacteria 13679
96 Ga0068866_10184430 3300005718 Bacteria 1235
97 Ga0068861_100048317 3300005719 Bacteria 3216
98 Ga0068861_100087588 3300005719 Bacteria 2451
99 Ga0068858_100275114 3300005842 Bacteria 1603
100 Ga0068860_100536814 3300005843 Bacteria 1171
101 Ga0068862_100161932 3300005844 Bacteria 1998
102 Ga0068862_100376222 3300005844 Bacteria 1323
103 Ga0081455_10013238 3300005937 Bacteria 8169
104 Ga0081455_10050371 3300005937 Bacteria 3582
105 Ga0081455_10097402 3300005937 Bacteria 2370
106 Ga0081455_10133119 3300005937 Bacteria 1941
107 Ga0081538_10000259 3300005981 Bacteria 60118
108 Ga0081538_10000464 3300005981 Bacteria 45462
109 Ga0081538_10001367 3300005981 Bacteria 25112
110 Ga0081538_10001681 3300005981 Bacteria 22530
111 Ga0081538_10004023 3300005981 Bacteria 13688
112 Ga0081538_10004443 3300005981 Bacteria 12929
113 Ga0081538_10004469 3300005981 Bacteria 12885
114 Ga0081538_10006296 3300005981 Bacteria 10483
115 Ga0081538_10006778 3300005981 Bacteria 10009
116 Ga0081538_10011443 3300005981 Bacteria 7185
117 Ga0081538_10012184 3300005981 Bacteria 6910
118 Ga0081538_10013454 3300005981 Bacteria 6474
119 Ga0081538_10021110 3300005981 Bacteria 4769
120 Ga0081538_10022159 3300005981 Bacteria 4611
121 Ga0081538_10023244 3300005981 Bacteria 4462
122 Ga0081538_10025455 3300005981 Bacteria 4170
123 Ga0081538_10052297 3300005981 Bacteria 2442
124 Ga0081538_10103597 3300005981 Bacteria 1423
125 Ga0081538_10127687 3300005981 Bacteria 1204
126 Ga0081538_10137357 3300005981 Bacteria 1135
127 Ga0081540_1001988 3300005983 Bacteria 17057
128 Ga0081540_1089664 3300005983 Bacteria 1356
129 Ga0081539_10009179 3300005985 Bacteria 8340
130 Ga0075365_10044514 3300006038 Bacteria 2909
131 Ga0075363_100107377 3300006048 Bacteria 1549
132 Ga0075432_10016207 3300006058 Bacteria 2545
133 Ga0075432_10039436 3300006058 Bacteria 1647
134 Ga0070712_100265084 3300006175 Bacteria 1378
135 Ga0075428_100042084 3300006844 Bacteria 5025
136 Ga0075428_100110280 3300006844 Bacteria 2998
137 Ga0075428_100147835 3300006844 Bacteria 2554
138 Ga0075428_100564966 3300006844 Bacteria 1216
139 Ga0075430_100004041 3300006846 Bacteria 12381
140 Ga0075430_100006490 3300006846 Bacteria 9862
141 Ga0075430_100315407 3300006846 Bacteria 1293
142 Ga0075431_100045733 3300006847 Bacteria 4513
143 Ga0075431_100067922 3300006847 Bacteria 3680
144 Ga0075431_100183868 3300006847 Bacteria 2144
145 Ga0075431_100268211 3300006847 Bacteria 1731
146 Ga0075431_100489412 3300006847 Bacteria 1222
147 Ga0075433_10072042 3300006852 Bacteria 3038
148 Ga0075433_10526690 3300006852 Bacteria 1040
149 Ga0075434_100006331 3300006871 Bacteria 10855
150 Ga0075429_100041633 3300006880 Bacteria 4001
151 Ga0075429_100273943 3300006880 Bacteria 1478
152 Ga0075429_100420881 3300006880 Bacteria 1170
153 Ga0068865_100167231 3300006881 Bacteria 1682
154 Ga0068865_100268802 3300006881 Bacteria 1353
155 Ga0068865_100443693 3300006881 Bacteria 1071
156 Ga0075436_100340522 3300006914 Bacteria 1079
157 Ga0097620_100232801 3300006931 Bacteria 1930
158 Ga0075435_100138721 3300007076 Bacteria 2039
159 Ga0105240_10139447 3300009093 Bacteria 2900
160 Ga0111539_10099383 3300009094 Bacteria 3417
161 Ga0111539_10100992 3300009094 Bacteria 3387
162 Ga0111539_10146412 3300009094 Bacteria 2765
163 Ga0111539_10427148 3300009094 Bacteria 1543
164 Ga0105245_10014517 3300009098 Bacteria 6859
165 Ga0105245_10239110 3300009098 Bacteria 1759
166 Ga0105245_10454099 3300009098 Bacteria 1290
167 Ga0105245_10594386 3300009098 Bacteria 1133
168 Ga0105247_10544055 3300009101 Bacteria 853
169 Ga0114129_10000894 3300009147 Bacteria 38837
170 Ga0114129_10019446 3300009147 Bacteria 9670
171 Ga0114129_10175377 3300009147 Bacteria 2920
172 Ga0114129_10202071 3300009147 Bacteria 2691
173 Ga0114129_10326558 3300009147 Bacteria 2038
174 Ga0114129_10492223 3300009147 Bacteria 1603
175 Ga0114129_11334778 3300009147 Bacteria 887
176 Ga0105243_10013190 3300009148 Bacteria 6248
177 Ga0105243_10089870 3300009148 Bacteria 2526
178 Ga0105243_10309872 3300009148 Bacteria 1434
179 Ga0105243_10439611 3300009148 Bacteria 1221
180 Ga0105242_10542542 3300009176 Bacteria 1113
181 Ga0105248_10104467 3300009177 Bacteria 3194
182 Ga0105248_10190482 3300009177 Bacteria 2311
183 Ga0105237_10179970 3300009545 Bacteria 2115
184 Ga0105237_10359841 3300009545 Bacteria 1459
185 Ga0105238_10026826 3300009551 Bacteria 5872
186 Ga0105238_10186722 3300009551 Bacteria 2049
187 Ga0105238_10660997 3300009551 Bacteria 1055
188 Ga0105249_10042917 3300009553 Bacteria 4113
189 Ga0105249_10080368 3300009553 Bacteria 3028
190 Ga0105249_10127565 3300009553 Bacteria 2424
191 Ga0105030_105291 3300009987 Bacteria 1091
192 Ga0105239_10116718 3300010375 Bacteria 2962
193 Ga0105239_10209296 3300010375 Bacteria 2186
194 Ga0105239_10746437 3300010375 Bacteria 1120
195 Ga0105239_10938538 3300010375 Bacteria 994
196 Ga0105246_10867743 3300011119 Bacteria 806
197 Ga0157371_10133217 3300013102 Bacteria 1768
198 Ga0157370_10035271 3300013104 Bacteria 4865
199 Ga0157369_10132800 3300013105 Bacteria 2637
200 Ga0157374_10038085 3300013296 Bacteria 4418
201 Ga0157378_10307922 3300013297 Bacteria 1535
202 Ga0157378_10314616 3300013297 Bacteria 1519
203 Ga0163162_10145768 3300013306 Bacteria 2484
204 Ga0163162_10154357 3300013306 Bacteria 2415
205 Ga0157372_10124400 3300013307 Bacteria 2964
206 Ga0157372_10250158 3300013307 Bacteria 2057
207 Ga0157372_10319705 3300013307 Bacteria 1807
208 Ga0157372_10694025 3300013307 Bacteria 1185
209 Ga0157372_10824319 3300013307 Bacteria 1077
210 Ga0157375_10408259 3300013308 Bacteria 1524
211 Ga0157375_10430018 3300013308 Bacteria 1486
212 Ga0157380_11066468 3300014326 Bacteria 845
213 Ga0182008_10154604 3300014497 Bacteria 1152
214 Ga0157377_10002230 3300014745 Bacteria 8514
215 Ga0157377_10060860 3300014745 Bacteria 2156
216 Ga0157379_10003747 3300014968 Bacteria 12935
217 Ga0157379_10290227 3300014968 Bacteria 1489
218 Ga0157376_10202751 3300014969 Bacteria 1826
219 Ga0157376_10396081 3300014969 Bacteria 1334
220 Ga0157376_10727278 3300014969 Bacteria 1000
221 Ga0197907_10222571 3300020069 Bacteria 1262
222 Ga0206353_11379463 3300020082 Bacteria 1102
223 Ga0207688_10000574 3300025901 Bacteria 18050
224 Ga0207688_10006513 3300025901 Bacteria 6356
225 Ga0207688_10198410 3300025901 Bacteria 1202
226 Ga0207688_10389423 3300025901 Bacteria 863
227 Ga0207647_10090683 3300025904 Bacteria 1823
228 Ga0207645_10093615 3300025907 Bacteria 1934
229 Ga0207645_10143467 3300025907 Bacteria 1557
230 Ga0207645_10143468 3300025907 Bacteria 1557
231 Ga0207643_10023715 3300025908 Bacteria 3385
232 Ga0207643_10156109 3300025908 Bacteria 1371
233 Ga0207705_10317755 3300025909 Bacteria 1196
234 Ga0207707_10262225 3300025912 Bacteria 1499
235 Ga0207695_10141789 3300025913 Bacteria 2351
236 Ga0207671_10049230 3300025914 Bacteria 3119
237 Ga0207663_10146879 3300025916 Bacteria 1649
238 Ga0207662_10005381 3300025918 Bacteria 6819
239 Ga0207662_10022129 3300025918 Bacteria 3640
240 Ga0207662_10187226 3300025918 Bacteria 1334
241 Ga0207657_10015219 3300025919 Bacteria 7462
242 Ga0207657_10041961 3300025919 Bacteria 4041
243 Ga0207657_10062918 3300025919 Bacteria 3175
244 Ga0207649_10124207 3300025920 Bacteria 1744
245 Ga0207649_10129522 3300025920 Bacteria 1712
246 Ga0207649_10284819 3300025920 Bacteria 1203
247 Ga0207649_10553230 3300025920 Bacteria 881
248 Ga0207652_10148253 3300025921 Bacteria 2100
249 Ga0207652_10431003 3300025921 Bacteria 1189
250 Ga0207694_10263553 3300025924 Bacteria 1412
251 Ga0207650_10211989 3300025925 Bacteria 1556
252 Ga0207659_10570788 3300025926 Bacteria 963
253 Ga0207687_10108496 3300025927 Bacteria 2056
254 Ga0207687_10122235 3300025927 Bacteria 1949
255 Ga0207687_10138514 3300025927 Bacteria 1843
256 Ga0207687_10172367 3300025927 Bacteria 1670
257 Ga0207690_10137147 3300025932 Bacteria 1797
258 Ga0207690_10207043 3300025932 Bacteria 1493
259 Ga0207690_10228838 3300025932 Bacteria 1426
260 Ga0207690_10257404 3300025932 Bacteria 1351
261 Ga0207690_10311796 3300025932 Bacteria 1234
262 Ga0207690_10381561 3300025932 Bacteria 1120
263 Ga0207706_10021747 3300025933 Bacteria 5757
264 Ga0207706_10023352 3300025933 Bacteria 5554
265 Ga0207706_10670909 3300025933 Bacteria 887
266 Ga0207686_10209019 3300025934 Bacteria 1402
267 Ga0207709_10170908 3300025935 Bacteria 1525
268 Ga0207709_10265047 3300025935 Bacteria 1262
269 Ga0207670_10088808 3300025936 Bacteria 2180
270 Ga0207669_10081929 3300025937 Bacteria 2070
271 Ga0207704_10058065 3300025938 Bacteria 2381
272 Ga0207691_10092600 3300025940 Bacteria 2707
273 Ga0207711_10309987 3300025941 Bacteria 1457
274 Ga0207711_10611087 3300025941 Bacteria 1017
275 Ga0207689_10046842 3300025942 Bacteria 3572
276 Ga0207689_10126833 3300025942 Bacteria 2099
277 Ga0207661_10001491 3300025944 Bacteria 15841
278 Ga0207661_10003675 3300025944 Bacteria 10695
279 Ga0207661_10008054 3300025944 Bacteria 7512
280 Ga0207661_10444474 3300025944 Bacteria 1180
281 Ga0207679_10032825 3300025945 Bacteria 3649
282 Ga0207679_10252740 3300025945 Bacteria 1499
283 Ga0207679_10270878 3300025945 Bacteria 1452
284 Ga0207679_10313831 3300025945 Bacteria 1355
285 Ga0207679_10333253 3300025945 Bacteria 1317
286 Ga0207667_10252528 3300025949 Bacteria 1804
287 Ga0207651_10017591 3300025960 Bacteria 4227
288 Ga0207651_10150995 3300025960 Bacteria 1808
289 Ga0207712_10071593 3300025961 Bacteria 2494
290 Ga0207712_10215824 3300025961 Bacteria 1531
291 Ga0207712_10329593 3300025961 Bacteria 1262
292 Ga0207668_10080774 3300025972 Bacteria 2356
293 Ga0207668_10160366 3300025972 Bacteria 1752
294 Ga0207668_10197955 3300025972 Bacteria 1598
295 Ga0207640_10041111 3300025981 Bacteria 2938
296 Ga0207640_10070975 3300025981 Bacteria 2344
297 Ga0207640_10111271 3300025981 Bacteria 1942
298 Ga0207640_10327983 3300025981 Bacteria 1221
299 Ga0207640_10710990 3300025981 Bacteria 862
300 Ga0207677_10197367 3300026023 Bacteria 1597
301 Ga0207703_10061203 3300026035 Bacteria 3081
302 Ga0207703_10351681 3300026035 Bacteria 1357
303 Ga0207639_10246006 3300026041 Bacteria 1557
304 Ga0207639_10300818 3300026041 Bacteria 1418
305 Ga0207639_10645585 3300026041 Bacteria 979
306 Ga0207678_10016804 3300026067 Bacteria 6428
307 Ga0207678_10048920 3300026067 Bacteria 3653
308 Ga0207708_10001896 3300026075 Bacteria 15450
309 Ga0207708_10094677 3300026075 Bacteria 2306
310 Ga0207708_10140641 3300026075 Bacteria 1893
311 Ga0207708_10214256 3300026075 Bacteria 1541
312 Ga0207708_10272168 3300026075 Bacteria 1370
313 Ga0207702_10104288 3300026078 Bacteria 2509
314 Ga0207702_10104983 3300026078 Bacteria 2502
315 Ga0207702_10165912 3300026078 Bacteria 2020
316 Ga0207702_10535797 3300026078 Bacteria 1144
317 Ga0207648_10085891 3300026089 Bacteria 2745
318 Ga0207648_10152151 3300026089 Bacteria 2042
319 Ga0207648_10353966 3300026089 Bacteria 1324
320 Ga0207674_10126849 3300026116 Bacteria 2517
321 Ga0207674_10150677 3300026116 Bacteria 2283
322 Ga0207674_10496884 3300026116 Bacteria 1179
323 Ga0207675_100004077 3300026118 Bacteria 14141
324 Ga0207675_100156993 3300026118 Bacteria 2168
325 Ga0207675_100206488 3300026118 Bacteria 1888
326 Ga0207675_100437102 3300026118 Bacteria 1295
327 Ga0207683_10098731 3300026121 Bacteria 2606
328 Ga0207683_10363572 3300026121 Bacteria 1329
329 Ga0207683_10512770 3300026121 Bacteria 1108
330 Ga0207683_10695381 3300026121 Bacteria 943
331 Ga0207698_10095613 3300026142 Bacteria 2446
332 Ga0207698_10270513 3300026142 Bacteria 1566
333 Ga0207698_10299250 3300026142 Bacteria 1497
334 Ga0207698_10615811 3300026142 Bacteria 1072
335 Ga0207428_10063126 3300027907 Bacteria 2927
336 Ga0207428_10098151 3300027907 Bacteria 2267
337 Ga0207428_10162337 3300027907 Bacteria 1696
338 Ga0268266_10055305 3300028379 Bacteria 3412
339 Ga0268265_10447133 3300028380 Bacteria 1206
340 Ga0268264_10216867 3300028381 Bacteria 1760
341 Ga0307405_10029550 3300031731 Bacteria 3205
342 Ga0307405_10143644 3300031731 Bacteria 1668
343 Ga0307405_10184845 3300031731 Bacteria 1500
344 Ga0307405_10404849 3300031731 Bacteria 1069
345 Ga0307413_10043767 3300031824 Bacteria 2641
346 Ga0307413_10056307 3300031824 Bacteria 2398
347 Ga0307413_10400550 3300031824 Bacteria 1075
348 Ga0307413_10623326 3300031824 Bacteria 886
349 Ga0307410_10037945 3300031852 Bacteria 3152
350 Ga0307410_10064772 3300031852 Bacteria 2512
351 Ga0307410_10085789 3300031852 Bacteria 2223
352 Ga0307410_10129448 3300031852 Bacteria 1852
353 Ga0307410_10276485 3300031852 Bacteria 1316
354 Ga0307410_10587070 3300031852 Bacteria 928
355 Ga0307406_10091528 3300031901 Bacteria 2049
356 Ga0307406_10137733 3300031901 Bacteria 1723
357 Ga0307406_10170666 3300031901 Bacteria 1574
358 Ga0307406_10433423 3300031901 Bacteria 1050
359 Ga0307406_10502959 3300031901 Bacteria 983
360 Ga0307406_10577316 3300031901 Bacteria 924
361 Ga0307407_10139274 3300031903 Bacteria 1563
362 Ga0307407_10230447 3300031903 Bacteria 1258
363 Ga0307412_10080143 3300031911 Bacteria 2255
364 Ga0307412_10093667 3300031911 Bacteria 2108
365 Ga0307409_100003036 3300031995 Bacteria 8970
366 Ga0307409_100022746 3300031995 Bacteria 4326
367 Ga0307409_100027002 3300031995 Bacteria 4061
368 Ga0307409_100032917 3300031995 Bacteria 3766
369 Ga0307409_100036818 3300031995 Bacteria 3601
370 Ga0307409_100787805 3300031995 Bacteria 957
371 Ga0307416_100027810 3300032002 Bacteria 4195
372 Ga0307416_100033057 3300032002 Bacteria 3917
373 Ga0307416_100035108 3300032002 Bacteria 3825
374 Ga0307416_100041584 3300032002 Bacteria 3581
375 Ga0307416_100074384 3300032002 Bacteria 2838
376 Ga0307416_100160694 3300032002 Bacteria 2076
377 Ga0307416_100206138 3300032002 Bacteria 1871
378 Ga0307416_100425155 3300032002 Bacteria 1374
379 Ga0307416_100426642 3300032002 Bacteria 1372
380 Ga0307416_100464265 3300032002 Bacteria 1322
381 Ga0307416_101356117 3300032002 Bacteria 817
382 Ga0307414_10192950 3300032004 Bacteria 1650
383 Ga0307411_10105111 3300032005 Bacteria 2007
384 Ga0307411_10281518 3300032005 Bacteria 1324
385 Ga0307415_100003888 3300032126 Bacteria 7674
386 Ga0307415_100008278 3300032126 Bacteria 5756
387 Ga0307415_100014045 3300032126 Bacteria 4694
388 Ga0307415_100014488 3300032126 Bacteria 4638
389 Ga0307415_100015841 3300032126 Bacteria 4476
390 Ga0307415_100049321 3300032126 Bacteria 2846
391 Ga0307415_100118736 3300032126 Bacteria 1978
392 Ga0307415_100317086 3300032126 Bacteria 1298
393 Ga0373929_0030967 3300035085 Bacteria 1144
394 Ga0395900_0286144 3300037418 Bacteria 1639
395 Ga0395900_0704381 3300037418 Bacteria 943
396 Ga0395898_0142728 3300037466 Bacteria 2293
397 Ga0395898_0269748 3300037466 Bacteria 1623
398 Ga0395898_0502795 3300037466 Bacteria 1153
399 Ga0395901_0190326 3300038443 Bacteria 2152
400 Ga0395901_0330540 3300038443 Bacteria 1576
401 Ga0395901_0637015 3300038443 Bacteria 1071
402 Ga0439448_0032507 3300042005 Bacteria 1661
403 Ga0439460_0097386 3300042461 Bacteria 941
404 Ga0466963_0048131 3300044694 Bacteria 2815
405 Ga0466963_0089361 3300044694 Bacteria 2096
406 Ga0466963_0097756 3300044694 Bacteria 2006
407 Ga0466963_0163823 3300044694 Bacteria 1548
408 Ga0466963_0226953 3300044694 Bacteria 1308
409 Ga0466963_0228824 3300044694 Bacteria 1303
410 Ga0466957_0192054 3300044842 Bacteria 1338
411 Ga0466957_0234986 3300044842 Bacteria 1214
412 Ga0466957_0257770 3300044842 Bacteria 1161
413 Ga0466960_0000054 3300044901 Bacteria 38136
414 Ga0466960_0017827 3300044901 Bacteria 3104
415 Ga0466960_0053547 3300044901 Bacteria 1956
416 Ga0466960_0057360 3300044901 Bacteria 1899
417 Ga0466960_0067887 3300044901 Bacteria 1767
418 Ga0466960_0077010 3300044901 Bacteria 1672
419 Ga0466960_0095845 3300044901 Bacteria 1520
420 Ga0466960_0152734 3300044901 Bacteria 1235
421 Ga0466958_0148940 3300045836 Bacteria 1476
422 Ga0466967_0009693 3300045976 Bacteria 7166
423 Ga0466967_0019837 3300045976 Bacteria 5416
424 Ga0466967_0025253 3300045976 Bacteria 4897
425 Ga0466967_0033230 3300045976 Bacteria 4365
426 Ga0466967_0055312 3300045976 Bacteria 3495
427 Ga0466967_0102218 3300045976 Bacteria 2621
428 Ga0466967_0127521 3300045976 Bacteria 2358
429 Ga0466967_0143185 3300045976 Bacteria 2228
430 Ga0466967_0204909 3300045976 Bacteria 1869
431 Ga0466967_0230694 3300045976 Bacteria 1762
432 Ga0466967_0236559 3300045976 Bacteria 1741
433 Ga0466967_0262886 3300045976 Bacteria 1651
434 Ga0466967_0515325 3300045976 Bacteria 1175
435 Ga0466967_0987577 3300045976 Bacteria 838
436 Ga0495603_0302887 3300046455 Bacteria 918
437 Ga0495641_0096036 3300046461 Bacteria 1323
438 Ga0495650_0000055 3300046471 Bacteria 308438
439 Ga0495582_0126714 3300046473 Bacteria 1441
440 Ga0495605_0102413 3300046474 Bacteria 1315
441 Ga0495605_0186812 3300046474 Bacteria 909
442 Ga0495596_0045089 3300046500 Bacteria 1734
443 Ga0495620_0096847 3300046515 Bacteria 1179
444 Ga0495609_0155537 3300046538 Bacteria 971
445 Ga0495656_0017373 3300046615 Bacteria 2745
446 Ga0495656_0126057 3300046615 Bacteria 1214
447 Ga0495589_0074591 3300046794 Bacteria 1655
448 Ga0495672_0037799 3300047320 Bacteria 2951
449 Ga0495677_0126485 3300047445 Bacteria 977
450 Ga0496100_0045634 3300048903 Bacteria 2813
451 Ga0496100_0096104 3300048903 Bacteria 2032
452 Ga0496101_0032417 3300048904 Bacteria 3678
453 Ga0496101_0065877 3300048904 Bacteria 2641
454 Ga0496102_0031443 3300048905 Bacteria 4762
455 Ga0496102_0198279 3300048905 Bacteria 1892
456 Ga0496104_0001966 3300048907 Bacteria 17806
457 Ga0496104_0004059 3300048907 Bacteria 12695
458 Ga0496104_0105909 3300048907 Bacteria 2695
459 Ga0496106_0010331 3300048909 Bacteria 6899
460 Ga0496106_0013317 3300048909 Bacteria 6071
461 Ga0496106_0151383 3300048909 Bacteria 1830
462 Ga0496106_0646897 3300048909 Bacteria 845
463 Ga0496107_0002481 3300048910 Bacteria 11975
464 Ga0496108_0000326 3300048911 Bacteria 40459
465 Ga0496108_0030203 3300048911 Bacteria 4491
466 Ga0496108_0037667 3300048911 Bacteria 4029
467 Ga0496108_0066593 3300048911 Bacteria 3037
468 Ga0496108_0199579 3300048911 Bacteria 1736
469 Ga0496108_0238099 3300048911 Bacteria 1583
470 Ga0496109_0006974 3300048912 Bacteria 9535
471 Ga0496109_0228664 3300048912 Bacteria 1749
472 Ga0496109_0268445 3300048912 Bacteria 1607
473 Ga0496110_0003062 3300048913 Bacteria 12675
474 Ga0496110_0065321 3300048913 Bacteria 3216
475 Ga0496111_0012838 3300048914 Bacteria 5684
476 Ga0496111_0195168 3300048914 Bacteria 1505
477 Ga0496112_0021423 3300048915 Bacteria 6147
478 Ga0496112_0041263 3300048915 Bacteria 4514
479 Ga0496112_0140653 3300048915 Bacteria 2383
480 Ga0496112_0187651 3300048915 Bacteria 2030
481 Ga0496112_0805430 3300048915 Bacteria 864
482 Ga0496113_0000503 3300048916 Bacteria 19274
483 Ga0496113_0056333 3300048916 Bacteria 2951
484 Ga0496113_0063088 3300048916 Bacteria 2800
485 Ga0496113_0141334 3300048916 Bacteria 1894
486 Ga0496113_0144274 3300048916 Bacteria 1875
487 Ga0496114_0056194 3300048917 Bacteria 3284
488 Ga0496114_0251886 3300048917 Bacteria 1554
489 Ga0496115_0027586 3300048918 Bacteria 4444
490 Ga0496115_0513395 3300048918 Bacteria 962
491 Ga0496121_0002905 3300048924 Bacteria 25149
492 Ga0496121_0040466 3300048924 Bacteria 4088
493 Ga0501031_0015366 3300049568 Bacteria 4972
494 Ga0501031_0107329 3300049568 Bacteria 1823
495 Ga0501031_0128007 3300049568 Bacteria 1659
496 Ga0501031_0413723 3300049568 Bacteria 872
497 Ga0501032_0120371 3300049569 Bacteria 1735
498 Ga0501033_0008996 3300049570 Bacteria 7707
499 Ga0501036_0007946 3300049572 Bacteria 8681
500 Ga0501036_0075654 3300049572 Bacteria 2847
501 Ga0501036_0090562 3300049572 Bacteria 2584
502 Ga0501036_0095413 3300049572 Bacteria 2514
503 Ga0501036_0166909 3300049572 Bacteria 1855
504 Ga0501037_0248786 3300049573 Bacteria 1244
505 Ga0501039_0054318 3300049575 Bacteria 3100
506 Ga0501039_0163777 3300049575 Bacteria 1748
507 Ga0501039_0222059 3300049575 Bacteria 1485
508 Ga0501039_0474536 3300049575 Bacteria 982
509 Ga0501040_0021069 3300049576 Bacteria 4347
510 Ga0501040_0097982 3300049576 Bacteria 2043
511 Ga0501040_0155654 3300049576 Bacteria 1614
512 Ga0501042_0090369 3300049578 Bacteria 2198
513 Ga0501042_0092001 3300049578 Bacteria 2177
514 Ga0501046_0003186 3300049580 Bacteria 15124
515 Ga0501046_0471848 3300049580 Bacteria 901
516 Ga0501047_0130957 3300049581 Bacteria 2389
517 Ga0501048_0033937 3300049582 Bacteria 3684
518 Ga0501048_0177021 3300049582 Bacteria 1512
519 Ga0501048_0407300 3300049582 Bacteria 972
520 Ga0501067_0040249 3300049583 Bacteria 2596
521 Ga0501068_0005484 3300049584 Bacteria 6950
522 Ga0501068_0248030 3300049584 Bacteria 1134
523 Ga0501068_0294708 3300049584 Bacteria 1038
524 Ga0501069_0001850 3300049585 Bacteria 10563
525 Ga0501070_0002054 3300049586 Bacteria 17680
526 Ga0501071_0011497 3300049587 Bacteria 5968
527 Ga0501071_0126020 3300049587 Bacteria 1901
528 Ga0501072_0021769 3300049588 Bacteria 4971
529 Ga0501072_0103323 3300049588 Bacteria 2265
530 Ga0501072_0122749 3300049588 Bacteria 2069
531 Ga0501072_0307924 3300049588 Bacteria 1259
532 Ga0501074_0197442 3300049590 Bacteria 1434
533 Ga0501075_0012953 3300049591 Bacteria 5941
534 Ga0501075_0017348 3300049591 Bacteria 5201
535 Ga0501075_0044675 3300049591 Bacteria 3324
536 Ga0501076_0016599 3300049592 Bacteria 5583
537 Ga0501076_0019685 3300049592 Bacteria 5161
538 Ga0501076_0089428 3300049592 Bacteria 2475
539 Ga0501079_0134842 3300049741 Bacteria 1922
540 Ga0501079_0366495 3300049741 Bacteria 1129
541 Ga0501081_0040435 3300049743 Bacteria 3193
542 Ga0501081_0068409 3300049743 Bacteria 2472
543 Ga0501081_0597543 3300049743 Bacteria 826
544 Ga0501083_0004221 3300049744 Bacteria 10119
545 Ga0501083_0300641 3300049744 Bacteria 1044
546 Ga0501083_0393486 3300049744 Bacteria 902
547 Ga0501035_0319915 3300049822 Bacteria 1304
548 Ga0501045_0134886 3300049824 Bacteria 1835
549 nmdc:mga03n38_83068_c1 3300050490 Bacteria 1509
550 nmdc:mga0yw44_296812_c1 3300050492 Bacteria 1082
551 nmdc:mga05p37_1195281_c1 3300050507 Bacteria 786
552 nmdc:mga05p37_432160_c1 3300050507 Bacteria 1529
553 nmdc:mga05p37_94787_c1 3300050507 Bacteria 3677
554 nmdc:mga09592_397683_c1 3300050508 Bacteria 1191
555 nmdc:mga09592_788548_c1 3300050508 Bacteria 804
556 nmdc:mga09592_95482_c1 3300050508 Bacteria 2543
557 nmdc:mga0qj67_10324_c1 3300050509 Bacteria 6975
558 nmdc:mga0qj67_190975_c1 3300050509 Bacteria 1664
559 nmdc:mga0qj67_446_c1 3300050509 Bacteria 28226
560 nmdc:mga06r32_145332_c1 3300050510 Bacteria 2349
561 nmdc:mga06r32_18055_c1 3300050510 Bacteria 6451
562 nmdc:mga06r32_530314_c1 3300050510 Bacteria 1152
563 nmdc:mga06r32_78865_c1 3300050510 Bacteria 3202
564 nmdc:mga06r32_96700_c1 3300050510 Bacteria 2892
565 nmdc:mga08y16_120495_c1 3300050511 Bacteria 2730
566 nmdc:mga08y16_140265_c1 3300050511 Bacteria 2513
567 nmdc:mga08y16_55395_c1 3300050511 Bacteria 4143
568 nmdc:mga08y16_97723_c1 3300050511 Bacteria 3058
569 nmdc:mga0n895_174491_c1 3300050512 Bacteria 2181
570 nmdc:mga0n895_320794_c1 3300050512 Bacteria 1570
571 nmdc:mga08x19_42335_c1 3300050514 Bacteria 2903
572 nmdc:mga0a205_109360_c1 3300050515 Bacteria 2662
573 nmdc:mga0a205_137141_c1 3300050515 Bacteria 2347
574 nmdc:mga0a205_167524_c1 3300050515 Bacteria 2093
575 Ga0500556_0000817 3300053104 Bacteria 17987
576 Ga0500568_0105172 3300053139 Bacteria 1058
577 Ga0500616_0002891 3300053153 Bacteria 13758
578 Ga0500616_0021454 3300053153 Bacteria 3621
579 Ga0501084_0089920 3300054114 Bacteria 2577
580 Ga0501084_0096740 3300054114 Bacteria 2479
581 Ga0501084_0109542 3300054114 Bacteria 2320
582 Ga0501084_0284490 3300054114 Bacteria 1396
583 Ga0501084_0294738 3300054114 Bacteria 1370
584 Ga0501082_0002632 3300060353 Bacteria 15690
585 Ga0501082_0036340 3300060353 Bacteria 4244
586 Ga0501082_0135649 3300060353 Bacteria 2135
587 Ga0501082_0585324 3300060353 Bacteria 976
588 Ga0530510_0073686 3300061734 Bacteria 2479
589 Ga0530510_0289155 3300061734 Bacteria 1225
590 Ga0530510_0326061 3300061734 Bacteria 1151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10433423 Ga0307406_104334232 204
2 3300049590 Ga0501074_0197442 Ga0501074_0197442_589_1236 205
3 3300037466 Ga0395898_0502795 Ga0395898_0502795_464_1135 208
4 3300045976 Ga0466967_0515325 Ga0466967_0515325_488_1162 209
5 3300048914 Ga0496111_0195168 Ga0496111_0195168_811_1485 209
6 3300005981 Ga0081538_10001367 Ga0081538_1000136725 210
7 3300045976 Ga0466967_0204909 Ga0466967_0204909_892_1647 220
8 3300005457 Ga0070662_100610517 Ga0070662_1006105171 221
9 3300003373 JGI25407J50210_10036156 JGI25407J50210_100361562 224
10 3300005981 Ga0081538_10004469 Ga0081538_1000446912 224
11 3300005981 Ga0081538_10022159 Ga0081538_100221594 225
12 3300049741 Ga0501079_0134842 Ga0501079_0134842_405_1127 225
13 3300026075 Ga0207708_10272168 Ga0207708_102721682 228
14 3300020069 Ga0197907_10222571 Ga0197907_102225712 229
15 3300005347 Ga0070668_100748613 Ga0070668_1007486131 230
16 3300044901 Ga0466960_0053547 Ga0466960_0053547_308_1048 231
17 3300046474 Ga0495605_0186812 Ga0495605_0186812_138_881 231
18 3300025908 Ga0207643_10156109 Ga0207643_101561092 232
19 3300031903 Ga0307407_10230447 Ga0307407_102304472 232
20 3300045976 Ga0466967_0143185 Ga0466967_0143185_570_1313 232
21 3300045976 Ga0466967_0230694 Ga0466967_0230694_857_1600 232
22 3300048924 Ga0496121_0002905 Ga0496121_0002905_15679_16422 232
23 3300049568 Ga0501031_0015366 Ga0501031_0015366_3912_4664 232
24 3300049569 Ga0501032_0120371 Ga0501032_0120371_272_1024 232
25 3300049570 Ga0501033_0008996 Ga0501033_0008996_5387_6139 232
26 3300049572 Ga0501036_0007946 Ga0501036_0007946_6426_7178 232
27 3300049573 Ga0501037_0248786 Ga0501037_0248786_390_1142 232
28 3300049575 Ga0501039_0163777 Ga0501039_0163777_222_974 232
29 3300049580 Ga0501046_0003186 Ga0501046_0003186_36_788 232
30 3300049583 Ga0501067_0040249 Ga0501067_0040249_35_787 232
31 3300049584 Ga0501068_0005484 Ga0501068_0005484_4612_5364 232
32 3300049584 Ga0501068_0294708 Ga0501068_0294708_209_964 232
33 3300049585 Ga0501069_0001850 Ga0501069_0001850_8323_9075 232
34 3300049586 Ga0501070_0002054 Ga0501070_0002054_8663_9415 232
35 3300049744 Ga0501083_0004221 Ga0501083_0004221_7551_8303 232
36 3300060353 Ga0501082_0002632 Ga0501082_0002632_1662_2414 232
37 3300003373 JGI25407J50210_10008507 JGI25407J50210_100085072 233
38 3300003373 JGI25407J50210_10009070 JGI25407J50210_100090702 233
39 3300003373 JGI25407J50210_10018012 JGI25407J50210_100180123 233
40 3300003373 JGI25407J50210_10023460 JGI25407J50210_100234602 233
41 3300005327 Ga0070658_10298391 Ga0070658_102983912 233
42 3300005329 Ga0070683_100003128 Ga0070683_10000312811 233
43 3300005329 Ga0070683_100653778 Ga0070683_1006537781 233
44 3300005334 Ga0068869_100156531 Ga0068869_1001565313 233
45 3300005334 Ga0068869_100403438 Ga0068869_1004034382 233
46 3300005336 Ga0070680_100133213 Ga0070680_1001332132 233
47 3300005337 Ga0070682_100193034 Ga0070682_1001930342 233
48 3300005339 Ga0070660_100254115 Ga0070660_1002541152 233
49 3300005341 Ga0070691_10013616 Ga0070691_100136162 233
50 3300005344 Ga0070661_100086896 Ga0070661_1000868962 233
51 3300005344 Ga0070661_100469862 Ga0070661_1004698622 233
52 3300005347 Ga0070668_100265874 Ga0070668_1002658742 233
53 3300005347 Ga0070668_100332451 Ga0070668_1003324512 233
54 3300005356 Ga0070674_100345025 Ga0070674_1003450252 233
55 3300005366 Ga0070659_100046843 Ga0070659_1000468432 233
56 3300005441 Ga0070700_100269391 Ga0070700_1002693912 233
57 3300005455 Ga0070663_100262323 Ga0070663_1002623232 233
58 3300005456 Ga0070678_100318190 Ga0070678_1003181902 233
59 3300005457 Ga0070662_100004913 Ga0070662_1000049138 233
60 3300005457 Ga0070662_100375669 Ga0070662_1003756692 233
61 3300005458 Ga0070681_10111935 Ga0070681_101119353 233
62 3300005458 Ga0070681_10153818 Ga0070681_101538184 233
63 3300005459 Ga0068867_100351565 Ga0068867_1003515652 233
64 3300005530 Ga0070679_100020722 Ga0070679_1000207223 233
65 3300005535 Ga0070684_100170373 Ga0070684_1001703733 233
66 3300005535 Ga0070684_100256214 Ga0070684_1002562143 233
67 3300005535 Ga0070684_100673698 Ga0070684_1006736981 233
68 3300005543 Ga0070672_100150432 Ga0070672_1001504322 233
69 3300005544 Ga0070686_100376193 Ga0070686_1003761932 233
70 3300005548 Ga0070665_100016871 Ga0070665_1000168718 233
71 3300005564 Ga0070664_100399397 Ga0070664_1003993972 233
72 3300005578 Ga0068854_100313992 Ga0068854_1003139922 233
73 3300005614 Ga0068856_100018365 Ga0068856_1000183655 233
74 3300005616 Ga0068852_100007636 Ga0068852_1000076362 233
75 3300005719 Ga0068861_100048317 Ga0068861_1000483173 233
76 3300005844 Ga0068862_100161932 Ga0068862_1001619324 233
77 3300005937 Ga0081455_10050371 Ga0081455_100503716 233
78 3300005937 Ga0081455_10097402 Ga0081455_100974022 233
79 3300005937 Ga0081455_10133119 Ga0081455_101331191 233
80 3300005981 Ga0081538_10000259 Ga0081538_1000025936 233
81 3300005981 Ga0081538_10000464 Ga0081538_1000046442 233
82 3300005981 Ga0081538_10001681 Ga0081538_1000168113 233
83 3300005981 Ga0081538_10004023 Ga0081538_100040238 233
84 3300005981 Ga0081538_10004443 Ga0081538_1000444316 233
85 3300005981 Ga0081538_10006296 Ga0081538_100062967 233
86 3300005981 Ga0081538_10006778 Ga0081538_1000677811 233
87 3300005981 Ga0081538_10011443 Ga0081538_100114433 233
88 3300005981 Ga0081538_10012184 Ga0081538_100121845 233
89 3300005981 Ga0081538_10013454 Ga0081538_100134548 233
90 3300005981 Ga0081538_10021110 Ga0081538_100211103 233
91 3300005981 Ga0081538_10023244 Ga0081538_100232442 233
92 3300005981 Ga0081538_10025455 Ga0081538_100254552 233
93 3300005981 Ga0081538_10052297 Ga0081538_100522974 233
94 3300005981 Ga0081538_10103597 Ga0081538_101035972 233
95 3300005981 Ga0081538_10127687 Ga0081538_101276872 233
96 3300005981 Ga0081538_10137357 Ga0081538_101373572 233
97 3300005983 Ga0081540_1089664 Ga0081540_10896642 233
98 3300006038 Ga0075365_10044514 Ga0075365_100445142 233
99 3300006048 Ga0075363_100107377 Ga0075363_1001073772 233
100 3300006058 Ga0075432_10016207 Ga0075432_100162075 233
101 3300006058 Ga0075432_10039436 Ga0075432_100394363 233
102 3300006844 Ga0075428_100042084 Ga0075428_1000420843 233
103 3300006844 Ga0075428_100110280 Ga0075428_1001102805 233
104 3300006844 Ga0075428_100147835 Ga0075428_1001478352 233
105 3300006844 Ga0075428_100564966 Ga0075428_1005649662 233
106 3300006846 Ga0075430_100004041 Ga0075430_1000040414 233
107 3300006846 Ga0075430_100006490 Ga0075430_1000064903 233
108 3300006846 Ga0075430_100315407 Ga0075430_1003154072 233
109 3300006847 Ga0075431_100045733 Ga0075431_1000457334 233
110 3300006847 Ga0075431_100067922 Ga0075431_1000679223 233
111 3300006847 Ga0075431_100268211 Ga0075431_1002682113 233
112 3300006852 Ga0075433_10526690 Ga0075433_105266902 233
113 3300006880 Ga0075429_100041633 Ga0075429_1000416334 233
114 3300006880 Ga0075429_100273943 Ga0075429_1002739432 233
115 3300006880 Ga0075429_100420881 Ga0075429_1004208812 233
116 3300006881 Ga0068865_100268802 Ga0068865_1002688022 233
117 3300006881 Ga0068865_100443693 Ga0068865_1004436931 233
118 3300009093 Ga0105240_10139447 Ga0105240_101394473 233
119 3300009094 Ga0111539_10099383 Ga0111539_100993833 233
120 3300009094 Ga0111539_10100992 Ga0111539_101009923 233
121 3300009094 Ga0111539_10427148 Ga0111539_104271483 233
122 3300009098 Ga0105245_10239110 Ga0105245_102391102 233
123 3300009098 Ga0105245_10454099 Ga0105245_104540992 233
124 3300009147 Ga0114129_10000894 Ga0114129_1000089412 233
125 3300009147 Ga0114129_10019446 Ga0114129_100194462 233
126 3300009147 Ga0114129_10175377 Ga0114129_101753774 233
127 3300009147 Ga0114129_10326558 Ga0114129_103265584 233
128 3300009147 Ga0114129_10492223 Ga0114129_104922232 233
129 3300009147 Ga0114129_11334778 Ga0114129_113347782 233
130 3300009148 Ga0105243_10309872 Ga0105243_103098722 233
131 3300009148 Ga0105243_10439611 Ga0105243_104396112 233
132 3300009176 Ga0105242_10542542 Ga0105242_105425421 233
133 3300009545 Ga0105237_10359841 Ga0105237_103598411 233
134 3300009551 Ga0105238_10026826 Ga0105238_100268263 233
135 3300009551 Ga0105238_10660997 Ga0105238_106609972 233
136 3300009553 Ga0105249_10042917 Ga0105249_100429172 233
137 3300009987 Ga0105030_105291 Ga0105030_1052912 233
138 3300010375 Ga0105239_10209296 Ga0105239_102092962 233
139 3300010375 Ga0105239_10746437 Ga0105239_107464371 233
140 3300010375 Ga0105239_10938538 Ga0105239_109385382 233
141 3300011119 Ga0105246_10867743 Ga0105246_108677431 233
142 3300013104 Ga0157370_10035271 Ga0157370_100352715 233
143 3300013105 Ga0157369_10132800 Ga0157369_101328002 233
144 3300013306 Ga0163162_10145768 Ga0163162_101457683 233
145 3300013307 Ga0157372_10250158 Ga0157372_102501582 233
146 3300013307 Ga0157372_10824319 Ga0157372_108243191 233
147 3300013308 Ga0157375_10430018 Ga0157375_104300182 233
148 3300014969 Ga0157376_10727278 Ga0157376_107272781 233
149 3300025901 Ga0207688_10389423 Ga0207688_103894231 233
150 3300025907 Ga0207645_10093615 Ga0207645_100936151 233
151 3300025907 Ga0207645_10143468 Ga0207645_101434682 233
152 3300025909 Ga0207705_10317755 Ga0207705_103177552 233
153 3300025912 Ga0207707_10262225 Ga0207707_102622252 233
154 3300025913 Ga0207695_10141789 Ga0207695_101417892 233
155 3300025914 Ga0207671_10049230 Ga0207671_100492303 233
156 3300025918 Ga0207662_10187226 Ga0207662_101872263 233
157 3300025919 Ga0207657_10015219 Ga0207657_100152194 233
158 3300025920 Ga0207649_10124207 Ga0207649_101242073 233
159 3300025920 Ga0207649_10553230 Ga0207649_105532301 233
160 3300025921 Ga0207652_10148253 Ga0207652_101482532 233
161 3300025924 Ga0207694_10263553 Ga0207694_102635532 233
162 3300025927 Ga0207687_10108496 Ga0207687_101084962 233
163 3300025927 Ga0207687_10138514 Ga0207687_101385143 233
164 3300025927 Ga0207687_10172367 Ga0207687_101723671 233
165 3300025932 Ga0207690_10137147 Ga0207690_101371471 233
166 3300025932 Ga0207690_10207043 Ga0207690_102070431 233
167 3300025932 Ga0207690_10228838 Ga0207690_102288382 233
168 3300025932 Ga0207690_10311796 Ga0207690_103117962 233
169 3300025933 Ga0207706_10021747 Ga0207706_100217472 233
170 3300025933 Ga0207706_10670909 Ga0207706_106709091 233
171 3300025944 Ga0207661_10001491 Ga0207661_1000149116 233
172 3300025944 Ga0207661_10008054 Ga0207661_100080547 233
173 3300025944 Ga0207661_10444474 Ga0207661_104444742 233
174 3300025945 Ga0207679_10252740 Ga0207679_102527402 233
175 3300025945 Ga0207679_10270878 Ga0207679_102708783 233
176 3300025945 Ga0207679_10313831 Ga0207679_103138312 233
177 3300025945 Ga0207679_10333253 Ga0207679_103332532 233
178 3300025949 Ga0207667_10252528 Ga0207667_102525283 233
179 3300025961 Ga0207712_10071593 Ga0207712_100715934 233
180 3300025972 Ga0207668_10080774 Ga0207668_100807742 233
181 3300025972 Ga0207668_10197955 Ga0207668_101979553 233
182 3300025981 Ga0207640_10070975 Ga0207640_100709752 233
183 3300025981 Ga0207640_10710990 Ga0207640_107109901 233
184 3300026023 Ga0207677_10197367 Ga0207677_101973672 233
185 3300026067 Ga0207678_10048920 Ga0207678_100489206 233
186 3300026075 Ga0207708_10140641 Ga0207708_101406412 233
187 3300026075 Ga0207708_10214256 Ga0207708_102142562 233
188 3300026078 Ga0207702_10165912 Ga0207702_101659122 233
189 3300026089 Ga0207648_10085891 Ga0207648_100858911 233
190 3300026089 Ga0207648_10152151 Ga0207648_101521514 233
191 3300026116 Ga0207674_10496884 Ga0207674_104968842 233
192 3300026118 Ga0207675_100004077 Ga0207675_1000040773 233
193 3300026118 Ga0207675_100437102 Ga0207675_1004371022 233
194 3300026121 Ga0207683_10363572 Ga0207683_103635722 233
195 3300026121 Ga0207683_10695381 Ga0207683_106953812 233
196 3300026142 Ga0207698_10299250 Ga0207698_102992502 233
197 3300026142 Ga0207698_10615811 Ga0207698_106158112 233
198 3300027907 Ga0207428_10098151 Ga0207428_100981512 233
199 3300027907 Ga0207428_10162337 Ga0207428_101623371 233
200 3300028380 Ga0268265_10447133 Ga0268265_104471332 233
201 3300031731 Ga0307405_10143644 Ga0307405_101436442 233
202 3300031731 Ga0307405_10184845 Ga0307405_101848451 233
203 3300031731 Ga0307405_10404849 Ga0307405_104048491 233
204 3300031824 Ga0307413_10043767 Ga0307413_100437675 233
205 3300031824 Ga0307413_10056307 Ga0307413_100563073 233
206 3300031824 Ga0307413_10400550 Ga0307413_104005502 233
207 3300031824 Ga0307413_10623326 Ga0307413_106233261 233
208 3300031852 Ga0307410_10037945 Ga0307410_100379453 233
209 3300031852 Ga0307410_10064772 Ga0307410_100647722 233
210 3300031852 Ga0307410_10129448 Ga0307410_101294482 233
211 3300031852 Ga0307410_10276485 Ga0307410_102764852 233
212 3300031852 Ga0307410_10587070 Ga0307410_105870702 233
213 3300031901 Ga0307406_10091528 Ga0307406_100915282 233
214 3300031901 Ga0307406_10137733 Ga0307406_101377333 233
215 3300031901 Ga0307406_10577316 Ga0307406_105773162 233
216 3300031903 Ga0307407_10139274 Ga0307407_101392742 233
217 3300031911 Ga0307412_10080143 Ga0307412_100801433 233
218 3300031911 Ga0307412_10093667 Ga0307412_100936672 233
219 3300031995 Ga0307409_100003036 Ga0307409_1000030366 233
220 3300031995 Ga0307409_100022746 Ga0307409_1000227465 233
221 3300031995 Ga0307409_100032917 Ga0307409_1000329172 233
222 3300031995 Ga0307409_100036818 Ga0307409_1000368183 233
223 3300031995 Ga0307409_100787805 Ga0307409_1007878052 233
224 3300032002 Ga0307416_100027810 Ga0307416_1000278104 233
225 3300032002 Ga0307416_100035108 Ga0307416_1000351084 233
226 3300032002 Ga0307416_100041584 Ga0307416_1000415842 233
227 3300032002 Ga0307416_100160694 Ga0307416_1001606942 233
228 3300032002 Ga0307416_100206138 Ga0307416_1002061383 233
229 3300032002 Ga0307416_100425155 Ga0307416_1004251552 233
230 3300032002 Ga0307416_100464265 Ga0307416_1004642652 233
231 3300032002 Ga0307416_101356117 Ga0307416_1013561171 233
232 3300032004 Ga0307414_10192950 Ga0307414_101929502 233
233 3300032005 Ga0307411_10105111 Ga0307411_101051115 233
234 3300032005 Ga0307411_10281518 Ga0307411_102815182 233
235 3300032126 Ga0307415_100008278 Ga0307415_1000082784 233
236 3300032126 Ga0307415_100014045 Ga0307415_1000140456 233
237 3300032126 Ga0307415_100014488 Ga0307415_1000144884 233
238 3300032126 Ga0307415_100015841 Ga0307415_1000158413 233
239 3300032126 Ga0307415_100118736 Ga0307415_1001187362 233
240 3300032126 Ga0307415_100317086 Ga0307415_1003170861 233
241 3300035085 Ga0373929_0030967 Ga0373929_0030967_261_1013 233
242 3300037418 Ga0395900_0286144 Ga0395900_0286144_723_1475 233
243 3300037466 Ga0395898_0269748 Ga0395898_0269748_360_1106 233
244 3300038443 Ga0395901_0190326 Ga0395901_0190326_1228_1986 233
245 3300042005 Ga0439448_0032507 Ga0439448_0032507_804_1550 233
246 3300042461 Ga0439460_0097386 Ga0439460_0097386_157_903 233
247 3300044694 Ga0466963_0048131 Ga0466963_0048131_1864_2610 233
248 3300044694 Ga0466963_0089361 Ga0466963_0089361_13_759 233
249 3300044694 Ga0466963_0163823 Ga0466963_0163823_420_1166 233
250 3300044694 Ga0466963_0226953 Ga0466963_0226953_247_993 233
251 3300044694 Ga0466963_0228824 Ga0466963_0228824_521_1267 233
252 3300044842 Ga0466957_0234986 Ga0466957_0234986_412_1158 233
253 3300044842 Ga0466957_0257770 Ga0466957_0257770_206_952 233
254 3300044901 Ga0466960_0000054 Ga0466960_0000054_33267_34022 233
255 3300044901 Ga0466960_0057360 Ga0466960_0057360_1052_1798 233
256 3300044901 Ga0466960_0067887 Ga0466960_0067887_214_966 233
257 3300044901 Ga0466960_0152734 Ga0466960_0152734_56_802 233
258 3300045836 Ga0466958_0148940 Ga0466958_0148940_603_1349 233
259 3300045976 Ga0466967_0009693 Ga0466967_0009693_2812_3558 233
260 3300045976 Ga0466967_0019837 Ga0466967_0019837_890_1636 233
261 3300045976 Ga0466967_0025253 Ga0466967_0025253_3085_3831 233
262 3300045976 Ga0466967_0033230 Ga0466967_0033230_3112_3858 233
263 3300045976 Ga0466967_0055312 Ga0466967_0055312_2206_2952 233
264 3300045976 Ga0466967_0127521 Ga0466967_0127521_247_993 233
265 3300045976 Ga0466967_0236559 Ga0466967_0236559_323_1069 233
266 3300045976 Ga0466967_0262886 Ga0466967_0262886_454_1212 233
267 3300046473 Ga0495582_0126714 Ga0495582_0126714_181_927 233
268 3300046500 Ga0495596_0045089 Ga0495596_0045089_848_1597 233
269 3300046515 Ga0495620_0096847 Ga0495620_0096847_313_1062 233
270 3300046615 Ga0495656_0126057 Ga0495656_0126057_330_1079 233
271 3300047320 Ga0495672_0037799 Ga0495672_0037799_1428_2177 233
272 3300048915 Ga0496112_0021423 Ga0496112_0021423_325_1083 233
273 3300048915 Ga0496112_0140653 Ga0496112_0140653_302_1048 233
274 3300048915 Ga0496112_0805430 Ga0496112_0805430_30_785 233
275 3300048916 Ga0496113_0056333 Ga0496113_0056333_956_1714 233
276 3300048916 Ga0496113_0144274 Ga0496113_0144274_596_1342 233
277 3300048918 Ga0496115_0513395 Ga0496115_0513395_62_808 233
278 3300049568 Ga0501031_0107329 Ga0501031_0107329_394_1140 233
279 3300049568 Ga0501031_0128007 Ga0501031_0128007_107_856 233
280 3300049568 Ga0501031_0413723 Ga0501031_0413723_91_840 233
281 3300049572 Ga0501036_0075654 Ga0501036_0075654_161_907 233
282 3300049572 Ga0501036_0090562 Ga0501036_0090562_735_1481 233
283 3300049572 Ga0501036_0095413 Ga0501036_0095413_1477_2226 233
284 3300049572 Ga0501036_0166909 Ga0501036_0166909_696_1442 233
285 3300049575 Ga0501039_0054318 Ga0501039_0054318_1252_1998 233
286 3300049575 Ga0501039_0222059 Ga0501039_0222059_118_864 233
287 3300049575 Ga0501039_0474536 Ga0501039_0474536_95_844 233
288 3300049576 Ga0501040_0021069 Ga0501040_0021069_2061_2807 233
289 3300049576 Ga0501040_0097982 Ga0501040_0097982_1094_1840 233
290 3300049576 Ga0501040_0155654 Ga0501040_0155654_531_1280 233
291 3300049578 Ga0501042_0090369 Ga0501042_0090369_354_1103 233
292 3300049578 Ga0501042_0092001 Ga0501042_0092001_773_1519 233
293 3300049580 Ga0501046_0471848 Ga0501046_0471848_78_824 233
294 3300049581 Ga0501047_0130957 Ga0501047_0130957_105_851 233
295 3300049582 Ga0501048_0033937 Ga0501048_0033937_2625_3371 233
296 3300049582 Ga0501048_0177021 Ga0501048_0177021_260_1006 233
297 3300049582 Ga0501048_0407300 Ga0501048_0407300_130_879 233
298 3300049584 Ga0501068_0248030 Ga0501068_0248030_367_1113 233
299 3300049587 Ga0501071_0011497 Ga0501071_0011497_1732_2478 233
300 3300049587 Ga0501071_0126020 Ga0501071_0126020_524_1270 233
301 3300049588 Ga0501072_0021769 Ga0501072_0021769_1614_2360 233
302 3300049588 Ga0501072_0103323 Ga0501072_0103323_1417_2166 233
303 3300049588 Ga0501072_0122749 Ga0501072_0122749_607_1353 233
304 3300049588 Ga0501072_0307924 Ga0501072_0307924_198_944 233
305 3300049591 Ga0501075_0012953 Ga0501075_0012953_399_1145 233
306 3300049591 Ga0501075_0017348 Ga0501075_0017348_1819_2568 233
307 3300049591 Ga0501075_0044675 Ga0501075_0044675_2123_2869 233
308 3300049592 Ga0501076_0016599 Ga0501076_0016599_3921_4670 233
309 3300049592 Ga0501076_0019685 Ga0501076_0019685_860_1606 233
310 3300049592 Ga0501076_0089428 Ga0501076_0089428_662_1408 233
311 3300049741 Ga0501079_0366495 Ga0501079_0366495_356_1105 233
312 3300049743 Ga0501081_0040435 Ga0501081_0040435_1094_1843 233
313 3300049743 Ga0501081_0068409 Ga0501081_0068409_351_1097 233
314 3300049743 Ga0501081_0597543 Ga0501081_0597543_11_760 233
315 3300049744 Ga0501083_0300641 Ga0501083_0300641_215_961 233
316 3300049744 Ga0501083_0393486 Ga0501083_0393486_88_837 233
317 3300049822 Ga0501035_0319915 Ga0501035_0319915_520_1269 233
318 3300049824 Ga0501045_0134886 Ga0501045_0134886_354_1100 233
319 3300050490 nmdc:mga03n38_83068_c1 nmdc:mga03n38_83068_c1_309_1073 233
320 3300050492 nmdc:mga0yw44_296812_c1 nmdc:mga0yw44_296812_c1_38_787 233
321 3300050507 nmdc:mga05p37_1195281_c1 nmdc:mga05p37_1195281_c1_11_760 233
322 3300050507 nmdc:mga05p37_432160_c1 nmdc:mga05p37_432160_c1_677_1426 233
323 3300050507 nmdc:mga05p37_94787_c1 nmdc:mga05p37_94787_c1_424_1173 233
324 3300050508 nmdc:mga09592_397683_c1 nmdc:mga09592_397683_c1_292_1041 233
325 3300050508 nmdc:mga09592_788548_c1 nmdc:mga09592_788548_c1_47_793 233
326 3300050508 nmdc:mga09592_95482_c1 nmdc:mga09592_95482_c1_228_977 233
327 3300050509 nmdc:mga0qj67_10324_c1 nmdc:mga0qj67_10324_c1_5024_5773 233
328 3300050509 nmdc:mga0qj67_190975_c1 nmdc:mga0qj67_190975_c1_417_1166 233
329 3300050509 nmdc:mga0qj67_446_c1 nmdc:mga0qj67_446_c1_15679_16428 233
330 3300050510 nmdc:mga06r32_145332_c1 nmdc:mga06r32_145332_c1_1011_1760 233
331 3300050510 nmdc:mga06r32_18055_c1 nmdc:mga06r32_18055_c1_1728_2477 233
332 3300050510 nmdc:mga06r32_96700_c1 nmdc:mga06r32_96700_c1_1293_2042 233
333 3300050511 nmdc:mga08y16_120495_c1 nmdc:mga08y16_120495_c1_1815_2564 233
334 3300050511 nmdc:mga08y16_140265_c1 nmdc:mga08y16_140265_c1_932_1678 233
335 3300050515 nmdc:mga0a205_137141_c1 nmdc:mga0a205_137141_c1_11_760 233
336 3300053139 Ga0500568_0105172 Ga0500568_0105172_280_1026 233
337 3300054114 Ga0501084_0089920 Ga0501084_0089920_980_1726 233
338 3300054114 Ga0501084_0096740 Ga0501084_0096740_66_812 233
339 3300054114 Ga0501084_0109542 Ga0501084_0109542_599_1348 233
340 3300054114 Ga0501084_0284490 Ga0501084_0284490_371_1117 233
341 3300054114 Ga0501084_0294738 Ga0501084_0294738_524_1273 233
342 3300060353 Ga0501082_0036340 Ga0501082_0036340_3346_4092 233
343 3300060353 Ga0501082_0135649 Ga0501082_0135649_270_1016 233
344 3300060353 Ga0501082_0585324 Ga0501082_0585324_133_879 233
345 3300061734 Ga0530510_0073686 Ga0530510_0073686_195_944 233
346 3300061734 Ga0530510_0289155 Ga0530510_0289155_290_1036 233
347 3300061734 Ga0530510_0326061 Ga0530510_0326061_294_1043 233
348 3300001990 JGI24737J22298_10040850 JGI24737J22298_100408502 234
349 3300003203 JGI25406J46586_10002467 JGI25406J46586_100024677 234
350 3300005328 Ga0070676_10068908 Ga0070676_100689084 234
351 3300005329 Ga0070683_100082217 Ga0070683_1000822174 234
352 3300005331 Ga0070670_100079952 Ga0070670_1000799522 234
353 3300005334 Ga0068869_100177377 Ga0068869_1001773771 234
354 3300005334 Ga0068869_100331155 Ga0068869_1003311551 234
355 3300005337 Ga0070682_100008003 Ga0070682_1000080033 234
356 3300005338 Ga0068868_100036527 Ga0068868_1000365273 234
357 3300005339 Ga0070660_100170098 Ga0070660_1001700982 234
358 3300005340 Ga0070689_100242936 Ga0070689_1002429362 234
359 3300005343 Ga0070687_100058870 Ga0070687_1000588702 234
360 3300005343 Ga0070687_100061403 Ga0070687_1000614032 234
361 3300005344 Ga0070661_100171412 Ga0070661_1001714123 234
362 3300005345 Ga0070692_10029858 Ga0070692_100298581 234
363 3300005347 Ga0070668_100050855 Ga0070668_1000508554 234
364 3300005354 Ga0070675_100122758 Ga0070675_1001227583 234
365 3300005364 Ga0070673_100210860 Ga0070673_1002108603 234
366 3300005366 Ga0070659_100403879 Ga0070659_1004038792 234
367 3300005440 Ga0070705_100205798 Ga0070705_1002057982 234
368 3300005441 Ga0070700_100247280 Ga0070700_1002472801 234
369 3300005455 Ga0070663_100125413 Ga0070663_1001254134 234
370 3300005456 Ga0070678_100091674 Ga0070678_1000916742 234
371 3300005457 Ga0070662_100313544 Ga0070662_1003135442 234
372 3300005459 Ga0068867_100290692 Ga0068867_1002906922 234
373 3300005466 Ga0070685_10059210 Ga0070685_100592102 234
374 3300005466 Ga0070685_10099129 Ga0070685_100991292 234
375 3300005535 Ga0070684_100001766 Ga0070684_10000176618 234
376 3300005535 Ga0070684_100446156 Ga0070684_1004461562 234
377 3300005539 Ga0068853_100167558 Ga0068853_1001675583 234
378 3300005543 Ga0070672_100127968 Ga0070672_1001279682 234
379 3300005544 Ga0070686_100122771 Ga0070686_1001227712 234
380 3300005544 Ga0070686_100626948 Ga0070686_1006269481 234
381 3300005545 Ga0070695_100101975 Ga0070695_1001019752 234
382 3300005547 Ga0070693_100075446 Ga0070693_1000754464 234
383 3300005547 Ga0070693_100118322 Ga0070693_1001183222 234
384 3300005548 Ga0070665_100073421 Ga0070665_1000734213 234
385 3300005578 Ga0068854_100013176 Ga0068854_1000131767 234
386 3300005578 Ga0068854_100070737 Ga0068854_1000707373 234
387 3300005578 Ga0068854_100576211 Ga0068854_1005762112 234
388 3300005614 Ga0068856_100033740 Ga0068856_1000337406 234
389 3300005614 Ga0068856_100148578 Ga0068856_1001485782 234
390 3300005614 Ga0068856_100425693 Ga0068856_1004256932 234
391 3300005614 Ga0068856_100500882 Ga0068856_1005008822 234
392 3300005614 Ga0068856_100530242 Ga0068856_1005302422 234
393 3300005615 Ga0070702_100054854 Ga0070702_1000548543 234
394 3300005615 Ga0070702_100082249 Ga0070702_1000822491 234
395 3300005615 Ga0070702_100116300 Ga0070702_1001163001 234
396 3300005615 Ga0070702_100257569 Ga0070702_1002575692 234
397 3300005616 Ga0068852_100014730 Ga0068852_1000147302 234
398 3300005616 Ga0068852_100048782 Ga0068852_1000487824 234
399 3300005616 Ga0068852_100081895 Ga0068852_1000818954 234
400 3300005617 Ga0068859_100232803 Ga0068859_1002328032 234
401 3300005618 Ga0068864_100003127 Ga0068864_10000312713 234
402 3300005718 Ga0068866_10184430 Ga0068866_101844301 234
403 3300005719 Ga0068861_100087588 Ga0068861_1000875882 234
404 3300005842 Ga0068858_100275114 Ga0068858_1002751142 234
405 3300005843 Ga0068860_100536814 Ga0068860_1005368142 234
406 3300005844 Ga0068862_100376222 Ga0068862_1003762222 234
407 3300005937 Ga0081455_10013238 Ga0081455_100132387 234
408 3300005983 Ga0081540_1001988 Ga0081540_100198817 234
409 3300005985 Ga0081539_10009179 Ga0081539_100091799 234
410 3300006175 Ga0070712_100265084 Ga0070712_1002650842 234
411 3300006847 Ga0075431_100183868 Ga0075431_1001838682 234
412 3300006847 Ga0075431_100489412 Ga0075431_1004894122 234
413 3300006852 Ga0075433_10072042 Ga0075433_100720421 234
414 3300006871 Ga0075434_100006331 Ga0075434_10000633114 234
415 3300006881 Ga0068865_100167231 Ga0068865_1001672312 234
416 3300006914 Ga0075436_100340522 Ga0075436_1003405222 234
417 3300006931 Ga0097620_100232801 Ga0097620_1002328013 234
418 3300007076 Ga0075435_100138721 Ga0075435_1001387212 234
419 3300009094 Ga0111539_10146412 Ga0111539_101464123 234
420 3300009098 Ga0105245_10014517 Ga0105245_100145176 234
421 3300009098 Ga0105245_10594386 Ga0105245_105943862 234
422 3300009101 Ga0105247_10544055 Ga0105247_105440551 234
423 3300009147 Ga0114129_10202071 Ga0114129_102020712 234
424 3300009148 Ga0105243_10013190 Ga0105243_100131908 234
425 3300009148 Ga0105243_10089870 Ga0105243_100898702 234
426 3300009177 Ga0105248_10104467 Ga0105248_101044672 234
427 3300009177 Ga0105248_10190482 Ga0105248_101904822 234
428 3300009545 Ga0105237_10179970 Ga0105237_101799703 234
429 3300009551 Ga0105238_10186722 Ga0105238_101867224 234
430 3300009553 Ga0105249_10080368 Ga0105249_100803683 234
431 3300009553 Ga0105249_10127565 Ga0105249_101275654 234
432 3300010375 Ga0105239_10116718 Ga0105239_101167184 234
433 3300013102 Ga0157371_10133217 Ga0157371_101332172 234
434 3300013296 Ga0157374_10038085 Ga0157374_100380855 234
435 3300013297 Ga0157378_10307922 Ga0157378_103079223 234
436 3300013297 Ga0157378_10314616 Ga0157378_103146162 234
437 3300013306 Ga0163162_10154357 Ga0163162_101543574 234
438 3300013307 Ga0157372_10124400 Ga0157372_101244005 234
439 3300013307 Ga0157372_10319705 Ga0157372_103197052 234
440 3300013307 Ga0157372_10694025 Ga0157372_106940252 234
441 3300013308 Ga0157375_10408259 Ga0157375_104082591 234
442 3300014326 Ga0157380_11066468 Ga0157380_110664681 234
443 3300014497 Ga0182008_10154604 Ga0182008_101546041 234
444 3300014745 Ga0157377_10002230 Ga0157377_100022304 234
445 3300014745 Ga0157377_10060860 Ga0157377_100608604 234
446 3300014968 Ga0157379_10003747 Ga0157379_1000374712 234
447 3300014968 Ga0157379_10290227 Ga0157379_102902272 234
448 3300014969 Ga0157376_10202751 Ga0157376_102027512 234
449 3300014969 Ga0157376_10396081 Ga0157376_103960812 234
450 3300020082 Ga0206353_11379463 Ga0206353_113794632 234
451 3300025901 Ga0207688_10000574 Ga0207688_100005745 234
452 3300025901 Ga0207688_10006513 Ga0207688_100065134 234
453 3300025901 Ga0207688_10198410 Ga0207688_101984102 234
454 3300025904 Ga0207647_10090683 Ga0207647_100906832 234
455 3300025907 Ga0207645_10143467 Ga0207645_101434673 234
456 3300025908 Ga0207643_10023715 Ga0207643_100237155 234
457 3300025916 Ga0207663_10146879 Ga0207663_101468793 234
458 3300025918 Ga0207662_10005381 Ga0207662_100053813 234
459 3300025918 Ga0207662_10022129 Ga0207662_100221292 234
460 3300025919 Ga0207657_10041961 Ga0207657_100419614 234
461 3300025919 Ga0207657_10062918 Ga0207657_100629182 234
462 3300025920 Ga0207649_10129522 Ga0207649_101295222 234
463 3300025920 Ga0207649_10284819 Ga0207649_102848192 234
464 3300025921 Ga0207652_10431003 Ga0207652_104310032 234
465 3300025925 Ga0207650_10211989 Ga0207650_102119891 234
466 3300025926 Ga0207659_10570788 Ga0207659_105707882 234
467 3300025927 Ga0207687_10122235 Ga0207687_101222353 234
468 3300025932 Ga0207690_10257404 Ga0207690_102574042 234
469 3300025932 Ga0207690_10381561 Ga0207690_103815611 234
470 3300025933 Ga0207706_10023352 Ga0207706_100233525 234
471 3300025934 Ga0207686_10209019 Ga0207686_102090192 234
472 3300025935 Ga0207709_10170908 Ga0207709_101709082 234
473 3300025935 Ga0207709_10265047 Ga0207709_102650472 234
474 3300025936 Ga0207670_10088808 Ga0207670_100888082 234
475 3300025937 Ga0207669_10081929 Ga0207669_100819293 234
476 3300025938 Ga0207704_10058065 Ga0207704_100580652 234
477 3300025940 Ga0207691_10092600 Ga0207691_100926004 234
478 3300025941 Ga0207711_10309987 Ga0207711_103099872 234
479 3300025941 Ga0207711_10611087 Ga0207711_106110872 234
480 3300025942 Ga0207689_10046842 Ga0207689_100468424 234
481 3300025942 Ga0207689_10126833 Ga0207689_101268332 234
482 3300025944 Ga0207661_10003675 Ga0207661_100036757 234
483 3300025945 Ga0207679_10032825 Ga0207679_100328253 234
484 3300025960 Ga0207651_10017591 Ga0207651_100175912 234
485 3300025960 Ga0207651_10150995 Ga0207651_101509953 234
486 3300025961 Ga0207712_10215824 Ga0207712_102158242 234
487 3300025961 Ga0207712_10329593 Ga0207712_103295932 234
488 3300025972 Ga0207668_10160366 Ga0207668_101603662 234
489 3300025981 Ga0207640_10041111 Ga0207640_100411113 234
490 3300025981 Ga0207640_10111271 Ga0207640_101112713 234
491 3300025981 Ga0207640_10327983 Ga0207640_103279832 234
492 3300026035 Ga0207703_10061203 Ga0207703_100612034 234
493 3300026035 Ga0207703_10351681 Ga0207703_103516812 234
494 3300026041 Ga0207639_10246006 Ga0207639_102460062 234
495 3300026041 Ga0207639_10300818 Ga0207639_103008182 234
496 3300026041 Ga0207639_10645585 Ga0207639_106455852 234
497 3300026067 Ga0207678_10016804 Ga0207678_100168046 234
498 3300026075 Ga0207708_10001896 Ga0207708_100018968 234
499 3300026075 Ga0207708_10094677 Ga0207708_100946772 234
500 3300026078 Ga0207702_10104288 Ga0207702_101042883 234
501 3300026078 Ga0207702_10104983 Ga0207702_101049834 234
502 3300026078 Ga0207702_10535797 Ga0207702_105357971 234
503 3300026089 Ga0207648_10353966 Ga0207648_103539662 234
504 3300026116 Ga0207674_10126849 Ga0207674_101268492 234
505 3300026116 Ga0207674_10150677 Ga0207674_101506772 234
506 3300026118 Ga0207675_100156993 Ga0207675_1001569932 234
507 3300026118 Ga0207675_100206488 Ga0207675_1002064882 234
508 3300026121 Ga0207683_10098731 Ga0207683_100987311 234
509 3300026121 Ga0207683_10512770 Ga0207683_105127702 234
510 3300026142 Ga0207698_10095613 Ga0207698_100956132 234
511 3300026142 Ga0207698_10270513 Ga0207698_102705133 234
512 3300027907 Ga0207428_10063126 Ga0207428_100631264 234
513 3300028379 Ga0268266_10055305 Ga0268266_100553053 234
514 3300028381 Ga0268264_10216867 Ga0268264_102168672 234
515 3300031731 Ga0307405_10029550 Ga0307405_100295502 234
516 3300031852 Ga0307410_10085789 Ga0307410_100857892 234
517 3300031901 Ga0307406_10170666 Ga0307406_101706663 234
518 3300031901 Ga0307406_10502959 Ga0307406_105029592 234
519 3300031995 Ga0307409_100027002 Ga0307409_1000270022 234
520 3300032002 Ga0307416_100033057 Ga0307416_1000330572 234
521 3300032002 Ga0307416_100074384 Ga0307416_1000743842 234
522 3300032002 Ga0307416_100426642 Ga0307416_1004266421 234
523 3300032126 Ga0307415_100003888 Ga0307415_1000038886 234
524 3300032126 Ga0307415_100049321 Ga0307415_1000493214 234
525 3300037418 Ga0395900_0704381 Ga0395900_0704381_13_768 234
526 3300037466 Ga0395898_0142728 Ga0395898_0142728_741_1508 234
527 3300038443 Ga0395901_0330540 Ga0395901_0330540_730_1479 234
528 3300038443 Ga0395901_0637015 Ga0395901_0637015_98_847 234
529 3300044694 Ga0466963_0097756 Ga0466963_0097756_858_1607 234
530 3300044842 Ga0466957_0192054 Ga0466957_0192054_19_768 234
531 3300044901 Ga0466960_0017827 Ga0466960_0017827_1156_1920 234
532 3300044901 Ga0466960_0077010 Ga0466960_0077010_485_1240 234
533 3300044901 Ga0466960_0095845 Ga0466960_0095845_383_1147 234
534 3300045976 Ga0466967_0102218 Ga0466967_0102218_1417_2181 234
535 3300045976 Ga0466967_0987577 Ga0466967_0987577_20_769 234
536 3300046455 Ga0495603_0302887 Ga0495603_0302887_18_776 234
537 3300046461 Ga0495641_0096036 Ga0495641_0096036_210_968 234
538 3300046471 Ga0495650_0000055 Ga0495650_0000055_2195_2959 234
539 3300046474 Ga0495605_0102413 Ga0495605_0102413_154_912 234
540 3300046538 Ga0495609_0155537 Ga0495609_0155537_76_834 234
541 3300046615 Ga0495656_0017373 Ga0495656_0017373_1702_2460 234
542 3300046794 Ga0495589_0074591 Ga0495589_0074591_157_915 234
543 3300047445 Ga0495677_0126485 Ga0495677_0126485_179_937 234
544 3300048903 Ga0496100_0045634 Ga0496100_0045634_1636_2391 234
545 3300048903 Ga0496100_0096104 Ga0496100_0096104_1150_1908 234
546 3300048904 Ga0496101_0032417 Ga0496101_0032417_2899_3654 234
547 3300048904 Ga0496101_0065877 Ga0496101_0065877_795_1544 234
548 3300048905 Ga0496102_0031443 Ga0496102_0031443_238_996 234
549 3300048905 Ga0496102_0198279 Ga0496102_0198279_47_799 234
550 3300048907 Ga0496104_0001966 Ga0496104_0001966_1365_2123 234
551 3300048907 Ga0496104_0004059 Ga0496104_0004059_10773_11522 234
552 3300048907 Ga0496104_0105909 Ga0496104_0105909_58_810 234
553 3300048909 Ga0496106_0010331 Ga0496106_0010331_2618_3373 234
554 3300048909 Ga0496106_0013317 Ga0496106_0013317_5191_5940 234
555 3300048909 Ga0496106_0151383 Ga0496106_0151383_77_835 234
556 3300048909 Ga0496106_0646897 Ga0496106_0646897_71_823 234
557 3300048910 Ga0496107_0002481 Ga0496107_0002481_3021_3776 234
558 3300048911 Ga0496108_0000326 Ga0496108_0000326_37021_37779 234
559 3300048911 Ga0496108_0030203 Ga0496108_0030203_106_864 234
560 3300048911 Ga0496108_0037667 Ga0496108_0037667_770_1528 234
561 3300048911 Ga0496108_0066593 Ga0496108_0066593_2159_2908 234
562 3300048911 Ga0496108_0199579 Ga0496108_0199579_480_1238 234
563 3300048911 Ga0496108_0238099 Ga0496108_0238099_774_1523 234
564 3300048912 Ga0496109_0006974 Ga0496109_0006974_921_1679 234
565 3300048912 Ga0496109_0228664 Ga0496109_0228664_654_1412 234
566 3300048912 Ga0496109_0268445 Ga0496109_0268445_661_1410 234
567 3300048913 Ga0496110_0003062 Ga0496110_0003062_4619_5377 234
568 3300048913 Ga0496110_0065321 Ga0496110_0065321_1130_1882 234
569 3300048914 Ga0496111_0012838 Ga0496111_0012838_3699_4457 234
570 3300048915 Ga0496112_0041263 Ga0496112_0041263_3456_4214 234
571 3300048915 Ga0496112_0187651 Ga0496112_0187651_146_895 234
572 3300048916 Ga0496113_0000503 Ga0496113_0000503_10572_11330 234
573 3300048916 Ga0496113_0063088 Ga0496113_0063088_2036_2788 234
574 3300048916 Ga0496113_0141334 Ga0496113_0141334_90_848 234
575 3300048917 Ga0496114_0056194 Ga0496114_0056194_101_859 234
576 3300048917 Ga0496114_0251886 Ga0496114_0251886_450_1202 234
577 3300048918 Ga0496115_0027586 Ga0496115_0027586_1969_2724 234
578 3300048924 Ga0496121_0040466 Ga0496121_0040466_3114_3881 234
579 3300050510 nmdc:mga06r32_530314_c1 nmdc:mga06r32_530314_c1_157_906 234
580 3300050510 nmdc:mga06r32_78865_c1 nmdc:mga06r32_78865_c1_1871_2620 234
581 3300050511 nmdc:mga08y16_55395_c1 nmdc:mga08y16_55395_c1_565_1323 234
582 3300050511 nmdc:mga08y16_97723_c1 nmdc:mga08y16_97723_c1_1382_2131 234
583 3300050512 nmdc:mga0n895_174491_c1 nmdc:mga0n895_174491_c1_1083_1832 234
584 3300050512 nmdc:mga0n895_320794_c1 nmdc:mga0n895_320794_c1_84_833 234
585 3300050514 nmdc:mga08x19_42335_c1 nmdc:mga08x19_42335_c1_1132_1881 234
586 3300050515 nmdc:mga0a205_109360_c1 nmdc:mga0a205_109360_c1_419_1177 234
587 3300050515 nmdc:mga0a205_167524_c1 nmdc:mga0a205_167524_c1_1277_2026 234
588 3300053104 Ga0500556_0000817 Ga0500556_0000817_15854_16615 234
589 3300053153 Ga0500616_0002891 Ga0500616_0002891_11420_12181 234
590 3300053153 Ga0500616_0021454 Ga0500616_0021454_1307_2068 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02683

DsbD

Cytochrome C biogenesis protein transmembrane region

22

233

0.95

Feature Viewer

pLDDT pTM Quality
57.12 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map