F466941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 236 | 590 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100170098|Ga0070660_1001700982 |
| Length | 258 |
| Sequence | VPGIPGGAAVNSGGVDTTVIAAFAVGFVSFISPCVLPLVPGYLSAVTGLSINEMKTGERSLLKILLPSIVFCLSFTVVFVALGMTATGIGSTLQSSKGTLDKIAGLVIIALGVFFLLTPFVPILNKEWRPDALISRAGSGGPLVAGAAFAVAWTPCIGPTLGSILSAAATQDTVGKGGILLAFYSLGLAVPFLLTAIAFTRMTTAFRWLRDRYLIVTAISGFVLIVMGLLLFTGELTQLNIKAQSWLDDLGLNFFKSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 151 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 163 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 222 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 223 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 234 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.36 |
| Nodule | 0 |
| Rhizoplane | 6.95 |
| Rhizosphere | 91.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10040850 | 3300001990 | Bacteria | 1423 |
| 2 | JGI25406J46586_10002467 | 3300003203 | Bacteria | 8744 |
| 3 | JGI25407J50210_10008507 | 3300003373 | Bacteria | 2588 |
| 4 | JGI25407J50210_10009070 | 3300003373 | Bacteria | 2514 |
| 5 | JGI25407J50210_10018012 | 3300003373 | Bacteria | 1835 |
| 6 | JGI25407J50210_10023460 | 3300003373 | Bacteria | 1601 |
| 7 | JGI25407J50210_10036156 | 3300003373 | Bacteria | 1271 |
| 8 | Ga0070658_10298391 | 3300005327 | Bacteria | 1374 |
| 9 | Ga0070676_10068908 | 3300005328 | Bacteria | 2119 |
| 10 | Ga0070683_100003128 | 3300005329 | Bacteria | 13332 |
| 11 | Ga0070683_100082217 | 3300005329 | Bacteria | 3016 |
| 12 | Ga0070683_100653778 | 3300005329 | Bacteria | 1006 |
| 13 | Ga0070670_100079952 | 3300005331 | Bacteria | 2810 |
| 14 | Ga0068869_100156531 | 3300005334 | Bacteria | 1771 |
| 15 | Ga0068869_100177377 | 3300005334 | Bacteria | 1669 |
| 16 | Ga0068869_100331155 | 3300005334 | Bacteria | 1237 |
| 17 | Ga0068869_100403438 | 3300005334 | Bacteria | 1125 |
| 18 | Ga0070680_100133213 | 3300005336 | Bacteria | 2080 |
| 19 | Ga0070682_100008003 | 3300005337 | Bacteria | 5951 |
| 20 | Ga0070682_100193034 | 3300005337 | Bacteria | 1431 |
| 21 | Ga0068868_100036527 | 3300005338 | Bacteria | 3803 |
| 22 | Ga0070660_100170098 | 3300005339 | Bacteria | 1760 |
| 23 | Ga0070660_100254115 | 3300005339 | Bacteria | 1434 |
| 24 | Ga0070689_100242936 | 3300005340 | Bacteria | 1483 |
| 25 | Ga0070691_10013616 | 3300005341 | Bacteria | 3727 |
| 26 | Ga0070687_100058870 | 3300005343 | Bacteria | 2020 |
| 27 | Ga0070687_100061403 | 3300005343 | Bacteria | 1987 |
| 28 | Ga0070661_100086896 | 3300005344 | Bacteria | 2312 |
| 29 | Ga0070661_100171412 | 3300005344 | Bacteria | 1648 |
| 30 | Ga0070661_100469862 | 3300005344 | Bacteria | 1003 |
| 31 | Ga0070692_10029858 | 3300005345 | Bacteria | 2721 |
| 32 | Ga0070668_100050855 | 3300005347 | Bacteria | 3192 |
| 33 | Ga0070668_100265874 | 3300005347 | Bacteria | 1428 |
| 34 | Ga0070668_100332451 | 3300005347 | Bacteria | 1282 |
| 35 | Ga0070668_100748613 | 3300005347 | Bacteria | 865 |
| 36 | Ga0070675_100122758 | 3300005354 | Bacteria | 2208 |
| 37 | Ga0070674_100345025 | 3300005356 | Bacteria | 1201 |
| 38 | Ga0070673_100210860 | 3300005364 | Bacteria | 1677 |
| 39 | Ga0070659_100046843 | 3300005366 | Bacteria | 3390 |
| 40 | Ga0070659_100403879 | 3300005366 | Bacteria | 1154 |
| 41 | Ga0070705_100205798 | 3300005440 | Bacteria | 1353 |
| 42 | Ga0070700_100247280 | 3300005441 | Bacteria | 1277 |
| 43 | Ga0070700_100269391 | 3300005441 | Bacteria | 1230 |
| 44 | Ga0070663_100125413 | 3300005455 | Bacteria | 1944 |
| 45 | Ga0070663_100262323 | 3300005455 | Bacteria | 1371 |
| 46 | Ga0070678_100091674 | 3300005456 | Bacteria | 2332 |
| 47 | Ga0070678_100318190 | 3300005456 | Bacteria | 1328 |
| 48 | Ga0070662_100004913 | 3300005457 | Bacteria | 8491 |
| 49 | Ga0070662_100313544 | 3300005457 | Bacteria | 1277 |
| 50 | Ga0070662_100375669 | 3300005457 | Bacteria | 1169 |
| 51 | Ga0070662_100610517 | 3300005457 | Bacteria | 918 |
| 52 | Ga0070681_10111935 | 3300005458 | Bacteria | 2669 |
| 53 | Ga0070681_10153818 | 3300005458 | Bacteria | 2226 |
| 54 | Ga0068867_100290692 | 3300005459 | Bacteria | 1343 |
| 55 | Ga0068867_100351565 | 3300005459 | Bacteria | 1230 |
| 56 | Ga0070685_10059210 | 3300005466 | Bacteria | 2235 |
| 57 | Ga0070685_10099129 | 3300005466 | Bacteria | 1777 |
| 58 | Ga0070679_100020722 | 3300005530 | Bacteria | 6415 |
| 59 | Ga0070684_100001766 | 3300005535 | Bacteria | 15773 |
| 60 | Ga0070684_100170373 | 3300005535 | Bacteria | 1977 |
| 61 | Ga0070684_100256214 | 3300005535 | Bacteria | 1600 |
| 62 | Ga0070684_100446156 | 3300005535 | Bacteria | 1196 |
| 63 | Ga0070684_100673698 | 3300005535 | Bacteria | 964 |
| 64 | Ga0068853_100167558 | 3300005539 | Bacteria | 1986 |
| 65 | Ga0070672_100127968 | 3300005543 | Bacteria | 2085 |
| 66 | Ga0070672_100150432 | 3300005543 | Bacteria | 1925 |
| 67 | Ga0070686_100122771 | 3300005544 | Bacteria | 1785 |
| 68 | Ga0070686_100376193 | 3300005544 | Bacteria | 1074 |
| 69 | Ga0070686_100626948 | 3300005544 | Bacteria | 850 |
| 70 | Ga0070695_100101975 | 3300005545 | Bacteria | 1934 |
| 71 | Ga0070693_100075446 | 3300005547 | Bacteria | 1997 |
| 72 | Ga0070693_100118322 | 3300005547 | Bacteria | 1640 |
| 73 | Ga0070665_100016871 | 3300005548 | Bacteria | 7322 |
| 74 | Ga0070665_100073421 | 3300005548 | Bacteria | 3427 |
| 75 | Ga0070664_100399397 | 3300005564 | Bacteria | 1257 |
| 76 | Ga0068854_100013176 | 3300005578 | Bacteria | 5420 |
| 77 | Ga0068854_100070737 | 3300005578 | Bacteria | 2550 |
| 78 | Ga0068854_100313992 | 3300005578 | Bacteria | 1272 |
| 79 | Ga0068854_100576211 | 3300005578 | Bacteria | 958 |
| 80 | Ga0068856_100018365 | 3300005614 | Bacteria | 6778 |
| 81 | Ga0068856_100033740 | 3300005614 | Bacteria | 5012 |
| 82 | Ga0068856_100148578 | 3300005614 | Bacteria | 2351 |
| 83 | Ga0068856_100425693 | 3300005614 | Bacteria | 1348 |
| 84 | Ga0068856_100500882 | 3300005614 | Bacteria | 1236 |
| 85 | Ga0068856_100530242 | 3300005614 | Bacteria | 1199 |
| 86 | Ga0070702_100054854 | 3300005615 | Bacteria | 2295 |
| 87 | Ga0070702_100082249 | 3300005615 | Bacteria | 1932 |
| 88 | Ga0070702_100116300 | 3300005615 | Bacteria | 1667 |
| 89 | Ga0070702_100257569 | 3300005615 | Bacteria | 1186 |
| 90 | Ga0068852_100007636 | 3300005616 | Bacteria | 7910 |
| 91 | Ga0068852_100014730 | 3300005616 | Bacteria | 6034 |
| 92 | Ga0068852_100048782 | 3300005616 | Bacteria | 3619 |
| 93 | Ga0068852_100081895 | 3300005616 | Bacteria | 2866 |
| 94 | Ga0068859_100232803 | 3300005617 | Bacteria | 1930 |
| 95 | Ga0068864_100003127 | 3300005618 | Bacteria | 13679 |
| 96 | Ga0068866_10184430 | 3300005718 | Bacteria | 1235 |
| 97 | Ga0068861_100048317 | 3300005719 | Bacteria | 3216 |
| 98 | Ga0068861_100087588 | 3300005719 | Bacteria | 2451 |
| 99 | Ga0068858_100275114 | 3300005842 | Bacteria | 1603 |
| 100 | Ga0068860_100536814 | 3300005843 | Bacteria | 1171 |
| 101 | Ga0068862_100161932 | 3300005844 | Bacteria | 1998 |
| 102 | Ga0068862_100376222 | 3300005844 | Bacteria | 1323 |
| 103 | Ga0081455_10013238 | 3300005937 | Bacteria | 8169 |
| 104 | Ga0081455_10050371 | 3300005937 | Bacteria | 3582 |
| 105 | Ga0081455_10097402 | 3300005937 | Bacteria | 2370 |
| 106 | Ga0081455_10133119 | 3300005937 | Bacteria | 1941 |
| 107 | Ga0081538_10000259 | 3300005981 | Bacteria | 60118 |
| 108 | Ga0081538_10000464 | 3300005981 | Bacteria | 45462 |
| 109 | Ga0081538_10001367 | 3300005981 | Bacteria | 25112 |
| 110 | Ga0081538_10001681 | 3300005981 | Bacteria | 22530 |
| 111 | Ga0081538_10004023 | 3300005981 | Bacteria | 13688 |
| 112 | Ga0081538_10004443 | 3300005981 | Bacteria | 12929 |
| 113 | Ga0081538_10004469 | 3300005981 | Bacteria | 12885 |
| 114 | Ga0081538_10006296 | 3300005981 | Bacteria | 10483 |
| 115 | Ga0081538_10006778 | 3300005981 | Bacteria | 10009 |
| 116 | Ga0081538_10011443 | 3300005981 | Bacteria | 7185 |
| 117 | Ga0081538_10012184 | 3300005981 | Bacteria | 6910 |
| 118 | Ga0081538_10013454 | 3300005981 | Bacteria | 6474 |
| 119 | Ga0081538_10021110 | 3300005981 | Bacteria | 4769 |
| 120 | Ga0081538_10022159 | 3300005981 | Bacteria | 4611 |
| 121 | Ga0081538_10023244 | 3300005981 | Bacteria | 4462 |
| 122 | Ga0081538_10025455 | 3300005981 | Bacteria | 4170 |
| 123 | Ga0081538_10052297 | 3300005981 | Bacteria | 2442 |
| 124 | Ga0081538_10103597 | 3300005981 | Bacteria | 1423 |
| 125 | Ga0081538_10127687 | 3300005981 | Bacteria | 1204 |
| 126 | Ga0081538_10137357 | 3300005981 | Bacteria | 1135 |
| 127 | Ga0081540_1001988 | 3300005983 | Bacteria | 17057 |
| 128 | Ga0081540_1089664 | 3300005983 | Bacteria | 1356 |
| 129 | Ga0081539_10009179 | 3300005985 | Bacteria | 8340 |
| 130 | Ga0075365_10044514 | 3300006038 | Bacteria | 2909 |
| 131 | Ga0075363_100107377 | 3300006048 | Bacteria | 1549 |
| 132 | Ga0075432_10016207 | 3300006058 | Bacteria | 2545 |
| 133 | Ga0075432_10039436 | 3300006058 | Bacteria | 1647 |
| 134 | Ga0070712_100265084 | 3300006175 | Bacteria | 1378 |
| 135 | Ga0075428_100042084 | 3300006844 | Bacteria | 5025 |
| 136 | Ga0075428_100110280 | 3300006844 | Bacteria | 2998 |
| 137 | Ga0075428_100147835 | 3300006844 | Bacteria | 2554 |
| 138 | Ga0075428_100564966 | 3300006844 | Bacteria | 1216 |
| 139 | Ga0075430_100004041 | 3300006846 | Bacteria | 12381 |
| 140 | Ga0075430_100006490 | 3300006846 | Bacteria | 9862 |
| 141 | Ga0075430_100315407 | 3300006846 | Bacteria | 1293 |
| 142 | Ga0075431_100045733 | 3300006847 | Bacteria | 4513 |
| 143 | Ga0075431_100067922 | 3300006847 | Bacteria | 3680 |
| 144 | Ga0075431_100183868 | 3300006847 | Bacteria | 2144 |
| 145 | Ga0075431_100268211 | 3300006847 | Bacteria | 1731 |
| 146 | Ga0075431_100489412 | 3300006847 | Bacteria | 1222 |
| 147 | Ga0075433_10072042 | 3300006852 | Bacteria | 3038 |
| 148 | Ga0075433_10526690 | 3300006852 | Bacteria | 1040 |
| 149 | Ga0075434_100006331 | 3300006871 | Bacteria | 10855 |
| 150 | Ga0075429_100041633 | 3300006880 | Bacteria | 4001 |
| 151 | Ga0075429_100273943 | 3300006880 | Bacteria | 1478 |
| 152 | Ga0075429_100420881 | 3300006880 | Bacteria | 1170 |
| 153 | Ga0068865_100167231 | 3300006881 | Bacteria | 1682 |
| 154 | Ga0068865_100268802 | 3300006881 | Bacteria | 1353 |
| 155 | Ga0068865_100443693 | 3300006881 | Bacteria | 1071 |
| 156 | Ga0075436_100340522 | 3300006914 | Bacteria | 1079 |
| 157 | Ga0097620_100232801 | 3300006931 | Bacteria | 1930 |
| 158 | Ga0075435_100138721 | 3300007076 | Bacteria | 2039 |
| 159 | Ga0105240_10139447 | 3300009093 | Bacteria | 2900 |
| 160 | Ga0111539_10099383 | 3300009094 | Bacteria | 3417 |
| 161 | Ga0111539_10100992 | 3300009094 | Bacteria | 3387 |
| 162 | Ga0111539_10146412 | 3300009094 | Bacteria | 2765 |
| 163 | Ga0111539_10427148 | 3300009094 | Bacteria | 1543 |
| 164 | Ga0105245_10014517 | 3300009098 | Bacteria | 6859 |
| 165 | Ga0105245_10239110 | 3300009098 | Bacteria | 1759 |
| 166 | Ga0105245_10454099 | 3300009098 | Bacteria | 1290 |
| 167 | Ga0105245_10594386 | 3300009098 | Bacteria | 1133 |
| 168 | Ga0105247_10544055 | 3300009101 | Bacteria | 853 |
| 169 | Ga0114129_10000894 | 3300009147 | Bacteria | 38837 |
| 170 | Ga0114129_10019446 | 3300009147 | Bacteria | 9670 |
| 171 | Ga0114129_10175377 | 3300009147 | Bacteria | 2920 |
| 172 | Ga0114129_10202071 | 3300009147 | Bacteria | 2691 |
| 173 | Ga0114129_10326558 | 3300009147 | Bacteria | 2038 |
| 174 | Ga0114129_10492223 | 3300009147 | Bacteria | 1603 |
| 175 | Ga0114129_11334778 | 3300009147 | Bacteria | 887 |
| 176 | Ga0105243_10013190 | 3300009148 | Bacteria | 6248 |
| 177 | Ga0105243_10089870 | 3300009148 | Bacteria | 2526 |
| 178 | Ga0105243_10309872 | 3300009148 | Bacteria | 1434 |
| 179 | Ga0105243_10439611 | 3300009148 | Bacteria | 1221 |
| 180 | Ga0105242_10542542 | 3300009176 | Bacteria | 1113 |
| 181 | Ga0105248_10104467 | 3300009177 | Bacteria | 3194 |
| 182 | Ga0105248_10190482 | 3300009177 | Bacteria | 2311 |
| 183 | Ga0105237_10179970 | 3300009545 | Bacteria | 2115 |
| 184 | Ga0105237_10359841 | 3300009545 | Bacteria | 1459 |
| 185 | Ga0105238_10026826 | 3300009551 | Bacteria | 5872 |
| 186 | Ga0105238_10186722 | 3300009551 | Bacteria | 2049 |
| 187 | Ga0105238_10660997 | 3300009551 | Bacteria | 1055 |
| 188 | Ga0105249_10042917 | 3300009553 | Bacteria | 4113 |
| 189 | Ga0105249_10080368 | 3300009553 | Bacteria | 3028 |
| 190 | Ga0105249_10127565 | 3300009553 | Bacteria | 2424 |
| 191 | Ga0105030_105291 | 3300009987 | Bacteria | 1091 |
| 192 | Ga0105239_10116718 | 3300010375 | Bacteria | 2962 |
| 193 | Ga0105239_10209296 | 3300010375 | Bacteria | 2186 |
| 194 | Ga0105239_10746437 | 3300010375 | Bacteria | 1120 |
| 195 | Ga0105239_10938538 | 3300010375 | Bacteria | 994 |
| 196 | Ga0105246_10867743 | 3300011119 | Bacteria | 806 |
| 197 | Ga0157371_10133217 | 3300013102 | Bacteria | 1768 |
| 198 | Ga0157370_10035271 | 3300013104 | Bacteria | 4865 |
| 199 | Ga0157369_10132800 | 3300013105 | Bacteria | 2637 |
| 200 | Ga0157374_10038085 | 3300013296 | Bacteria | 4418 |
| 201 | Ga0157378_10307922 | 3300013297 | Bacteria | 1535 |
| 202 | Ga0157378_10314616 | 3300013297 | Bacteria | 1519 |
| 203 | Ga0163162_10145768 | 3300013306 | Bacteria | 2484 |
| 204 | Ga0163162_10154357 | 3300013306 | Bacteria | 2415 |
| 205 | Ga0157372_10124400 | 3300013307 | Bacteria | 2964 |
| 206 | Ga0157372_10250158 | 3300013307 | Bacteria | 2057 |
| 207 | Ga0157372_10319705 | 3300013307 | Bacteria | 1807 |
| 208 | Ga0157372_10694025 | 3300013307 | Bacteria | 1185 |
| 209 | Ga0157372_10824319 | 3300013307 | Bacteria | 1077 |
| 210 | Ga0157375_10408259 | 3300013308 | Bacteria | 1524 |
| 211 | Ga0157375_10430018 | 3300013308 | Bacteria | 1486 |
| 212 | Ga0157380_11066468 | 3300014326 | Bacteria | 845 |
| 213 | Ga0182008_10154604 | 3300014497 | Bacteria | 1152 |
| 214 | Ga0157377_10002230 | 3300014745 | Bacteria | 8514 |
| 215 | Ga0157377_10060860 | 3300014745 | Bacteria | 2156 |
| 216 | Ga0157379_10003747 | 3300014968 | Bacteria | 12935 |
| 217 | Ga0157379_10290227 | 3300014968 | Bacteria | 1489 |
| 218 | Ga0157376_10202751 | 3300014969 | Bacteria | 1826 |
| 219 | Ga0157376_10396081 | 3300014969 | Bacteria | 1334 |
| 220 | Ga0157376_10727278 | 3300014969 | Bacteria | 1000 |
| 221 | Ga0197907_10222571 | 3300020069 | Bacteria | 1262 |
| 222 | Ga0206353_11379463 | 3300020082 | Bacteria | 1102 |
| 223 | Ga0207688_10000574 | 3300025901 | Bacteria | 18050 |
| 224 | Ga0207688_10006513 | 3300025901 | Bacteria | 6356 |
| 225 | Ga0207688_10198410 | 3300025901 | Bacteria | 1202 |
| 226 | Ga0207688_10389423 | 3300025901 | Bacteria | 863 |
| 227 | Ga0207647_10090683 | 3300025904 | Bacteria | 1823 |
| 228 | Ga0207645_10093615 | 3300025907 | Bacteria | 1934 |
| 229 | Ga0207645_10143467 | 3300025907 | Bacteria | 1557 |
| 230 | Ga0207645_10143468 | 3300025907 | Bacteria | 1557 |
| 231 | Ga0207643_10023715 | 3300025908 | Bacteria | 3385 |
| 232 | Ga0207643_10156109 | 3300025908 | Bacteria | 1371 |
| 233 | Ga0207705_10317755 | 3300025909 | Bacteria | 1196 |
| 234 | Ga0207707_10262225 | 3300025912 | Bacteria | 1499 |
| 235 | Ga0207695_10141789 | 3300025913 | Bacteria | 2351 |
| 236 | Ga0207671_10049230 | 3300025914 | Bacteria | 3119 |
| 237 | Ga0207663_10146879 | 3300025916 | Bacteria | 1649 |
| 238 | Ga0207662_10005381 | 3300025918 | Bacteria | 6819 |
| 239 | Ga0207662_10022129 | 3300025918 | Bacteria | 3640 |
| 240 | Ga0207662_10187226 | 3300025918 | Bacteria | 1334 |
| 241 | Ga0207657_10015219 | 3300025919 | Bacteria | 7462 |
| 242 | Ga0207657_10041961 | 3300025919 | Bacteria | 4041 |
| 243 | Ga0207657_10062918 | 3300025919 | Bacteria | 3175 |
| 244 | Ga0207649_10124207 | 3300025920 | Bacteria | 1744 |
| 245 | Ga0207649_10129522 | 3300025920 | Bacteria | 1712 |
| 246 | Ga0207649_10284819 | 3300025920 | Bacteria | 1203 |
| 247 | Ga0207649_10553230 | 3300025920 | Bacteria | 881 |
| 248 | Ga0207652_10148253 | 3300025921 | Bacteria | 2100 |
| 249 | Ga0207652_10431003 | 3300025921 | Bacteria | 1189 |
| 250 | Ga0207694_10263553 | 3300025924 | Bacteria | 1412 |
| 251 | Ga0207650_10211989 | 3300025925 | Bacteria | 1556 |
| 252 | Ga0207659_10570788 | 3300025926 | Bacteria | 963 |
| 253 | Ga0207687_10108496 | 3300025927 | Bacteria | 2056 |
| 254 | Ga0207687_10122235 | 3300025927 | Bacteria | 1949 |
| 255 | Ga0207687_10138514 | 3300025927 | Bacteria | 1843 |
| 256 | Ga0207687_10172367 | 3300025927 | Bacteria | 1670 |
| 257 | Ga0207690_10137147 | 3300025932 | Bacteria | 1797 |
| 258 | Ga0207690_10207043 | 3300025932 | Bacteria | 1493 |
| 259 | Ga0207690_10228838 | 3300025932 | Bacteria | 1426 |
| 260 | Ga0207690_10257404 | 3300025932 | Bacteria | 1351 |
| 261 | Ga0207690_10311796 | 3300025932 | Bacteria | 1234 |
| 262 | Ga0207690_10381561 | 3300025932 | Bacteria | 1120 |
| 263 | Ga0207706_10021747 | 3300025933 | Bacteria | 5757 |
| 264 | Ga0207706_10023352 | 3300025933 | Bacteria | 5554 |
| 265 | Ga0207706_10670909 | 3300025933 | Bacteria | 887 |
| 266 | Ga0207686_10209019 | 3300025934 | Bacteria | 1402 |
| 267 | Ga0207709_10170908 | 3300025935 | Bacteria | 1525 |
| 268 | Ga0207709_10265047 | 3300025935 | Bacteria | 1262 |
| 269 | Ga0207670_10088808 | 3300025936 | Bacteria | 2180 |
| 270 | Ga0207669_10081929 | 3300025937 | Bacteria | 2070 |
| 271 | Ga0207704_10058065 | 3300025938 | Bacteria | 2381 |
| 272 | Ga0207691_10092600 | 3300025940 | Bacteria | 2707 |
| 273 | Ga0207711_10309987 | 3300025941 | Bacteria | 1457 |
| 274 | Ga0207711_10611087 | 3300025941 | Bacteria | 1017 |
| 275 | Ga0207689_10046842 | 3300025942 | Bacteria | 3572 |
| 276 | Ga0207689_10126833 | 3300025942 | Bacteria | 2099 |
| 277 | Ga0207661_10001491 | 3300025944 | Bacteria | 15841 |
| 278 | Ga0207661_10003675 | 3300025944 | Bacteria | 10695 |
| 279 | Ga0207661_10008054 | 3300025944 | Bacteria | 7512 |
| 280 | Ga0207661_10444474 | 3300025944 | Bacteria | 1180 |
| 281 | Ga0207679_10032825 | 3300025945 | Bacteria | 3649 |
| 282 | Ga0207679_10252740 | 3300025945 | Bacteria | 1499 |
| 283 | Ga0207679_10270878 | 3300025945 | Bacteria | 1452 |
| 284 | Ga0207679_10313831 | 3300025945 | Bacteria | 1355 |
| 285 | Ga0207679_10333253 | 3300025945 | Bacteria | 1317 |
| 286 | Ga0207667_10252528 | 3300025949 | Bacteria | 1804 |
| 287 | Ga0207651_10017591 | 3300025960 | Bacteria | 4227 |
| 288 | Ga0207651_10150995 | 3300025960 | Bacteria | 1808 |
| 289 | Ga0207712_10071593 | 3300025961 | Bacteria | 2494 |
| 290 | Ga0207712_10215824 | 3300025961 | Bacteria | 1531 |
| 291 | Ga0207712_10329593 | 3300025961 | Bacteria | 1262 |
| 292 | Ga0207668_10080774 | 3300025972 | Bacteria | 2356 |
| 293 | Ga0207668_10160366 | 3300025972 | Bacteria | 1752 |
| 294 | Ga0207668_10197955 | 3300025972 | Bacteria | 1598 |
| 295 | Ga0207640_10041111 | 3300025981 | Bacteria | 2938 |
| 296 | Ga0207640_10070975 | 3300025981 | Bacteria | 2344 |
| 297 | Ga0207640_10111271 | 3300025981 | Bacteria | 1942 |
| 298 | Ga0207640_10327983 | 3300025981 | Bacteria | 1221 |
| 299 | Ga0207640_10710990 | 3300025981 | Bacteria | 862 |
| 300 | Ga0207677_10197367 | 3300026023 | Bacteria | 1597 |
| 301 | Ga0207703_10061203 | 3300026035 | Bacteria | 3081 |
| 302 | Ga0207703_10351681 | 3300026035 | Bacteria | 1357 |
| 303 | Ga0207639_10246006 | 3300026041 | Bacteria | 1557 |
| 304 | Ga0207639_10300818 | 3300026041 | Bacteria | 1418 |
| 305 | Ga0207639_10645585 | 3300026041 | Bacteria | 979 |
| 306 | Ga0207678_10016804 | 3300026067 | Bacteria | 6428 |
| 307 | Ga0207678_10048920 | 3300026067 | Bacteria | 3653 |
| 308 | Ga0207708_10001896 | 3300026075 | Bacteria | 15450 |
| 309 | Ga0207708_10094677 | 3300026075 | Bacteria | 2306 |
| 310 | Ga0207708_10140641 | 3300026075 | Bacteria | 1893 |
| 311 | Ga0207708_10214256 | 3300026075 | Bacteria | 1541 |
| 312 | Ga0207708_10272168 | 3300026075 | Bacteria | 1370 |
| 313 | Ga0207702_10104288 | 3300026078 | Bacteria | 2509 |
| 314 | Ga0207702_10104983 | 3300026078 | Bacteria | 2502 |
| 315 | Ga0207702_10165912 | 3300026078 | Bacteria | 2020 |
| 316 | Ga0207702_10535797 | 3300026078 | Bacteria | 1144 |
| 317 | Ga0207648_10085891 | 3300026089 | Bacteria | 2745 |
| 318 | Ga0207648_10152151 | 3300026089 | Bacteria | 2042 |
| 319 | Ga0207648_10353966 | 3300026089 | Bacteria | 1324 |
| 320 | Ga0207674_10126849 | 3300026116 | Bacteria | 2517 |
| 321 | Ga0207674_10150677 | 3300026116 | Bacteria | 2283 |
| 322 | Ga0207674_10496884 | 3300026116 | Bacteria | 1179 |
| 323 | Ga0207675_100004077 | 3300026118 | Bacteria | 14141 |
| 324 | Ga0207675_100156993 | 3300026118 | Bacteria | 2168 |
| 325 | Ga0207675_100206488 | 3300026118 | Bacteria | 1888 |
| 326 | Ga0207675_100437102 | 3300026118 | Bacteria | 1295 |
| 327 | Ga0207683_10098731 | 3300026121 | Bacteria | 2606 |
| 328 | Ga0207683_10363572 | 3300026121 | Bacteria | 1329 |
| 329 | Ga0207683_10512770 | 3300026121 | Bacteria | 1108 |
| 330 | Ga0207683_10695381 | 3300026121 | Bacteria | 943 |
| 331 | Ga0207698_10095613 | 3300026142 | Bacteria | 2446 |
| 332 | Ga0207698_10270513 | 3300026142 | Bacteria | 1566 |
| 333 | Ga0207698_10299250 | 3300026142 | Bacteria | 1497 |
| 334 | Ga0207698_10615811 | 3300026142 | Bacteria | 1072 |
| 335 | Ga0207428_10063126 | 3300027907 | Bacteria | 2927 |
| 336 | Ga0207428_10098151 | 3300027907 | Bacteria | 2267 |
| 337 | Ga0207428_10162337 | 3300027907 | Bacteria | 1696 |
| 338 | Ga0268266_10055305 | 3300028379 | Bacteria | 3412 |
| 339 | Ga0268265_10447133 | 3300028380 | Bacteria | 1206 |
| 340 | Ga0268264_10216867 | 3300028381 | Bacteria | 1760 |
| 341 | Ga0307405_10029550 | 3300031731 | Bacteria | 3205 |
| 342 | Ga0307405_10143644 | 3300031731 | Bacteria | 1668 |
| 343 | Ga0307405_10184845 | 3300031731 | Bacteria | 1500 |
| 344 | Ga0307405_10404849 | 3300031731 | Bacteria | 1069 |
| 345 | Ga0307413_10043767 | 3300031824 | Bacteria | 2641 |
| 346 | Ga0307413_10056307 | 3300031824 | Bacteria | 2398 |
| 347 | Ga0307413_10400550 | 3300031824 | Bacteria | 1075 |
| 348 | Ga0307413_10623326 | 3300031824 | Bacteria | 886 |
| 349 | Ga0307410_10037945 | 3300031852 | Bacteria | 3152 |
| 350 | Ga0307410_10064772 | 3300031852 | Bacteria | 2512 |
| 351 | Ga0307410_10085789 | 3300031852 | Bacteria | 2223 |
| 352 | Ga0307410_10129448 | 3300031852 | Bacteria | 1852 |
| 353 | Ga0307410_10276485 | 3300031852 | Bacteria | 1316 |
| 354 | Ga0307410_10587070 | 3300031852 | Bacteria | 928 |
| 355 | Ga0307406_10091528 | 3300031901 | Bacteria | 2049 |
| 356 | Ga0307406_10137733 | 3300031901 | Bacteria | 1723 |
| 357 | Ga0307406_10170666 | 3300031901 | Bacteria | 1574 |
| 358 | Ga0307406_10433423 | 3300031901 | Bacteria | 1050 |
| 359 | Ga0307406_10502959 | 3300031901 | Bacteria | 983 |
| 360 | Ga0307406_10577316 | 3300031901 | Bacteria | 924 |
| 361 | Ga0307407_10139274 | 3300031903 | Bacteria | 1563 |
| 362 | Ga0307407_10230447 | 3300031903 | Bacteria | 1258 |
| 363 | Ga0307412_10080143 | 3300031911 | Bacteria | 2255 |
| 364 | Ga0307412_10093667 | 3300031911 | Bacteria | 2108 |
| 365 | Ga0307409_100003036 | 3300031995 | Bacteria | 8970 |
| 366 | Ga0307409_100022746 | 3300031995 | Bacteria | 4326 |
| 367 | Ga0307409_100027002 | 3300031995 | Bacteria | 4061 |
| 368 | Ga0307409_100032917 | 3300031995 | Bacteria | 3766 |
| 369 | Ga0307409_100036818 | 3300031995 | Bacteria | 3601 |
| 370 | Ga0307409_100787805 | 3300031995 | Bacteria | 957 |
| 371 | Ga0307416_100027810 | 3300032002 | Bacteria | 4195 |
| 372 | Ga0307416_100033057 | 3300032002 | Bacteria | 3917 |
| 373 | Ga0307416_100035108 | 3300032002 | Bacteria | 3825 |
| 374 | Ga0307416_100041584 | 3300032002 | Bacteria | 3581 |
| 375 | Ga0307416_100074384 | 3300032002 | Bacteria | 2838 |
| 376 | Ga0307416_100160694 | 3300032002 | Bacteria | 2076 |
| 377 | Ga0307416_100206138 | 3300032002 | Bacteria | 1871 |
| 378 | Ga0307416_100425155 | 3300032002 | Bacteria | 1374 |
| 379 | Ga0307416_100426642 | 3300032002 | Bacteria | 1372 |
| 380 | Ga0307416_100464265 | 3300032002 | Bacteria | 1322 |
| 381 | Ga0307416_101356117 | 3300032002 | Bacteria | 817 |
| 382 | Ga0307414_10192950 | 3300032004 | Bacteria | 1650 |
| 383 | Ga0307411_10105111 | 3300032005 | Bacteria | 2007 |
| 384 | Ga0307411_10281518 | 3300032005 | Bacteria | 1324 |
| 385 | Ga0307415_100003888 | 3300032126 | Bacteria | 7674 |
| 386 | Ga0307415_100008278 | 3300032126 | Bacteria | 5756 |
| 387 | Ga0307415_100014045 | 3300032126 | Bacteria | 4694 |
| 388 | Ga0307415_100014488 | 3300032126 | Bacteria | 4638 |
| 389 | Ga0307415_100015841 | 3300032126 | Bacteria | 4476 |
| 390 | Ga0307415_100049321 | 3300032126 | Bacteria | 2846 |
| 391 | Ga0307415_100118736 | 3300032126 | Bacteria | 1978 |
| 392 | Ga0307415_100317086 | 3300032126 | Bacteria | 1298 |
| 393 | Ga0373929_0030967 | 3300035085 | Bacteria | 1144 |
| 394 | Ga0395900_0286144 | 3300037418 | Bacteria | 1639 |
| 395 | Ga0395900_0704381 | 3300037418 | Bacteria | 943 |
| 396 | Ga0395898_0142728 | 3300037466 | Bacteria | 2293 |
| 397 | Ga0395898_0269748 | 3300037466 | Bacteria | 1623 |
| 398 | Ga0395898_0502795 | 3300037466 | Bacteria | 1153 |
| 399 | Ga0395901_0190326 | 3300038443 | Bacteria | 2152 |
| 400 | Ga0395901_0330540 | 3300038443 | Bacteria | 1576 |
| 401 | Ga0395901_0637015 | 3300038443 | Bacteria | 1071 |
| 402 | Ga0439448_0032507 | 3300042005 | Bacteria | 1661 |
| 403 | Ga0439460_0097386 | 3300042461 | Bacteria | 941 |
| 404 | Ga0466963_0048131 | 3300044694 | Bacteria | 2815 |
| 405 | Ga0466963_0089361 | 3300044694 | Bacteria | 2096 |
| 406 | Ga0466963_0097756 | 3300044694 | Bacteria | 2006 |
| 407 | Ga0466963_0163823 | 3300044694 | Bacteria | 1548 |
| 408 | Ga0466963_0226953 | 3300044694 | Bacteria | 1308 |
| 409 | Ga0466963_0228824 | 3300044694 | Bacteria | 1303 |
| 410 | Ga0466957_0192054 | 3300044842 | Bacteria | 1338 |
| 411 | Ga0466957_0234986 | 3300044842 | Bacteria | 1214 |
| 412 | Ga0466957_0257770 | 3300044842 | Bacteria | 1161 |
| 413 | Ga0466960_0000054 | 3300044901 | Bacteria | 38136 |
| 414 | Ga0466960_0017827 | 3300044901 | Bacteria | 3104 |
| 415 | Ga0466960_0053547 | 3300044901 | Bacteria | 1956 |
| 416 | Ga0466960_0057360 | 3300044901 | Bacteria | 1899 |
| 417 | Ga0466960_0067887 | 3300044901 | Bacteria | 1767 |
| 418 | Ga0466960_0077010 | 3300044901 | Bacteria | 1672 |
| 419 | Ga0466960_0095845 | 3300044901 | Bacteria | 1520 |
| 420 | Ga0466960_0152734 | 3300044901 | Bacteria | 1235 |
| 421 | Ga0466958_0148940 | 3300045836 | Bacteria | 1476 |
| 422 | Ga0466967_0009693 | 3300045976 | Bacteria | 7166 |
| 423 | Ga0466967_0019837 | 3300045976 | Bacteria | 5416 |
| 424 | Ga0466967_0025253 | 3300045976 | Bacteria | 4897 |
| 425 | Ga0466967_0033230 | 3300045976 | Bacteria | 4365 |
| 426 | Ga0466967_0055312 | 3300045976 | Bacteria | 3495 |
| 427 | Ga0466967_0102218 | 3300045976 | Bacteria | 2621 |
| 428 | Ga0466967_0127521 | 3300045976 | Bacteria | 2358 |
| 429 | Ga0466967_0143185 | 3300045976 | Bacteria | 2228 |
| 430 | Ga0466967_0204909 | 3300045976 | Bacteria | 1869 |
| 431 | Ga0466967_0230694 | 3300045976 | Bacteria | 1762 |
| 432 | Ga0466967_0236559 | 3300045976 | Bacteria | 1741 |
| 433 | Ga0466967_0262886 | 3300045976 | Bacteria | 1651 |
| 434 | Ga0466967_0515325 | 3300045976 | Bacteria | 1175 |
| 435 | Ga0466967_0987577 | 3300045976 | Bacteria | 838 |
| 436 | Ga0495603_0302887 | 3300046455 | Bacteria | 918 |
| 437 | Ga0495641_0096036 | 3300046461 | Bacteria | 1323 |
| 438 | Ga0495650_0000055 | 3300046471 | Bacteria | 308438 |
| 439 | Ga0495582_0126714 | 3300046473 | Bacteria | 1441 |
| 440 | Ga0495605_0102413 | 3300046474 | Bacteria | 1315 |
| 441 | Ga0495605_0186812 | 3300046474 | Bacteria | 909 |
| 442 | Ga0495596_0045089 | 3300046500 | Bacteria | 1734 |
| 443 | Ga0495620_0096847 | 3300046515 | Bacteria | 1179 |
| 444 | Ga0495609_0155537 | 3300046538 | Bacteria | 971 |
| 445 | Ga0495656_0017373 | 3300046615 | Bacteria | 2745 |
| 446 | Ga0495656_0126057 | 3300046615 | Bacteria | 1214 |
| 447 | Ga0495589_0074591 | 3300046794 | Bacteria | 1655 |
| 448 | Ga0495672_0037799 | 3300047320 | Bacteria | 2951 |
| 449 | Ga0495677_0126485 | 3300047445 | Bacteria | 977 |
| 450 | Ga0496100_0045634 | 3300048903 | Bacteria | 2813 |
| 451 | Ga0496100_0096104 | 3300048903 | Bacteria | 2032 |
| 452 | Ga0496101_0032417 | 3300048904 | Bacteria | 3678 |
| 453 | Ga0496101_0065877 | 3300048904 | Bacteria | 2641 |
| 454 | Ga0496102_0031443 | 3300048905 | Bacteria | 4762 |
| 455 | Ga0496102_0198279 | 3300048905 | Bacteria | 1892 |
| 456 | Ga0496104_0001966 | 3300048907 | Bacteria | 17806 |
| 457 | Ga0496104_0004059 | 3300048907 | Bacteria | 12695 |
| 458 | Ga0496104_0105909 | 3300048907 | Bacteria | 2695 |
| 459 | Ga0496106_0010331 | 3300048909 | Bacteria | 6899 |
| 460 | Ga0496106_0013317 | 3300048909 | Bacteria | 6071 |
| 461 | Ga0496106_0151383 | 3300048909 | Bacteria | 1830 |
| 462 | Ga0496106_0646897 | 3300048909 | Bacteria | 845 |
| 463 | Ga0496107_0002481 | 3300048910 | Bacteria | 11975 |
| 464 | Ga0496108_0000326 | 3300048911 | Bacteria | 40459 |
| 465 | Ga0496108_0030203 | 3300048911 | Bacteria | 4491 |
| 466 | Ga0496108_0037667 | 3300048911 | Bacteria | 4029 |
| 467 | Ga0496108_0066593 | 3300048911 | Bacteria | 3037 |
| 468 | Ga0496108_0199579 | 3300048911 | Bacteria | 1736 |
| 469 | Ga0496108_0238099 | 3300048911 | Bacteria | 1583 |
| 470 | Ga0496109_0006974 | 3300048912 | Bacteria | 9535 |
| 471 | Ga0496109_0228664 | 3300048912 | Bacteria | 1749 |
| 472 | Ga0496109_0268445 | 3300048912 | Bacteria | 1607 |
| 473 | Ga0496110_0003062 | 3300048913 | Bacteria | 12675 |
| 474 | Ga0496110_0065321 | 3300048913 | Bacteria | 3216 |
| 475 | Ga0496111_0012838 | 3300048914 | Bacteria | 5684 |
| 476 | Ga0496111_0195168 | 3300048914 | Bacteria | 1505 |
| 477 | Ga0496112_0021423 | 3300048915 | Bacteria | 6147 |
| 478 | Ga0496112_0041263 | 3300048915 | Bacteria | 4514 |
| 479 | Ga0496112_0140653 | 3300048915 | Bacteria | 2383 |
| 480 | Ga0496112_0187651 | 3300048915 | Bacteria | 2030 |
| 481 | Ga0496112_0805430 | 3300048915 | Bacteria | 864 |
| 482 | Ga0496113_0000503 | 3300048916 | Bacteria | 19274 |
| 483 | Ga0496113_0056333 | 3300048916 | Bacteria | 2951 |
| 484 | Ga0496113_0063088 | 3300048916 | Bacteria | 2800 |
| 485 | Ga0496113_0141334 | 3300048916 | Bacteria | 1894 |
| 486 | Ga0496113_0144274 | 3300048916 | Bacteria | 1875 |
| 487 | Ga0496114_0056194 | 3300048917 | Bacteria | 3284 |
| 488 | Ga0496114_0251886 | 3300048917 | Bacteria | 1554 |
| 489 | Ga0496115_0027586 | 3300048918 | Bacteria | 4444 |
| 490 | Ga0496115_0513395 | 3300048918 | Bacteria | 962 |
| 491 | Ga0496121_0002905 | 3300048924 | Bacteria | 25149 |
| 492 | Ga0496121_0040466 | 3300048924 | Bacteria | 4088 |
| 493 | Ga0501031_0015366 | 3300049568 | Bacteria | 4972 |
| 494 | Ga0501031_0107329 | 3300049568 | Bacteria | 1823 |
| 495 | Ga0501031_0128007 | 3300049568 | Bacteria | 1659 |
| 496 | Ga0501031_0413723 | 3300049568 | Bacteria | 872 |
| 497 | Ga0501032_0120371 | 3300049569 | Bacteria | 1735 |
| 498 | Ga0501033_0008996 | 3300049570 | Bacteria | 7707 |
| 499 | Ga0501036_0007946 | 3300049572 | Bacteria | 8681 |
| 500 | Ga0501036_0075654 | 3300049572 | Bacteria | 2847 |
| 501 | Ga0501036_0090562 | 3300049572 | Bacteria | 2584 |
| 502 | Ga0501036_0095413 | 3300049572 | Bacteria | 2514 |
| 503 | Ga0501036_0166909 | 3300049572 | Bacteria | 1855 |
| 504 | Ga0501037_0248786 | 3300049573 | Bacteria | 1244 |
| 505 | Ga0501039_0054318 | 3300049575 | Bacteria | 3100 |
| 506 | Ga0501039_0163777 | 3300049575 | Bacteria | 1748 |
| 507 | Ga0501039_0222059 | 3300049575 | Bacteria | 1485 |
| 508 | Ga0501039_0474536 | 3300049575 | Bacteria | 982 |
| 509 | Ga0501040_0021069 | 3300049576 | Bacteria | 4347 |
| 510 | Ga0501040_0097982 | 3300049576 | Bacteria | 2043 |
| 511 | Ga0501040_0155654 | 3300049576 | Bacteria | 1614 |
| 512 | Ga0501042_0090369 | 3300049578 | Bacteria | 2198 |
| 513 | Ga0501042_0092001 | 3300049578 | Bacteria | 2177 |
| 514 | Ga0501046_0003186 | 3300049580 | Bacteria | 15124 |
| 515 | Ga0501046_0471848 | 3300049580 | Bacteria | 901 |
| 516 | Ga0501047_0130957 | 3300049581 | Bacteria | 2389 |
| 517 | Ga0501048_0033937 | 3300049582 | Bacteria | 3684 |
| 518 | Ga0501048_0177021 | 3300049582 | Bacteria | 1512 |
| 519 | Ga0501048_0407300 | 3300049582 | Bacteria | 972 |
| 520 | Ga0501067_0040249 | 3300049583 | Bacteria | 2596 |
| 521 | Ga0501068_0005484 | 3300049584 | Bacteria | 6950 |
| 522 | Ga0501068_0248030 | 3300049584 | Bacteria | 1134 |
| 523 | Ga0501068_0294708 | 3300049584 | Bacteria | 1038 |
| 524 | Ga0501069_0001850 | 3300049585 | Bacteria | 10563 |
| 525 | Ga0501070_0002054 | 3300049586 | Bacteria | 17680 |
| 526 | Ga0501071_0011497 | 3300049587 | Bacteria | 5968 |
| 527 | Ga0501071_0126020 | 3300049587 | Bacteria | 1901 |
| 528 | Ga0501072_0021769 | 3300049588 | Bacteria | 4971 |
| 529 | Ga0501072_0103323 | 3300049588 | Bacteria | 2265 |
| 530 | Ga0501072_0122749 | 3300049588 | Bacteria | 2069 |
| 531 | Ga0501072_0307924 | 3300049588 | Bacteria | 1259 |
| 532 | Ga0501074_0197442 | 3300049590 | Bacteria | 1434 |
| 533 | Ga0501075_0012953 | 3300049591 | Bacteria | 5941 |
| 534 | Ga0501075_0017348 | 3300049591 | Bacteria | 5201 |
| 535 | Ga0501075_0044675 | 3300049591 | Bacteria | 3324 |
| 536 | Ga0501076_0016599 | 3300049592 | Bacteria | 5583 |
| 537 | Ga0501076_0019685 | 3300049592 | Bacteria | 5161 |
| 538 | Ga0501076_0089428 | 3300049592 | Bacteria | 2475 |
| 539 | Ga0501079_0134842 | 3300049741 | Bacteria | 1922 |
| 540 | Ga0501079_0366495 | 3300049741 | Bacteria | 1129 |
| 541 | Ga0501081_0040435 | 3300049743 | Bacteria | 3193 |
| 542 | Ga0501081_0068409 | 3300049743 | Bacteria | 2472 |
| 543 | Ga0501081_0597543 | 3300049743 | Bacteria | 826 |
| 544 | Ga0501083_0004221 | 3300049744 | Bacteria | 10119 |
| 545 | Ga0501083_0300641 | 3300049744 | Bacteria | 1044 |
| 546 | Ga0501083_0393486 | 3300049744 | Bacteria | 902 |
| 547 | Ga0501035_0319915 | 3300049822 | Bacteria | 1304 |
| 548 | Ga0501045_0134886 | 3300049824 | Bacteria | 1835 |
| 549 | nmdc:mga03n38_83068_c1 | 3300050490 | Bacteria | 1509 |
| 550 | nmdc:mga0yw44_296812_c1 | 3300050492 | Bacteria | 1082 |
| 551 | nmdc:mga05p37_1195281_c1 | 3300050507 | Bacteria | 786 |
| 552 | nmdc:mga05p37_432160_c1 | 3300050507 | Bacteria | 1529 |
| 553 | nmdc:mga05p37_94787_c1 | 3300050507 | Bacteria | 3677 |
| 554 | nmdc:mga09592_397683_c1 | 3300050508 | Bacteria | 1191 |
| 555 | nmdc:mga09592_788548_c1 | 3300050508 | Bacteria | 804 |
| 556 | nmdc:mga09592_95482_c1 | 3300050508 | Bacteria | 2543 |
| 557 | nmdc:mga0qj67_10324_c1 | 3300050509 | Bacteria | 6975 |
| 558 | nmdc:mga0qj67_190975_c1 | 3300050509 | Bacteria | 1664 |
| 559 | nmdc:mga0qj67_446_c1 | 3300050509 | Bacteria | 28226 |
| 560 | nmdc:mga06r32_145332_c1 | 3300050510 | Bacteria | 2349 |
| 561 | nmdc:mga06r32_18055_c1 | 3300050510 | Bacteria | 6451 |
| 562 | nmdc:mga06r32_530314_c1 | 3300050510 | Bacteria | 1152 |
| 563 | nmdc:mga06r32_78865_c1 | 3300050510 | Bacteria | 3202 |
| 564 | nmdc:mga06r32_96700_c1 | 3300050510 | Bacteria | 2892 |
| 565 | nmdc:mga08y16_120495_c1 | 3300050511 | Bacteria | 2730 |
| 566 | nmdc:mga08y16_140265_c1 | 3300050511 | Bacteria | 2513 |
| 567 | nmdc:mga08y16_55395_c1 | 3300050511 | Bacteria | 4143 |
| 568 | nmdc:mga08y16_97723_c1 | 3300050511 | Bacteria | 3058 |
| 569 | nmdc:mga0n895_174491_c1 | 3300050512 | Bacteria | 2181 |
| 570 | nmdc:mga0n895_320794_c1 | 3300050512 | Bacteria | 1570 |
| 571 | nmdc:mga08x19_42335_c1 | 3300050514 | Bacteria | 2903 |
| 572 | nmdc:mga0a205_109360_c1 | 3300050515 | Bacteria | 2662 |
| 573 | nmdc:mga0a205_137141_c1 | 3300050515 | Bacteria | 2347 |
| 574 | nmdc:mga0a205_167524_c1 | 3300050515 | Bacteria | 2093 |
| 575 | Ga0500556_0000817 | 3300053104 | Bacteria | 17987 |
| 576 | Ga0500568_0105172 | 3300053139 | Bacteria | 1058 |
| 577 | Ga0500616_0002891 | 3300053153 | Bacteria | 13758 |
| 578 | Ga0500616_0021454 | 3300053153 | Bacteria | 3621 |
| 579 | Ga0501084_0089920 | 3300054114 | Bacteria | 2577 |
| 580 | Ga0501084_0096740 | 3300054114 | Bacteria | 2479 |
| 581 | Ga0501084_0109542 | 3300054114 | Bacteria | 2320 |
| 582 | Ga0501084_0284490 | 3300054114 | Bacteria | 1396 |
| 583 | Ga0501084_0294738 | 3300054114 | Bacteria | 1370 |
| 584 | Ga0501082_0002632 | 3300060353 | Bacteria | 15690 |
| 585 | Ga0501082_0036340 | 3300060353 | Bacteria | 4244 |
| 586 | Ga0501082_0135649 | 3300060353 | Bacteria | 2135 |
| 587 | Ga0501082_0585324 | 3300060353 | Bacteria | 976 |
| 588 | Ga0530510_0073686 | 3300061734 | Bacteria | 2479 |
| 589 | Ga0530510_0289155 | 3300061734 | Bacteria | 1225 |
| 590 | Ga0530510_0326061 | 3300061734 | Bacteria | 1151 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031901 | Ga0307406_10433423 | Ga0307406_104334232 | 204 |
| 2 | 3300049590 | Ga0501074_0197442 | Ga0501074_0197442_589_1236 | 205 |
| 3 | 3300037466 | Ga0395898_0502795 | Ga0395898_0502795_464_1135 | 208 |
| 4 | 3300045976 | Ga0466967_0515325 | Ga0466967_0515325_488_1162 | 209 |
| 5 | 3300048914 | Ga0496111_0195168 | Ga0496111_0195168_811_1485 | 209 |
| 6 | 3300005981 | Ga0081538_10001367 | Ga0081538_1000136725 | 210 |
| 7 | 3300045976 | Ga0466967_0204909 | Ga0466967_0204909_892_1647 | 220 |
| 8 | 3300005457 | Ga0070662_100610517 | Ga0070662_1006105171 | 221 |
| 9 | 3300003373 | JGI25407J50210_10036156 | JGI25407J50210_100361562 | 224 |
| 10 | 3300005981 | Ga0081538_10004469 | Ga0081538_1000446912 | 224 |
| 11 | 3300005981 | Ga0081538_10022159 | Ga0081538_100221594 | 225 |
| 12 | 3300049741 | Ga0501079_0134842 | Ga0501079_0134842_405_1127 | 225 |
| 13 | 3300026075 | Ga0207708_10272168 | Ga0207708_102721682 | 228 |
| 14 | 3300020069 | Ga0197907_10222571 | Ga0197907_102225712 | 229 |
| 15 | 3300005347 | Ga0070668_100748613 | Ga0070668_1007486131 | 230 |
| 16 | 3300044901 | Ga0466960_0053547 | Ga0466960_0053547_308_1048 | 231 |
| 17 | 3300046474 | Ga0495605_0186812 | Ga0495605_0186812_138_881 | 231 |
| 18 | 3300025908 | Ga0207643_10156109 | Ga0207643_101561092 | 232 |
| 19 | 3300031903 | Ga0307407_10230447 | Ga0307407_102304472 | 232 |
| 20 | 3300045976 | Ga0466967_0143185 | Ga0466967_0143185_570_1313 | 232 |
| 21 | 3300045976 | Ga0466967_0230694 | Ga0466967_0230694_857_1600 | 232 |
| 22 | 3300048924 | Ga0496121_0002905 | Ga0496121_0002905_15679_16422 | 232 |
| 23 | 3300049568 | Ga0501031_0015366 | Ga0501031_0015366_3912_4664 | 232 |
| 24 | 3300049569 | Ga0501032_0120371 | Ga0501032_0120371_272_1024 | 232 |
| 25 | 3300049570 | Ga0501033_0008996 | Ga0501033_0008996_5387_6139 | 232 |
| 26 | 3300049572 | Ga0501036_0007946 | Ga0501036_0007946_6426_7178 | 232 |
| 27 | 3300049573 | Ga0501037_0248786 | Ga0501037_0248786_390_1142 | 232 |
| 28 | 3300049575 | Ga0501039_0163777 | Ga0501039_0163777_222_974 | 232 |
| 29 | 3300049580 | Ga0501046_0003186 | Ga0501046_0003186_36_788 | 232 |
| 30 | 3300049583 | Ga0501067_0040249 | Ga0501067_0040249_35_787 | 232 |
| 31 | 3300049584 | Ga0501068_0005484 | Ga0501068_0005484_4612_5364 | 232 |
| 32 | 3300049584 | Ga0501068_0294708 | Ga0501068_0294708_209_964 | 232 |
| 33 | 3300049585 | Ga0501069_0001850 | Ga0501069_0001850_8323_9075 | 232 |
| 34 | 3300049586 | Ga0501070_0002054 | Ga0501070_0002054_8663_9415 | 232 |
| 35 | 3300049744 | Ga0501083_0004221 | Ga0501083_0004221_7551_8303 | 232 |
| 36 | 3300060353 | Ga0501082_0002632 | Ga0501082_0002632_1662_2414 | 232 |
| 37 | 3300003373 | JGI25407J50210_10008507 | JGI25407J50210_100085072 | 233 |
| 38 | 3300003373 | JGI25407J50210_10009070 | JGI25407J50210_100090702 | 233 |
| 39 | 3300003373 | JGI25407J50210_10018012 | JGI25407J50210_100180123 | 233 |
| 40 | 3300003373 | JGI25407J50210_10023460 | JGI25407J50210_100234602 | 233 |
| 41 | 3300005327 | Ga0070658_10298391 | Ga0070658_102983912 | 233 |
| 42 | 3300005329 | Ga0070683_100003128 | Ga0070683_10000312811 | 233 |
| 43 | 3300005329 | Ga0070683_100653778 | Ga0070683_1006537781 | 233 |
| 44 | 3300005334 | Ga0068869_100156531 | Ga0068869_1001565313 | 233 |
| 45 | 3300005334 | Ga0068869_100403438 | Ga0068869_1004034382 | 233 |
| 46 | 3300005336 | Ga0070680_100133213 | Ga0070680_1001332132 | 233 |
| 47 | 3300005337 | Ga0070682_100193034 | Ga0070682_1001930342 | 233 |
| 48 | 3300005339 | Ga0070660_100254115 | Ga0070660_1002541152 | 233 |
| 49 | 3300005341 | Ga0070691_10013616 | Ga0070691_100136162 | 233 |
| 50 | 3300005344 | Ga0070661_100086896 | Ga0070661_1000868962 | 233 |
| 51 | 3300005344 | Ga0070661_100469862 | Ga0070661_1004698622 | 233 |
| 52 | 3300005347 | Ga0070668_100265874 | Ga0070668_1002658742 | 233 |
| 53 | 3300005347 | Ga0070668_100332451 | Ga0070668_1003324512 | 233 |
| 54 | 3300005356 | Ga0070674_100345025 | Ga0070674_1003450252 | 233 |
| 55 | 3300005366 | Ga0070659_100046843 | Ga0070659_1000468432 | 233 |
| 56 | 3300005441 | Ga0070700_100269391 | Ga0070700_1002693912 | 233 |
| 57 | 3300005455 | Ga0070663_100262323 | Ga0070663_1002623232 | 233 |
| 58 | 3300005456 | Ga0070678_100318190 | Ga0070678_1003181902 | 233 |
| 59 | 3300005457 | Ga0070662_100004913 | Ga0070662_1000049138 | 233 |
| 60 | 3300005457 | Ga0070662_100375669 | Ga0070662_1003756692 | 233 |
| 61 | 3300005458 | Ga0070681_10111935 | Ga0070681_101119353 | 233 |
| 62 | 3300005458 | Ga0070681_10153818 | Ga0070681_101538184 | 233 |
| 63 | 3300005459 | Ga0068867_100351565 | Ga0068867_1003515652 | 233 |
| 64 | 3300005530 | Ga0070679_100020722 | Ga0070679_1000207223 | 233 |
| 65 | 3300005535 | Ga0070684_100170373 | Ga0070684_1001703733 | 233 |
| 66 | 3300005535 | Ga0070684_100256214 | Ga0070684_1002562143 | 233 |
| 67 | 3300005535 | Ga0070684_100673698 | Ga0070684_1006736981 | 233 |
| 68 | 3300005543 | Ga0070672_100150432 | Ga0070672_1001504322 | 233 |
| 69 | 3300005544 | Ga0070686_100376193 | Ga0070686_1003761932 | 233 |
| 70 | 3300005548 | Ga0070665_100016871 | Ga0070665_1000168718 | 233 |
| 71 | 3300005564 | Ga0070664_100399397 | Ga0070664_1003993972 | 233 |
| 72 | 3300005578 | Ga0068854_100313992 | Ga0068854_1003139922 | 233 |
| 73 | 3300005614 | Ga0068856_100018365 | Ga0068856_1000183655 | 233 |
| 74 | 3300005616 | Ga0068852_100007636 | Ga0068852_1000076362 | 233 |
| 75 | 3300005719 | Ga0068861_100048317 | Ga0068861_1000483173 | 233 |
| 76 | 3300005844 | Ga0068862_100161932 | Ga0068862_1001619324 | 233 |
| 77 | 3300005937 | Ga0081455_10050371 | Ga0081455_100503716 | 233 |
| 78 | 3300005937 | Ga0081455_10097402 | Ga0081455_100974022 | 233 |
| 79 | 3300005937 | Ga0081455_10133119 | Ga0081455_101331191 | 233 |
| 80 | 3300005981 | Ga0081538_10000259 | Ga0081538_1000025936 | 233 |
| 81 | 3300005981 | Ga0081538_10000464 | Ga0081538_1000046442 | 233 |
| 82 | 3300005981 | Ga0081538_10001681 | Ga0081538_1000168113 | 233 |
| 83 | 3300005981 | Ga0081538_10004023 | Ga0081538_100040238 | 233 |
| 84 | 3300005981 | Ga0081538_10004443 | Ga0081538_1000444316 | 233 |
| 85 | 3300005981 | Ga0081538_10006296 | Ga0081538_100062967 | 233 |
| 86 | 3300005981 | Ga0081538_10006778 | Ga0081538_1000677811 | 233 |
| 87 | 3300005981 | Ga0081538_10011443 | Ga0081538_100114433 | 233 |
| 88 | 3300005981 | Ga0081538_10012184 | Ga0081538_100121845 | 233 |
| 89 | 3300005981 | Ga0081538_10013454 | Ga0081538_100134548 | 233 |
| 90 | 3300005981 | Ga0081538_10021110 | Ga0081538_100211103 | 233 |
| 91 | 3300005981 | Ga0081538_10023244 | Ga0081538_100232442 | 233 |
| 92 | 3300005981 | Ga0081538_10025455 | Ga0081538_100254552 | 233 |
| 93 | 3300005981 | Ga0081538_10052297 | Ga0081538_100522974 | 233 |
| 94 | 3300005981 | Ga0081538_10103597 | Ga0081538_101035972 | 233 |
| 95 | 3300005981 | Ga0081538_10127687 | Ga0081538_101276872 | 233 |
| 96 | 3300005981 | Ga0081538_10137357 | Ga0081538_101373572 | 233 |
| 97 | 3300005983 | Ga0081540_1089664 | Ga0081540_10896642 | 233 |
| 98 | 3300006038 | Ga0075365_10044514 | Ga0075365_100445142 | 233 |
| 99 | 3300006048 | Ga0075363_100107377 | Ga0075363_1001073772 | 233 |
| 100 | 3300006058 | Ga0075432_10016207 | Ga0075432_100162075 | 233 |
| 101 | 3300006058 | Ga0075432_10039436 | Ga0075432_100394363 | 233 |
| 102 | 3300006844 | Ga0075428_100042084 | Ga0075428_1000420843 | 233 |
| 103 | 3300006844 | Ga0075428_100110280 | Ga0075428_1001102805 | 233 |
| 104 | 3300006844 | Ga0075428_100147835 | Ga0075428_1001478352 | 233 |
| 105 | 3300006844 | Ga0075428_100564966 | Ga0075428_1005649662 | 233 |
| 106 | 3300006846 | Ga0075430_100004041 | Ga0075430_1000040414 | 233 |
| 107 | 3300006846 | Ga0075430_100006490 | Ga0075430_1000064903 | 233 |
| 108 | 3300006846 | Ga0075430_100315407 | Ga0075430_1003154072 | 233 |
| 109 | 3300006847 | Ga0075431_100045733 | Ga0075431_1000457334 | 233 |
| 110 | 3300006847 | Ga0075431_100067922 | Ga0075431_1000679223 | 233 |
| 111 | 3300006847 | Ga0075431_100268211 | Ga0075431_1002682113 | 233 |
| 112 | 3300006852 | Ga0075433_10526690 | Ga0075433_105266902 | 233 |
| 113 | 3300006880 | Ga0075429_100041633 | Ga0075429_1000416334 | 233 |
| 114 | 3300006880 | Ga0075429_100273943 | Ga0075429_1002739432 | 233 |
| 115 | 3300006880 | Ga0075429_100420881 | Ga0075429_1004208812 | 233 |
| 116 | 3300006881 | Ga0068865_100268802 | Ga0068865_1002688022 | 233 |
| 117 | 3300006881 | Ga0068865_100443693 | Ga0068865_1004436931 | 233 |
| 118 | 3300009093 | Ga0105240_10139447 | Ga0105240_101394473 | 233 |
| 119 | 3300009094 | Ga0111539_10099383 | Ga0111539_100993833 | 233 |
| 120 | 3300009094 | Ga0111539_10100992 | Ga0111539_101009923 | 233 |
| 121 | 3300009094 | Ga0111539_10427148 | Ga0111539_104271483 | 233 |
| 122 | 3300009098 | Ga0105245_10239110 | Ga0105245_102391102 | 233 |
| 123 | 3300009098 | Ga0105245_10454099 | Ga0105245_104540992 | 233 |
| 124 | 3300009147 | Ga0114129_10000894 | Ga0114129_1000089412 | 233 |
| 125 | 3300009147 | Ga0114129_10019446 | Ga0114129_100194462 | 233 |
| 126 | 3300009147 | Ga0114129_10175377 | Ga0114129_101753774 | 233 |
| 127 | 3300009147 | Ga0114129_10326558 | Ga0114129_103265584 | 233 |
| 128 | 3300009147 | Ga0114129_10492223 | Ga0114129_104922232 | 233 |
| 129 | 3300009147 | Ga0114129_11334778 | Ga0114129_113347782 | 233 |
| 130 | 3300009148 | Ga0105243_10309872 | Ga0105243_103098722 | 233 |
| 131 | 3300009148 | Ga0105243_10439611 | Ga0105243_104396112 | 233 |
| 132 | 3300009176 | Ga0105242_10542542 | Ga0105242_105425421 | 233 |
| 133 | 3300009545 | Ga0105237_10359841 | Ga0105237_103598411 | 233 |
| 134 | 3300009551 | Ga0105238_10026826 | Ga0105238_100268263 | 233 |
| 135 | 3300009551 | Ga0105238_10660997 | Ga0105238_106609972 | 233 |
| 136 | 3300009553 | Ga0105249_10042917 | Ga0105249_100429172 | 233 |
| 137 | 3300009987 | Ga0105030_105291 | Ga0105030_1052912 | 233 |
| 138 | 3300010375 | Ga0105239_10209296 | Ga0105239_102092962 | 233 |
| 139 | 3300010375 | Ga0105239_10746437 | Ga0105239_107464371 | 233 |
| 140 | 3300010375 | Ga0105239_10938538 | Ga0105239_109385382 | 233 |
| 141 | 3300011119 | Ga0105246_10867743 | Ga0105246_108677431 | 233 |
| 142 | 3300013104 | Ga0157370_10035271 | Ga0157370_100352715 | 233 |
| 143 | 3300013105 | Ga0157369_10132800 | Ga0157369_101328002 | 233 |
| 144 | 3300013306 | Ga0163162_10145768 | Ga0163162_101457683 | 233 |
| 145 | 3300013307 | Ga0157372_10250158 | Ga0157372_102501582 | 233 |
| 146 | 3300013307 | Ga0157372_10824319 | Ga0157372_108243191 | 233 |
| 147 | 3300013308 | Ga0157375_10430018 | Ga0157375_104300182 | 233 |
| 148 | 3300014969 | Ga0157376_10727278 | Ga0157376_107272781 | 233 |
| 149 | 3300025901 | Ga0207688_10389423 | Ga0207688_103894231 | 233 |
| 150 | 3300025907 | Ga0207645_10093615 | Ga0207645_100936151 | 233 |
| 151 | 3300025907 | Ga0207645_10143468 | Ga0207645_101434682 | 233 |
| 152 | 3300025909 | Ga0207705_10317755 | Ga0207705_103177552 | 233 |
| 153 | 3300025912 | Ga0207707_10262225 | Ga0207707_102622252 | 233 |
| 154 | 3300025913 | Ga0207695_10141789 | Ga0207695_101417892 | 233 |
| 155 | 3300025914 | Ga0207671_10049230 | Ga0207671_100492303 | 233 |
| 156 | 3300025918 | Ga0207662_10187226 | Ga0207662_101872263 | 233 |
| 157 | 3300025919 | Ga0207657_10015219 | Ga0207657_100152194 | 233 |
| 158 | 3300025920 | Ga0207649_10124207 | Ga0207649_101242073 | 233 |
| 159 | 3300025920 | Ga0207649_10553230 | Ga0207649_105532301 | 233 |
| 160 | 3300025921 | Ga0207652_10148253 | Ga0207652_101482532 | 233 |
| 161 | 3300025924 | Ga0207694_10263553 | Ga0207694_102635532 | 233 |
| 162 | 3300025927 | Ga0207687_10108496 | Ga0207687_101084962 | 233 |
| 163 | 3300025927 | Ga0207687_10138514 | Ga0207687_101385143 | 233 |
| 164 | 3300025927 | Ga0207687_10172367 | Ga0207687_101723671 | 233 |
| 165 | 3300025932 | Ga0207690_10137147 | Ga0207690_101371471 | 233 |
| 166 | 3300025932 | Ga0207690_10207043 | Ga0207690_102070431 | 233 |
| 167 | 3300025932 | Ga0207690_10228838 | Ga0207690_102288382 | 233 |
| 168 | 3300025932 | Ga0207690_10311796 | Ga0207690_103117962 | 233 |
| 169 | 3300025933 | Ga0207706_10021747 | Ga0207706_100217472 | 233 |
| 170 | 3300025933 | Ga0207706_10670909 | Ga0207706_106709091 | 233 |
| 171 | 3300025944 | Ga0207661_10001491 | Ga0207661_1000149116 | 233 |
| 172 | 3300025944 | Ga0207661_10008054 | Ga0207661_100080547 | 233 |
| 173 | 3300025944 | Ga0207661_10444474 | Ga0207661_104444742 | 233 |
| 174 | 3300025945 | Ga0207679_10252740 | Ga0207679_102527402 | 233 |
| 175 | 3300025945 | Ga0207679_10270878 | Ga0207679_102708783 | 233 |
| 176 | 3300025945 | Ga0207679_10313831 | Ga0207679_103138312 | 233 |
| 177 | 3300025945 | Ga0207679_10333253 | Ga0207679_103332532 | 233 |
| 178 | 3300025949 | Ga0207667_10252528 | Ga0207667_102525283 | 233 |
| 179 | 3300025961 | Ga0207712_10071593 | Ga0207712_100715934 | 233 |
| 180 | 3300025972 | Ga0207668_10080774 | Ga0207668_100807742 | 233 |
| 181 | 3300025972 | Ga0207668_10197955 | Ga0207668_101979553 | 233 |
| 182 | 3300025981 | Ga0207640_10070975 | Ga0207640_100709752 | 233 |
| 183 | 3300025981 | Ga0207640_10710990 | Ga0207640_107109901 | 233 |
| 184 | 3300026023 | Ga0207677_10197367 | Ga0207677_101973672 | 233 |
| 185 | 3300026067 | Ga0207678_10048920 | Ga0207678_100489206 | 233 |
| 186 | 3300026075 | Ga0207708_10140641 | Ga0207708_101406412 | 233 |
| 187 | 3300026075 | Ga0207708_10214256 | Ga0207708_102142562 | 233 |
| 188 | 3300026078 | Ga0207702_10165912 | Ga0207702_101659122 | 233 |
| 189 | 3300026089 | Ga0207648_10085891 | Ga0207648_100858911 | 233 |
| 190 | 3300026089 | Ga0207648_10152151 | Ga0207648_101521514 | 233 |
| 191 | 3300026116 | Ga0207674_10496884 | Ga0207674_104968842 | 233 |
| 192 | 3300026118 | Ga0207675_100004077 | Ga0207675_1000040773 | 233 |
| 193 | 3300026118 | Ga0207675_100437102 | Ga0207675_1004371022 | 233 |
| 194 | 3300026121 | Ga0207683_10363572 | Ga0207683_103635722 | 233 |
| 195 | 3300026121 | Ga0207683_10695381 | Ga0207683_106953812 | 233 |
| 196 | 3300026142 | Ga0207698_10299250 | Ga0207698_102992502 | 233 |
| 197 | 3300026142 | Ga0207698_10615811 | Ga0207698_106158112 | 233 |
| 198 | 3300027907 | Ga0207428_10098151 | Ga0207428_100981512 | 233 |
| 199 | 3300027907 | Ga0207428_10162337 | Ga0207428_101623371 | 233 |
| 200 | 3300028380 | Ga0268265_10447133 | Ga0268265_104471332 | 233 |
| 201 | 3300031731 | Ga0307405_10143644 | Ga0307405_101436442 | 233 |
| 202 | 3300031731 | Ga0307405_10184845 | Ga0307405_101848451 | 233 |
| 203 | 3300031731 | Ga0307405_10404849 | Ga0307405_104048491 | 233 |
| 204 | 3300031824 | Ga0307413_10043767 | Ga0307413_100437675 | 233 |
| 205 | 3300031824 | Ga0307413_10056307 | Ga0307413_100563073 | 233 |
| 206 | 3300031824 | Ga0307413_10400550 | Ga0307413_104005502 | 233 |
| 207 | 3300031824 | Ga0307413_10623326 | Ga0307413_106233261 | 233 |
| 208 | 3300031852 | Ga0307410_10037945 | Ga0307410_100379453 | 233 |
| 209 | 3300031852 | Ga0307410_10064772 | Ga0307410_100647722 | 233 |
| 210 | 3300031852 | Ga0307410_10129448 | Ga0307410_101294482 | 233 |
| 211 | 3300031852 | Ga0307410_10276485 | Ga0307410_102764852 | 233 |
| 212 | 3300031852 | Ga0307410_10587070 | Ga0307410_105870702 | 233 |
| 213 | 3300031901 | Ga0307406_10091528 | Ga0307406_100915282 | 233 |
| 214 | 3300031901 | Ga0307406_10137733 | Ga0307406_101377333 | 233 |
| 215 | 3300031901 | Ga0307406_10577316 | Ga0307406_105773162 | 233 |
| 216 | 3300031903 | Ga0307407_10139274 | Ga0307407_101392742 | 233 |
| 217 | 3300031911 | Ga0307412_10080143 | Ga0307412_100801433 | 233 |
| 218 | 3300031911 | Ga0307412_10093667 | Ga0307412_100936672 | 233 |
| 219 | 3300031995 | Ga0307409_100003036 | Ga0307409_1000030366 | 233 |
| 220 | 3300031995 | Ga0307409_100022746 | Ga0307409_1000227465 | 233 |
| 221 | 3300031995 | Ga0307409_100032917 | Ga0307409_1000329172 | 233 |
| 222 | 3300031995 | Ga0307409_100036818 | Ga0307409_1000368183 | 233 |
| 223 | 3300031995 | Ga0307409_100787805 | Ga0307409_1007878052 | 233 |
| 224 | 3300032002 | Ga0307416_100027810 | Ga0307416_1000278104 | 233 |
| 225 | 3300032002 | Ga0307416_100035108 | Ga0307416_1000351084 | 233 |
| 226 | 3300032002 | Ga0307416_100041584 | Ga0307416_1000415842 | 233 |
| 227 | 3300032002 | Ga0307416_100160694 | Ga0307416_1001606942 | 233 |
| 228 | 3300032002 | Ga0307416_100206138 | Ga0307416_1002061383 | 233 |
| 229 | 3300032002 | Ga0307416_100425155 | Ga0307416_1004251552 | 233 |
| 230 | 3300032002 | Ga0307416_100464265 | Ga0307416_1004642652 | 233 |
| 231 | 3300032002 | Ga0307416_101356117 | Ga0307416_1013561171 | 233 |
| 232 | 3300032004 | Ga0307414_10192950 | Ga0307414_101929502 | 233 |
| 233 | 3300032005 | Ga0307411_10105111 | Ga0307411_101051115 | 233 |
| 234 | 3300032005 | Ga0307411_10281518 | Ga0307411_102815182 | 233 |
| 235 | 3300032126 | Ga0307415_100008278 | Ga0307415_1000082784 | 233 |
| 236 | 3300032126 | Ga0307415_100014045 | Ga0307415_1000140456 | 233 |
| 237 | 3300032126 | Ga0307415_100014488 | Ga0307415_1000144884 | 233 |
| 238 | 3300032126 | Ga0307415_100015841 | Ga0307415_1000158413 | 233 |
| 239 | 3300032126 | Ga0307415_100118736 | Ga0307415_1001187362 | 233 |
| 240 | 3300032126 | Ga0307415_100317086 | Ga0307415_1003170861 | 233 |
| 241 | 3300035085 | Ga0373929_0030967 | Ga0373929_0030967_261_1013 | 233 |
| 242 | 3300037418 | Ga0395900_0286144 | Ga0395900_0286144_723_1475 | 233 |
| 243 | 3300037466 | Ga0395898_0269748 | Ga0395898_0269748_360_1106 | 233 |
| 244 | 3300038443 | Ga0395901_0190326 | Ga0395901_0190326_1228_1986 | 233 |
| 245 | 3300042005 | Ga0439448_0032507 | Ga0439448_0032507_804_1550 | 233 |
| 246 | 3300042461 | Ga0439460_0097386 | Ga0439460_0097386_157_903 | 233 |
| 247 | 3300044694 | Ga0466963_0048131 | Ga0466963_0048131_1864_2610 | 233 |
| 248 | 3300044694 | Ga0466963_0089361 | Ga0466963_0089361_13_759 | 233 |
| 249 | 3300044694 | Ga0466963_0163823 | Ga0466963_0163823_420_1166 | 233 |
| 250 | 3300044694 | Ga0466963_0226953 | Ga0466963_0226953_247_993 | 233 |
| 251 | 3300044694 | Ga0466963_0228824 | Ga0466963_0228824_521_1267 | 233 |
| 252 | 3300044842 | Ga0466957_0234986 | Ga0466957_0234986_412_1158 | 233 |
| 253 | 3300044842 | Ga0466957_0257770 | Ga0466957_0257770_206_952 | 233 |
| 254 | 3300044901 | Ga0466960_0000054 | Ga0466960_0000054_33267_34022 | 233 |
| 255 | 3300044901 | Ga0466960_0057360 | Ga0466960_0057360_1052_1798 | 233 |
| 256 | 3300044901 | Ga0466960_0067887 | Ga0466960_0067887_214_966 | 233 |
| 257 | 3300044901 | Ga0466960_0152734 | Ga0466960_0152734_56_802 | 233 |
| 258 | 3300045836 | Ga0466958_0148940 | Ga0466958_0148940_603_1349 | 233 |
| 259 | 3300045976 | Ga0466967_0009693 | Ga0466967_0009693_2812_3558 | 233 |
| 260 | 3300045976 | Ga0466967_0019837 | Ga0466967_0019837_890_1636 | 233 |
| 261 | 3300045976 | Ga0466967_0025253 | Ga0466967_0025253_3085_3831 | 233 |
| 262 | 3300045976 | Ga0466967_0033230 | Ga0466967_0033230_3112_3858 | 233 |
| 263 | 3300045976 | Ga0466967_0055312 | Ga0466967_0055312_2206_2952 | 233 |
| 264 | 3300045976 | Ga0466967_0127521 | Ga0466967_0127521_247_993 | 233 |
| 265 | 3300045976 | Ga0466967_0236559 | Ga0466967_0236559_323_1069 | 233 |
| 266 | 3300045976 | Ga0466967_0262886 | Ga0466967_0262886_454_1212 | 233 |
| 267 | 3300046473 | Ga0495582_0126714 | Ga0495582_0126714_181_927 | 233 |
| 268 | 3300046500 | Ga0495596_0045089 | Ga0495596_0045089_848_1597 | 233 |
| 269 | 3300046515 | Ga0495620_0096847 | Ga0495620_0096847_313_1062 | 233 |
| 270 | 3300046615 | Ga0495656_0126057 | Ga0495656_0126057_330_1079 | 233 |
| 271 | 3300047320 | Ga0495672_0037799 | Ga0495672_0037799_1428_2177 | 233 |
| 272 | 3300048915 | Ga0496112_0021423 | Ga0496112_0021423_325_1083 | 233 |
| 273 | 3300048915 | Ga0496112_0140653 | Ga0496112_0140653_302_1048 | 233 |
| 274 | 3300048915 | Ga0496112_0805430 | Ga0496112_0805430_30_785 | 233 |
| 275 | 3300048916 | Ga0496113_0056333 | Ga0496113_0056333_956_1714 | 233 |
| 276 | 3300048916 | Ga0496113_0144274 | Ga0496113_0144274_596_1342 | 233 |
| 277 | 3300048918 | Ga0496115_0513395 | Ga0496115_0513395_62_808 | 233 |
| 278 | 3300049568 | Ga0501031_0107329 | Ga0501031_0107329_394_1140 | 233 |
| 279 | 3300049568 | Ga0501031_0128007 | Ga0501031_0128007_107_856 | 233 |
| 280 | 3300049568 | Ga0501031_0413723 | Ga0501031_0413723_91_840 | 233 |
| 281 | 3300049572 | Ga0501036_0075654 | Ga0501036_0075654_161_907 | 233 |
| 282 | 3300049572 | Ga0501036_0090562 | Ga0501036_0090562_735_1481 | 233 |
| 283 | 3300049572 | Ga0501036_0095413 | Ga0501036_0095413_1477_2226 | 233 |
| 284 | 3300049572 | Ga0501036_0166909 | Ga0501036_0166909_696_1442 | 233 |
| 285 | 3300049575 | Ga0501039_0054318 | Ga0501039_0054318_1252_1998 | 233 |
| 286 | 3300049575 | Ga0501039_0222059 | Ga0501039_0222059_118_864 | 233 |
| 287 | 3300049575 | Ga0501039_0474536 | Ga0501039_0474536_95_844 | 233 |
| 288 | 3300049576 | Ga0501040_0021069 | Ga0501040_0021069_2061_2807 | 233 |
| 289 | 3300049576 | Ga0501040_0097982 | Ga0501040_0097982_1094_1840 | 233 |
| 290 | 3300049576 | Ga0501040_0155654 | Ga0501040_0155654_531_1280 | 233 |
| 291 | 3300049578 | Ga0501042_0090369 | Ga0501042_0090369_354_1103 | 233 |
| 292 | 3300049578 | Ga0501042_0092001 | Ga0501042_0092001_773_1519 | 233 |
| 293 | 3300049580 | Ga0501046_0471848 | Ga0501046_0471848_78_824 | 233 |
| 294 | 3300049581 | Ga0501047_0130957 | Ga0501047_0130957_105_851 | 233 |
| 295 | 3300049582 | Ga0501048_0033937 | Ga0501048_0033937_2625_3371 | 233 |
| 296 | 3300049582 | Ga0501048_0177021 | Ga0501048_0177021_260_1006 | 233 |
| 297 | 3300049582 | Ga0501048_0407300 | Ga0501048_0407300_130_879 | 233 |
| 298 | 3300049584 | Ga0501068_0248030 | Ga0501068_0248030_367_1113 | 233 |
| 299 | 3300049587 | Ga0501071_0011497 | Ga0501071_0011497_1732_2478 | 233 |
| 300 | 3300049587 | Ga0501071_0126020 | Ga0501071_0126020_524_1270 | 233 |
| 301 | 3300049588 | Ga0501072_0021769 | Ga0501072_0021769_1614_2360 | 233 |
| 302 | 3300049588 | Ga0501072_0103323 | Ga0501072_0103323_1417_2166 | 233 |
| 303 | 3300049588 | Ga0501072_0122749 | Ga0501072_0122749_607_1353 | 233 |
| 304 | 3300049588 | Ga0501072_0307924 | Ga0501072_0307924_198_944 | 233 |
| 305 | 3300049591 | Ga0501075_0012953 | Ga0501075_0012953_399_1145 | 233 |
| 306 | 3300049591 | Ga0501075_0017348 | Ga0501075_0017348_1819_2568 | 233 |
| 307 | 3300049591 | Ga0501075_0044675 | Ga0501075_0044675_2123_2869 | 233 |
| 308 | 3300049592 | Ga0501076_0016599 | Ga0501076_0016599_3921_4670 | 233 |
| 309 | 3300049592 | Ga0501076_0019685 | Ga0501076_0019685_860_1606 | 233 |
| 310 | 3300049592 | Ga0501076_0089428 | Ga0501076_0089428_662_1408 | 233 |
| 311 | 3300049741 | Ga0501079_0366495 | Ga0501079_0366495_356_1105 | 233 |
| 312 | 3300049743 | Ga0501081_0040435 | Ga0501081_0040435_1094_1843 | 233 |
| 313 | 3300049743 | Ga0501081_0068409 | Ga0501081_0068409_351_1097 | 233 |
| 314 | 3300049743 | Ga0501081_0597543 | Ga0501081_0597543_11_760 | 233 |
| 315 | 3300049744 | Ga0501083_0300641 | Ga0501083_0300641_215_961 | 233 |
| 316 | 3300049744 | Ga0501083_0393486 | Ga0501083_0393486_88_837 | 233 |
| 317 | 3300049822 | Ga0501035_0319915 | Ga0501035_0319915_520_1269 | 233 |
| 318 | 3300049824 | Ga0501045_0134886 | Ga0501045_0134886_354_1100 | 233 |
| 319 | 3300050490 | nmdc:mga03n38_83068_c1 | nmdc:mga03n38_83068_c1_309_1073 | 233 |
| 320 | 3300050492 | nmdc:mga0yw44_296812_c1 | nmdc:mga0yw44_296812_c1_38_787 | 233 |
| 321 | 3300050507 | nmdc:mga05p37_1195281_c1 | nmdc:mga05p37_1195281_c1_11_760 | 233 |
| 322 | 3300050507 | nmdc:mga05p37_432160_c1 | nmdc:mga05p37_432160_c1_677_1426 | 233 |
| 323 | 3300050507 | nmdc:mga05p37_94787_c1 | nmdc:mga05p37_94787_c1_424_1173 | 233 |
| 324 | 3300050508 | nmdc:mga09592_397683_c1 | nmdc:mga09592_397683_c1_292_1041 | 233 |
| 325 | 3300050508 | nmdc:mga09592_788548_c1 | nmdc:mga09592_788548_c1_47_793 | 233 |
| 326 | 3300050508 | nmdc:mga09592_95482_c1 | nmdc:mga09592_95482_c1_228_977 | 233 |
| 327 | 3300050509 | nmdc:mga0qj67_10324_c1 | nmdc:mga0qj67_10324_c1_5024_5773 | 233 |
| 328 | 3300050509 | nmdc:mga0qj67_190975_c1 | nmdc:mga0qj67_190975_c1_417_1166 | 233 |
| 329 | 3300050509 | nmdc:mga0qj67_446_c1 | nmdc:mga0qj67_446_c1_15679_16428 | 233 |
| 330 | 3300050510 | nmdc:mga06r32_145332_c1 | nmdc:mga06r32_145332_c1_1011_1760 | 233 |
| 331 | 3300050510 | nmdc:mga06r32_18055_c1 | nmdc:mga06r32_18055_c1_1728_2477 | 233 |
| 332 | 3300050510 | nmdc:mga06r32_96700_c1 | nmdc:mga06r32_96700_c1_1293_2042 | 233 |
| 333 | 3300050511 | nmdc:mga08y16_120495_c1 | nmdc:mga08y16_120495_c1_1815_2564 | 233 |
| 334 | 3300050511 | nmdc:mga08y16_140265_c1 | nmdc:mga08y16_140265_c1_932_1678 | 233 |
| 335 | 3300050515 | nmdc:mga0a205_137141_c1 | nmdc:mga0a205_137141_c1_11_760 | 233 |
| 336 | 3300053139 | Ga0500568_0105172 | Ga0500568_0105172_280_1026 | 233 |
| 337 | 3300054114 | Ga0501084_0089920 | Ga0501084_0089920_980_1726 | 233 |
| 338 | 3300054114 | Ga0501084_0096740 | Ga0501084_0096740_66_812 | 233 |
| 339 | 3300054114 | Ga0501084_0109542 | Ga0501084_0109542_599_1348 | 233 |
| 340 | 3300054114 | Ga0501084_0284490 | Ga0501084_0284490_371_1117 | 233 |
| 341 | 3300054114 | Ga0501084_0294738 | Ga0501084_0294738_524_1273 | 233 |
| 342 | 3300060353 | Ga0501082_0036340 | Ga0501082_0036340_3346_4092 | 233 |
| 343 | 3300060353 | Ga0501082_0135649 | Ga0501082_0135649_270_1016 | 233 |
| 344 | 3300060353 | Ga0501082_0585324 | Ga0501082_0585324_133_879 | 233 |
| 345 | 3300061734 | Ga0530510_0073686 | Ga0530510_0073686_195_944 | 233 |
| 346 | 3300061734 | Ga0530510_0289155 | Ga0530510_0289155_290_1036 | 233 |
| 347 | 3300061734 | Ga0530510_0326061 | Ga0530510_0326061_294_1043 | 233 |
| 348 | 3300001990 | JGI24737J22298_10040850 | JGI24737J22298_100408502 | 234 |
| 349 | 3300003203 | JGI25406J46586_10002467 | JGI25406J46586_100024677 | 234 |
| 350 | 3300005328 | Ga0070676_10068908 | Ga0070676_100689084 | 234 |
| 351 | 3300005329 | Ga0070683_100082217 | Ga0070683_1000822174 | 234 |
| 352 | 3300005331 | Ga0070670_100079952 | Ga0070670_1000799522 | 234 |
| 353 | 3300005334 | Ga0068869_100177377 | Ga0068869_1001773771 | 234 |
| 354 | 3300005334 | Ga0068869_100331155 | Ga0068869_1003311551 | 234 |
| 355 | 3300005337 | Ga0070682_100008003 | Ga0070682_1000080033 | 234 |
| 356 | 3300005338 | Ga0068868_100036527 | Ga0068868_1000365273 | 234 |
| 357 | 3300005339 | Ga0070660_100170098 | Ga0070660_1001700982 | 234 |
| 358 | 3300005340 | Ga0070689_100242936 | Ga0070689_1002429362 | 234 |
| 359 | 3300005343 | Ga0070687_100058870 | Ga0070687_1000588702 | 234 |
| 360 | 3300005343 | Ga0070687_100061403 | Ga0070687_1000614032 | 234 |
| 361 | 3300005344 | Ga0070661_100171412 | Ga0070661_1001714123 | 234 |
| 362 | 3300005345 | Ga0070692_10029858 | Ga0070692_100298581 | 234 |
| 363 | 3300005347 | Ga0070668_100050855 | Ga0070668_1000508554 | 234 |
| 364 | 3300005354 | Ga0070675_100122758 | Ga0070675_1001227583 | 234 |
| 365 | 3300005364 | Ga0070673_100210860 | Ga0070673_1002108603 | 234 |
| 366 | 3300005366 | Ga0070659_100403879 | Ga0070659_1004038792 | 234 |
| 367 | 3300005440 | Ga0070705_100205798 | Ga0070705_1002057982 | 234 |
| 368 | 3300005441 | Ga0070700_100247280 | Ga0070700_1002472801 | 234 |
| 369 | 3300005455 | Ga0070663_100125413 | Ga0070663_1001254134 | 234 |
| 370 | 3300005456 | Ga0070678_100091674 | Ga0070678_1000916742 | 234 |
| 371 | 3300005457 | Ga0070662_100313544 | Ga0070662_1003135442 | 234 |
| 372 | 3300005459 | Ga0068867_100290692 | Ga0068867_1002906922 | 234 |
| 373 | 3300005466 | Ga0070685_10059210 | Ga0070685_100592102 | 234 |
| 374 | 3300005466 | Ga0070685_10099129 | Ga0070685_100991292 | 234 |
| 375 | 3300005535 | Ga0070684_100001766 | Ga0070684_10000176618 | 234 |
| 376 | 3300005535 | Ga0070684_100446156 | Ga0070684_1004461562 | 234 |
| 377 | 3300005539 | Ga0068853_100167558 | Ga0068853_1001675583 | 234 |
| 378 | 3300005543 | Ga0070672_100127968 | Ga0070672_1001279682 | 234 |
| 379 | 3300005544 | Ga0070686_100122771 | Ga0070686_1001227712 | 234 |
| 380 | 3300005544 | Ga0070686_100626948 | Ga0070686_1006269481 | 234 |
| 381 | 3300005545 | Ga0070695_100101975 | Ga0070695_1001019752 | 234 |
| 382 | 3300005547 | Ga0070693_100075446 | Ga0070693_1000754464 | 234 |
| 383 | 3300005547 | Ga0070693_100118322 | Ga0070693_1001183222 | 234 |
| 384 | 3300005548 | Ga0070665_100073421 | Ga0070665_1000734213 | 234 |
| 385 | 3300005578 | Ga0068854_100013176 | Ga0068854_1000131767 | 234 |
| 386 | 3300005578 | Ga0068854_100070737 | Ga0068854_1000707373 | 234 |
| 387 | 3300005578 | Ga0068854_100576211 | Ga0068854_1005762112 | 234 |
| 388 | 3300005614 | Ga0068856_100033740 | Ga0068856_1000337406 | 234 |
| 389 | 3300005614 | Ga0068856_100148578 | Ga0068856_1001485782 | 234 |
| 390 | 3300005614 | Ga0068856_100425693 | Ga0068856_1004256932 | 234 |
| 391 | 3300005614 | Ga0068856_100500882 | Ga0068856_1005008822 | 234 |
| 392 | 3300005614 | Ga0068856_100530242 | Ga0068856_1005302422 | 234 |
| 393 | 3300005615 | Ga0070702_100054854 | Ga0070702_1000548543 | 234 |
| 394 | 3300005615 | Ga0070702_100082249 | Ga0070702_1000822491 | 234 |
| 395 | 3300005615 | Ga0070702_100116300 | Ga0070702_1001163001 | 234 |
| 396 | 3300005615 | Ga0070702_100257569 | Ga0070702_1002575692 | 234 |
| 397 | 3300005616 | Ga0068852_100014730 | Ga0068852_1000147302 | 234 |
| 398 | 3300005616 | Ga0068852_100048782 | Ga0068852_1000487824 | 234 |
| 399 | 3300005616 | Ga0068852_100081895 | Ga0068852_1000818954 | 234 |
| 400 | 3300005617 | Ga0068859_100232803 | Ga0068859_1002328032 | 234 |
| 401 | 3300005618 | Ga0068864_100003127 | Ga0068864_10000312713 | 234 |
| 402 | 3300005718 | Ga0068866_10184430 | Ga0068866_101844301 | 234 |
| 403 | 3300005719 | Ga0068861_100087588 | Ga0068861_1000875882 | 234 |
| 404 | 3300005842 | Ga0068858_100275114 | Ga0068858_1002751142 | 234 |
| 405 | 3300005843 | Ga0068860_100536814 | Ga0068860_1005368142 | 234 |
| 406 | 3300005844 | Ga0068862_100376222 | Ga0068862_1003762222 | 234 |
| 407 | 3300005937 | Ga0081455_10013238 | Ga0081455_100132387 | 234 |
| 408 | 3300005983 | Ga0081540_1001988 | Ga0081540_100198817 | 234 |
| 409 | 3300005985 | Ga0081539_10009179 | Ga0081539_100091799 | 234 |
| 410 | 3300006175 | Ga0070712_100265084 | Ga0070712_1002650842 | 234 |
| 411 | 3300006847 | Ga0075431_100183868 | Ga0075431_1001838682 | 234 |
| 412 | 3300006847 | Ga0075431_100489412 | Ga0075431_1004894122 | 234 |
| 413 | 3300006852 | Ga0075433_10072042 | Ga0075433_100720421 | 234 |
| 414 | 3300006871 | Ga0075434_100006331 | Ga0075434_10000633114 | 234 |
| 415 | 3300006881 | Ga0068865_100167231 | Ga0068865_1001672312 | 234 |
| 416 | 3300006914 | Ga0075436_100340522 | Ga0075436_1003405222 | 234 |
| 417 | 3300006931 | Ga0097620_100232801 | Ga0097620_1002328013 | 234 |
| 418 | 3300007076 | Ga0075435_100138721 | Ga0075435_1001387212 | 234 |
| 419 | 3300009094 | Ga0111539_10146412 | Ga0111539_101464123 | 234 |
| 420 | 3300009098 | Ga0105245_10014517 | Ga0105245_100145176 | 234 |
| 421 | 3300009098 | Ga0105245_10594386 | Ga0105245_105943862 | 234 |
| 422 | 3300009101 | Ga0105247_10544055 | Ga0105247_105440551 | 234 |
| 423 | 3300009147 | Ga0114129_10202071 | Ga0114129_102020712 | 234 |
| 424 | 3300009148 | Ga0105243_10013190 | Ga0105243_100131908 | 234 |
| 425 | 3300009148 | Ga0105243_10089870 | Ga0105243_100898702 | 234 |
| 426 | 3300009177 | Ga0105248_10104467 | Ga0105248_101044672 | 234 |
| 427 | 3300009177 | Ga0105248_10190482 | Ga0105248_101904822 | 234 |
| 428 | 3300009545 | Ga0105237_10179970 | Ga0105237_101799703 | 234 |
| 429 | 3300009551 | Ga0105238_10186722 | Ga0105238_101867224 | 234 |
| 430 | 3300009553 | Ga0105249_10080368 | Ga0105249_100803683 | 234 |
| 431 | 3300009553 | Ga0105249_10127565 | Ga0105249_101275654 | 234 |
| 432 | 3300010375 | Ga0105239_10116718 | Ga0105239_101167184 | 234 |
| 433 | 3300013102 | Ga0157371_10133217 | Ga0157371_101332172 | 234 |
| 434 | 3300013296 | Ga0157374_10038085 | Ga0157374_100380855 | 234 |
| 435 | 3300013297 | Ga0157378_10307922 | Ga0157378_103079223 | 234 |
| 436 | 3300013297 | Ga0157378_10314616 | Ga0157378_103146162 | 234 |
| 437 | 3300013306 | Ga0163162_10154357 | Ga0163162_101543574 | 234 |
| 438 | 3300013307 | Ga0157372_10124400 | Ga0157372_101244005 | 234 |
| 439 | 3300013307 | Ga0157372_10319705 | Ga0157372_103197052 | 234 |
| 440 | 3300013307 | Ga0157372_10694025 | Ga0157372_106940252 | 234 |
| 441 | 3300013308 | Ga0157375_10408259 | Ga0157375_104082591 | 234 |
| 442 | 3300014326 | Ga0157380_11066468 | Ga0157380_110664681 | 234 |
| 443 | 3300014497 | Ga0182008_10154604 | Ga0182008_101546041 | 234 |
| 444 | 3300014745 | Ga0157377_10002230 | Ga0157377_100022304 | 234 |
| 445 | 3300014745 | Ga0157377_10060860 | Ga0157377_100608604 | 234 |
| 446 | 3300014968 | Ga0157379_10003747 | Ga0157379_1000374712 | 234 |
| 447 | 3300014968 | Ga0157379_10290227 | Ga0157379_102902272 | 234 |
| 448 | 3300014969 | Ga0157376_10202751 | Ga0157376_102027512 | 234 |
| 449 | 3300014969 | Ga0157376_10396081 | Ga0157376_103960812 | 234 |
| 450 | 3300020082 | Ga0206353_11379463 | Ga0206353_113794632 | 234 |
| 451 | 3300025901 | Ga0207688_10000574 | Ga0207688_100005745 | 234 |
| 452 | 3300025901 | Ga0207688_10006513 | Ga0207688_100065134 | 234 |
| 453 | 3300025901 | Ga0207688_10198410 | Ga0207688_101984102 | 234 |
| 454 | 3300025904 | Ga0207647_10090683 | Ga0207647_100906832 | 234 |
| 455 | 3300025907 | Ga0207645_10143467 | Ga0207645_101434673 | 234 |
| 456 | 3300025908 | Ga0207643_10023715 | Ga0207643_100237155 | 234 |
| 457 | 3300025916 | Ga0207663_10146879 | Ga0207663_101468793 | 234 |
| 458 | 3300025918 | Ga0207662_10005381 | Ga0207662_100053813 | 234 |
| 459 | 3300025918 | Ga0207662_10022129 | Ga0207662_100221292 | 234 |
| 460 | 3300025919 | Ga0207657_10041961 | Ga0207657_100419614 | 234 |
| 461 | 3300025919 | Ga0207657_10062918 | Ga0207657_100629182 | 234 |
| 462 | 3300025920 | Ga0207649_10129522 | Ga0207649_101295222 | 234 |
| 463 | 3300025920 | Ga0207649_10284819 | Ga0207649_102848192 | 234 |
| 464 | 3300025921 | Ga0207652_10431003 | Ga0207652_104310032 | 234 |
| 465 | 3300025925 | Ga0207650_10211989 | Ga0207650_102119891 | 234 |
| 466 | 3300025926 | Ga0207659_10570788 | Ga0207659_105707882 | 234 |
| 467 | 3300025927 | Ga0207687_10122235 | Ga0207687_101222353 | 234 |
| 468 | 3300025932 | Ga0207690_10257404 | Ga0207690_102574042 | 234 |
| 469 | 3300025932 | Ga0207690_10381561 | Ga0207690_103815611 | 234 |
| 470 | 3300025933 | Ga0207706_10023352 | Ga0207706_100233525 | 234 |
| 471 | 3300025934 | Ga0207686_10209019 | Ga0207686_102090192 | 234 |
| 472 | 3300025935 | Ga0207709_10170908 | Ga0207709_101709082 | 234 |
| 473 | 3300025935 | Ga0207709_10265047 | Ga0207709_102650472 | 234 |
| 474 | 3300025936 | Ga0207670_10088808 | Ga0207670_100888082 | 234 |
| 475 | 3300025937 | Ga0207669_10081929 | Ga0207669_100819293 | 234 |
| 476 | 3300025938 | Ga0207704_10058065 | Ga0207704_100580652 | 234 |
| 477 | 3300025940 | Ga0207691_10092600 | Ga0207691_100926004 | 234 |
| 478 | 3300025941 | Ga0207711_10309987 | Ga0207711_103099872 | 234 |
| 479 | 3300025941 | Ga0207711_10611087 | Ga0207711_106110872 | 234 |
| 480 | 3300025942 | Ga0207689_10046842 | Ga0207689_100468424 | 234 |
| 481 | 3300025942 | Ga0207689_10126833 | Ga0207689_101268332 | 234 |
| 482 | 3300025944 | Ga0207661_10003675 | Ga0207661_100036757 | 234 |
| 483 | 3300025945 | Ga0207679_10032825 | Ga0207679_100328253 | 234 |
| 484 | 3300025960 | Ga0207651_10017591 | Ga0207651_100175912 | 234 |
| 485 | 3300025960 | Ga0207651_10150995 | Ga0207651_101509953 | 234 |
| 486 | 3300025961 | Ga0207712_10215824 | Ga0207712_102158242 | 234 |
| 487 | 3300025961 | Ga0207712_10329593 | Ga0207712_103295932 | 234 |
| 488 | 3300025972 | Ga0207668_10160366 | Ga0207668_101603662 | 234 |
| 489 | 3300025981 | Ga0207640_10041111 | Ga0207640_100411113 | 234 |
| 490 | 3300025981 | Ga0207640_10111271 | Ga0207640_101112713 | 234 |
| 491 | 3300025981 | Ga0207640_10327983 | Ga0207640_103279832 | 234 |
| 492 | 3300026035 | Ga0207703_10061203 | Ga0207703_100612034 | 234 |
| 493 | 3300026035 | Ga0207703_10351681 | Ga0207703_103516812 | 234 |
| 494 | 3300026041 | Ga0207639_10246006 | Ga0207639_102460062 | 234 |
| 495 | 3300026041 | Ga0207639_10300818 | Ga0207639_103008182 | 234 |
| 496 | 3300026041 | Ga0207639_10645585 | Ga0207639_106455852 | 234 |
| 497 | 3300026067 | Ga0207678_10016804 | Ga0207678_100168046 | 234 |
| 498 | 3300026075 | Ga0207708_10001896 | Ga0207708_100018968 | 234 |
| 499 | 3300026075 | Ga0207708_10094677 | Ga0207708_100946772 | 234 |
| 500 | 3300026078 | Ga0207702_10104288 | Ga0207702_101042883 | 234 |
| 501 | 3300026078 | Ga0207702_10104983 | Ga0207702_101049834 | 234 |
| 502 | 3300026078 | Ga0207702_10535797 | Ga0207702_105357971 | 234 |
| 503 | 3300026089 | Ga0207648_10353966 | Ga0207648_103539662 | 234 |
| 504 | 3300026116 | Ga0207674_10126849 | Ga0207674_101268492 | 234 |
| 505 | 3300026116 | Ga0207674_10150677 | Ga0207674_101506772 | 234 |
| 506 | 3300026118 | Ga0207675_100156993 | Ga0207675_1001569932 | 234 |
| 507 | 3300026118 | Ga0207675_100206488 | Ga0207675_1002064882 | 234 |
| 508 | 3300026121 | Ga0207683_10098731 | Ga0207683_100987311 | 234 |
| 509 | 3300026121 | Ga0207683_10512770 | Ga0207683_105127702 | 234 |
| 510 | 3300026142 | Ga0207698_10095613 | Ga0207698_100956132 | 234 |
| 511 | 3300026142 | Ga0207698_10270513 | Ga0207698_102705133 | 234 |
| 512 | 3300027907 | Ga0207428_10063126 | Ga0207428_100631264 | 234 |
| 513 | 3300028379 | Ga0268266_10055305 | Ga0268266_100553053 | 234 |
| 514 | 3300028381 | Ga0268264_10216867 | Ga0268264_102168672 | 234 |
| 515 | 3300031731 | Ga0307405_10029550 | Ga0307405_100295502 | 234 |
| 516 | 3300031852 | Ga0307410_10085789 | Ga0307410_100857892 | 234 |
| 517 | 3300031901 | Ga0307406_10170666 | Ga0307406_101706663 | 234 |
| 518 | 3300031901 | Ga0307406_10502959 | Ga0307406_105029592 | 234 |
| 519 | 3300031995 | Ga0307409_100027002 | Ga0307409_1000270022 | 234 |
| 520 | 3300032002 | Ga0307416_100033057 | Ga0307416_1000330572 | 234 |
| 521 | 3300032002 | Ga0307416_100074384 | Ga0307416_1000743842 | 234 |
| 522 | 3300032002 | Ga0307416_100426642 | Ga0307416_1004266421 | 234 |
| 523 | 3300032126 | Ga0307415_100003888 | Ga0307415_1000038886 | 234 |
| 524 | 3300032126 | Ga0307415_100049321 | Ga0307415_1000493214 | 234 |
| 525 | 3300037418 | Ga0395900_0704381 | Ga0395900_0704381_13_768 | 234 |
| 526 | 3300037466 | Ga0395898_0142728 | Ga0395898_0142728_741_1508 | 234 |
| 527 | 3300038443 | Ga0395901_0330540 | Ga0395901_0330540_730_1479 | 234 |
| 528 | 3300038443 | Ga0395901_0637015 | Ga0395901_0637015_98_847 | 234 |
| 529 | 3300044694 | Ga0466963_0097756 | Ga0466963_0097756_858_1607 | 234 |
| 530 | 3300044842 | Ga0466957_0192054 | Ga0466957_0192054_19_768 | 234 |
| 531 | 3300044901 | Ga0466960_0017827 | Ga0466960_0017827_1156_1920 | 234 |
| 532 | 3300044901 | Ga0466960_0077010 | Ga0466960_0077010_485_1240 | 234 |
| 533 | 3300044901 | Ga0466960_0095845 | Ga0466960_0095845_383_1147 | 234 |
| 534 | 3300045976 | Ga0466967_0102218 | Ga0466967_0102218_1417_2181 | 234 |
| 535 | 3300045976 | Ga0466967_0987577 | Ga0466967_0987577_20_769 | 234 |
| 536 | 3300046455 | Ga0495603_0302887 | Ga0495603_0302887_18_776 | 234 |
| 537 | 3300046461 | Ga0495641_0096036 | Ga0495641_0096036_210_968 | 234 |
| 538 | 3300046471 | Ga0495650_0000055 | Ga0495650_0000055_2195_2959 | 234 |
| 539 | 3300046474 | Ga0495605_0102413 | Ga0495605_0102413_154_912 | 234 |
| 540 | 3300046538 | Ga0495609_0155537 | Ga0495609_0155537_76_834 | 234 |
| 541 | 3300046615 | Ga0495656_0017373 | Ga0495656_0017373_1702_2460 | 234 |
| 542 | 3300046794 | Ga0495589_0074591 | Ga0495589_0074591_157_915 | 234 |
| 543 | 3300047445 | Ga0495677_0126485 | Ga0495677_0126485_179_937 | 234 |
| 544 | 3300048903 | Ga0496100_0045634 | Ga0496100_0045634_1636_2391 | 234 |
| 545 | 3300048903 | Ga0496100_0096104 | Ga0496100_0096104_1150_1908 | 234 |
| 546 | 3300048904 | Ga0496101_0032417 | Ga0496101_0032417_2899_3654 | 234 |
| 547 | 3300048904 | Ga0496101_0065877 | Ga0496101_0065877_795_1544 | 234 |
| 548 | 3300048905 | Ga0496102_0031443 | Ga0496102_0031443_238_996 | 234 |
| 549 | 3300048905 | Ga0496102_0198279 | Ga0496102_0198279_47_799 | 234 |
| 550 | 3300048907 | Ga0496104_0001966 | Ga0496104_0001966_1365_2123 | 234 |
| 551 | 3300048907 | Ga0496104_0004059 | Ga0496104_0004059_10773_11522 | 234 |
| 552 | 3300048907 | Ga0496104_0105909 | Ga0496104_0105909_58_810 | 234 |
| 553 | 3300048909 | Ga0496106_0010331 | Ga0496106_0010331_2618_3373 | 234 |
| 554 | 3300048909 | Ga0496106_0013317 | Ga0496106_0013317_5191_5940 | 234 |
| 555 | 3300048909 | Ga0496106_0151383 | Ga0496106_0151383_77_835 | 234 |
| 556 | 3300048909 | Ga0496106_0646897 | Ga0496106_0646897_71_823 | 234 |
| 557 | 3300048910 | Ga0496107_0002481 | Ga0496107_0002481_3021_3776 | 234 |
| 558 | 3300048911 | Ga0496108_0000326 | Ga0496108_0000326_37021_37779 | 234 |
| 559 | 3300048911 | Ga0496108_0030203 | Ga0496108_0030203_106_864 | 234 |
| 560 | 3300048911 | Ga0496108_0037667 | Ga0496108_0037667_770_1528 | 234 |
| 561 | 3300048911 | Ga0496108_0066593 | Ga0496108_0066593_2159_2908 | 234 |
| 562 | 3300048911 | Ga0496108_0199579 | Ga0496108_0199579_480_1238 | 234 |
| 563 | 3300048911 | Ga0496108_0238099 | Ga0496108_0238099_774_1523 | 234 |
| 564 | 3300048912 | Ga0496109_0006974 | Ga0496109_0006974_921_1679 | 234 |
| 565 | 3300048912 | Ga0496109_0228664 | Ga0496109_0228664_654_1412 | 234 |
| 566 | 3300048912 | Ga0496109_0268445 | Ga0496109_0268445_661_1410 | 234 |
| 567 | 3300048913 | Ga0496110_0003062 | Ga0496110_0003062_4619_5377 | 234 |
| 568 | 3300048913 | Ga0496110_0065321 | Ga0496110_0065321_1130_1882 | 234 |
| 569 | 3300048914 | Ga0496111_0012838 | Ga0496111_0012838_3699_4457 | 234 |
| 570 | 3300048915 | Ga0496112_0041263 | Ga0496112_0041263_3456_4214 | 234 |
| 571 | 3300048915 | Ga0496112_0187651 | Ga0496112_0187651_146_895 | 234 |
| 572 | 3300048916 | Ga0496113_0000503 | Ga0496113_0000503_10572_11330 | 234 |
| 573 | 3300048916 | Ga0496113_0063088 | Ga0496113_0063088_2036_2788 | 234 |
| 574 | 3300048916 | Ga0496113_0141334 | Ga0496113_0141334_90_848 | 234 |
| 575 | 3300048917 | Ga0496114_0056194 | Ga0496114_0056194_101_859 | 234 |
| 576 | 3300048917 | Ga0496114_0251886 | Ga0496114_0251886_450_1202 | 234 |
| 577 | 3300048918 | Ga0496115_0027586 | Ga0496115_0027586_1969_2724 | 234 |
| 578 | 3300048924 | Ga0496121_0040466 | Ga0496121_0040466_3114_3881 | 234 |
| 579 | 3300050510 | nmdc:mga06r32_530314_c1 | nmdc:mga06r32_530314_c1_157_906 | 234 |
| 580 | 3300050510 | nmdc:mga06r32_78865_c1 | nmdc:mga06r32_78865_c1_1871_2620 | 234 |
| 581 | 3300050511 | nmdc:mga08y16_55395_c1 | nmdc:mga08y16_55395_c1_565_1323 | 234 |
| 582 | 3300050511 | nmdc:mga08y16_97723_c1 | nmdc:mga08y16_97723_c1_1382_2131 | 234 |
| 583 | 3300050512 | nmdc:mga0n895_174491_c1 | nmdc:mga0n895_174491_c1_1083_1832 | 234 |
| 584 | 3300050512 | nmdc:mga0n895_320794_c1 | nmdc:mga0n895_320794_c1_84_833 | 234 |
| 585 | 3300050514 | nmdc:mga08x19_42335_c1 | nmdc:mga08x19_42335_c1_1132_1881 | 234 |
| 586 | 3300050515 | nmdc:mga0a205_109360_c1 | nmdc:mga0a205_109360_c1_419_1177 | 234 |
| 587 | 3300050515 | nmdc:mga0a205_167524_c1 | nmdc:mga0a205_167524_c1_1277_2026 | 234 |
| 588 | 3300053104 | Ga0500556_0000817 | Ga0500556_0000817_15854_16615 | 234 |
| 589 | 3300053153 | Ga0500616_0002891 | Ga0500616_0002891_11420_12181 | 234 |
| 590 | 3300053153 | Ga0500616_0021454 | Ga0500616_0021454_1307_2068 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar