F466909

General Info

Members Datasets Scaffolds Average Seq Length
589 206 1178 128

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0183867|Ga0501043_0183867_432_782
Length 116
Sequence MAGELILIVEDNERNRKLVRDVLQVKGYQTIESETAEEGIQLPGMDGIAALGHLRADPTTRAIPVMAVTASAMTHNRQQILAAGFDAYQSKPINVKGFLEAVRALLDRRSGSGDEP

Samples

Sample ID Description Type Environment
1 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
86 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
87 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
88 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.23
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 12.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501043_0183867 3300049579 Bacteria 1628
2 JGI24743J22301_10037471 3300001991 Bacteria 967
3 JGI24033J26618_1051464 3300002155 Unclassified 592
4 Ga0065714_10266228 3300005288 Unclassified 747
5 Ga0065712_10028332 3300005290 Unclassified 1380
6 Ga0065712_10067755 3300005290 Bacteria 55560
7 Ga0065712_10069144 3300005290 Bacteria 7910
8 Ga0065712_10160499 3300005290 Bacteria 1306
9 Ga0065715_10014335 3300005293 Unclassified 2443
10 Ga0065715_10089069 3300005293 Bacteria 15008
11 Ga0065715_10092886 3300005293 Bacteria 4890
12 Ga0065707_10047137 3300005295 Bacteria 793
13 Ga0065707_10047484 3300005295 Bacteria 841
14 Ga0065707_10234837 3300005295 Bacteria 1173
15 Ga0065707_10251880 3300005295 Bacteria 1122
16 Ga0065707_10293366 3300005295 Bacteria 975
17 Ga0065707_10432651 3300005295 Unclassified 818
18 Ga0070683_100022873 3300005329 Bacteria 5590
19 Ga0070690_100277120 3300005330 Bacteria 1195
20 Ga0070670_100043025 3300005331 Bacteria 3883
21 Ga0070670_100182969 3300005331 Bacteria 1820
22 Ga0070670_101695122 3300005331 Unclassified 581
23 Ga0070677_10010993 3300005333 Bacteria 3110
24 Ga0068869_100214258 3300005334 Bacteria 1524
25 Ga0068869_100669278 3300005334 Bacteria 883
26 Ga0070666_10130962 3300005335 Bacteria 1743
27 Ga0070666_10131937 3300005335 Bacteria 1736
28 Ga0070666_10143890 3300005335 Bacteria 1661
29 Ga0070666_11328255 3300005335 Unclassified 537
30 Ga0070680_100972943 3300005336 Bacteria 733
31 Ga0070682_100298417 3300005337 Bacteria 1181
32 Ga0068868_100033583 3300005338 Bacteria 3955
33 Ga0070660_100015334 3300005339 Bacteria 5531
34 Ga0070660_100118147 3300005339 Bacteria 2115
35 Ga0070660_100438876 3300005339 Unclassified 1082
36 Ga0070661_100025715 3300005344 Bacteria 4231
37 Ga0070692_10314774 3300005345 Bacteria 960
38 Ga0070692_10865840 3300005345 Bacteria 622
39 Ga0070669_100256997 3300005353 Bacteria 1392
40 Ga0070675_100060969 3300005354 Bacteria 3114
41 Ga0070675_101300098 3300005354 Bacteria 670
42 Ga0070671_100063918 3300005355 Bacteria 3065
43 Ga0070671_100188412 3300005355 Bacteria 1748
44 Ga0070671_100979735 3300005355 Unclassified 740
45 Ga0070674_100334375 3300005356 Bacteria 1218
46 Ga0070674_100418554 3300005356 Bacteria 1099
47 Ga0070673_100071300 3300005364 Bacteria 2791
48 Ga0070673_100141535 3300005364 Bacteria 2029
49 Ga0070673_100329562 3300005364 Bacteria 1350
50 Ga0070659_100290360 3300005366 Bacteria 1362
51 Ga0070659_100999111 3300005366 Bacteria 734
52 Ga0070667_100223391 3300005367 Bacteria 1677
53 Ga0070705_100027281 3300005440 Bacteria 3117
54 Ga0070705_100299425 3300005440 Bacteria 1152
55 Ga0070705_100951359 3300005440 Unclassified 694
56 Ga0070694_100249175 3300005444 Bacteria 1343
57 Ga0070694_100432813 3300005444 Bacteria 1035
58 Ga0070708_100002144 3300005445 Bacteria 15229
59 Ga0070708_100006411 3300005445 Bacteria 9366
60 Ga0070708_100076223 3300005445 Bacteria 3028
61 Ga0070708_100486246 3300005445 Bacteria 1164
62 Ga0070678_100301112 3300005456 Bacteria 1362
63 Ga0070662_100057610 3300005457 Bacteria 2824
64 Ga0070662_100717375 3300005457 Bacteria 847
65 Ga0070662_100789678 3300005457 Bacteria 807
66 Ga0070681_10010147 3300005458 Bacteria 9288
67 Ga0070681_10940843 3300005458 Unclassified 783
68 Ga0068867_100218456 3300005459 Bacteria 1535
69 Ga0070706_100252409 3300005467 Bacteria 1647
70 Ga0070706_100362100 3300005467 Bacteria 1351
71 Ga0070706_100555893 3300005467 Bacteria 1067
72 Ga0070706_100880607 3300005467 Bacteria 827
73 Ga0070706_102167026 3300005467 Bacteria 502
74 Ga0070707_100314333 3300005468 Bacteria 1522
75 Ga0070707_100331932 3300005468 Bacteria 1477
76 Ga0070707_100581270 3300005468 Bacteria 1082
77 Ga0070707_100814830 3300005468 Bacteria 897
78 Ga0070698_100105754 3300005471 Bacteria 2784
79 Ga0070698_100144681 3300005471 Bacteria 2327
80 Ga0070698_100241053 3300005471 Bacteria 1741
81 Ga0070699_100010101 3300005518 Bacteria 8174
82 Ga0070699_100024437 3300005518 Bacteria 5207
83 Ga0070699_100187395 3300005518 Bacteria 1837
84 Ga0070699_100220122 3300005518 Bacteria 1692
85 Ga0070699_100696136 3300005518 Bacteria 928
86 Ga0070699_101129527 3300005518 Bacteria 719
87 Ga0070699_101266195 3300005518 Unclassified 676
88 Ga0070699_102109434 3300005518 Bacteria 515
89 Ga0070679_100061715 3300005530 Bacteria 3736
90 Ga0070684_100313491 3300005535 Bacteria 1441
91 Ga0070697_100011695 3300005536 Bacteria 6863
92 Ga0070697_100099546 3300005536 Bacteria 2413
93 Ga0070697_100196271 3300005536 Bacteria 1714
94 Ga0070697_101174884 3300005536 Bacteria 684
95 Ga0070672_100011864 3300005543 Bacteria 6089
96 Ga0070695_100924053 3300005545 Bacteria 706
97 Ga0070696_100079749 3300005546 Bacteria 2317
98 Ga0070693_100565479 3300005547 Bacteria 816
99 Ga0070693_100779300 3300005547 Unclassified 707
100 Ga0070665_100419006 3300005548 Bacteria 1348
101 Ga0070665_101627873 3300005548 Bacteria 653
102 Ga0070704_100003067 3300005549 Bacteria 9509
103 Ga0070704_100104922 3300005549 Bacteria 2139
104 Ga0070664_100004304 3300005564 Bacteria 11447
105 Ga0070664_100018154 3300005564 Bacteria 5774
106 Ga0070664_101175717 3300005564 Bacteria 723
107 Ga0068857_100457358 3300005577 Bacteria 1194
108 Ga0068857_101060150 3300005577 Unclassified 782
109 Ga0068857_101446389 3300005577 Bacteria 669
110 Ga0068854_100050038 3300005578 Bacteria 2988
111 Ga0070702_100112129 3300005615 Bacteria 1693
112 Ga0068852_100149051 3300005616 Bacteria 2173
113 Ga0068859_102341930 3300005617 Bacteria 589
114 Ga0068864_100212199 3300005618 Unclassified 1783
115 Ga0068864_100237798 3300005618 Bacteria 1687
116 Ga0068866_10235516 3300005718 Unclassified 1112
117 Ga0068866_10279148 3300005718 Bacteria 1034
118 Ga0068861_100983434 3300005719 Unclassified 804
119 Ga0068861_101141860 3300005719 Bacteria 751
120 Ga0068851_10095495 3300005834 Bacteria 1571
121 Ga0068870_10301002 3300005840 Bacteria 1012
122 Ga0068863_100102915 3300005841 Bacteria 2716
123 Ga0068863_100152384 3300005841 Bacteria 2212
124 Ga0068858_100123384 3300005842 Bacteria 2424
125 Ga0068858_100423249 3300005842 Bacteria 1281
126 Ga0068860_100560203 3300005843 Bacteria 1146
127 Ga0081455_10005813 3300005937 Bacteria 13432
128 Ga0081455_10033313 3300005937 Bacteria 4632
129 Ga0081455_10369535 3300005937 Bacteria 1006
130 Ga0081455_10445513 3300005937 Bacteria 886
131 Ga0081455_10831894 3300005937 Bacteria 578
132 Ga0081538_10003350 3300005981 Bacteria 15173
133 Ga0081540_1094291 3300005983 Bacteria 1308
134 Ga0081540_1221716 3300005983 Unclassified 672
135 Ga0097621_100081012 3300006237 Bacteria 2701
136 Ga0097621_100905851 3300006237 Unclassified 822
137 Ga0068871_100118004 3300006358 Bacteria 2238
138 Ga0075428_100991276 3300006844 Bacteria 890
139 Ga0075428_102141584 3300006844 Unclassified 578
140 Ga0075430_100968337 3300006846 Unclassified 701
141 Ga0075431_100010703 3300006847 Bacteria 9219
142 Ga0075431_100048280 3300006847 Bacteria 4391
143 Ga0075431_100108369 3300006847 Bacteria 2867
144 Ga0075431_100124178 3300006847 Bacteria 2663
145 Ga0075431_100247831 3300006847 Bacteria 1810
146 Ga0075431_100256912 3300006847 Bacteria 1774
147 Ga0075431_100566990 3300006847 Bacteria 1122
148 Ga0075433_10058770 3300006852 Bacteria 3364
149 Ga0075433_10127400 3300006852 Unclassified 2261
150 Ga0075433_10356863 3300006852 Bacteria 1291
151 Ga0075433_10425156 3300006852 Bacteria 1171
152 Ga0075433_10483618 3300006852 Unclassified 1090
153 Ga0075433_10561891 3300006852 Bacteria 1002
154 Ga0075433_10790944 3300006852 Bacteria 829
155 Ga0075434_100018569 3300006871 Bacteria 6719
156 Ga0075434_100044050 3300006871 Bacteria 4427
157 Ga0075434_100056563 3300006871 Bacteria 3898
158 Ga0075434_100152137 3300006871 Bacteria 2334
159 Ga0075434_100468063 3300006871 Unclassified 1282
160 Ga0075434_101191359 3300006871 Unclassified 774
161 Ga0075434_101463826 3300006871 Unclassified 692
162 Ga0075429_100002115 3300006880 Bacteria 16571
163 Ga0075429_100040826 3300006880 Bacteria 4040
164 Ga0075429_100060779 3300006880 Bacteria 3290
165 Ga0075429_100134257 3300006880 Bacteria 2165
166 Ga0075429_100481109 3300006880 Bacteria 1088
167 Ga0075429_101116180 3300006880 Bacteria 689
168 Ga0068865_100453434 3300006881 Bacteria 1061
169 Ga0075436_100011490 3300006914 Bacteria 6076
170 Ga0075436_100098284 3300006914 Bacteria 2037
171 Ga0075436_100418629 3300006914 Bacteria 972
172 Ga0075436_100873945 3300006914 Bacteria 672
173 Ga0075436_100894125 3300006914 Bacteria 664
174 Ga0075436_101359938 3300006914 Unclassified 538
175 Ga0097620_102342025 3300006931 Bacteria 589
176 Ga0075435_100017591 3300007076 Bacteria 5415
177 Ga0075435_100094595 3300007076 Bacteria 2470
178 Ga0075435_100103793 3300007076 Bacteria 2358
179 Ga0075435_100233896 3300007076 Bacteria 1561
180 Ga0075435_100604759 3300007076 Bacteria 951
181 Ga0111539_10295353 3300009094 Bacteria 1885
182 Ga0111539_10371327 3300009094 Bacteria 1665
183 Ga0111539_10544275 3300009094 Bacteria 1352
184 Ga0105245_10435301 3300009098 Bacteria 1317
185 Ga0114129_10001013 3300009147 Bacteria 36634
186 Ga0114129_10003126 3300009147 Bacteria 23222
187 Ga0114129_10019029 3300009147 Bacteria 9782
188 Ga0114129_10020002 3300009147 Bacteria 9528
189 Ga0114129_10079842 3300009147 Bacteria 4548
190 Ga0114129_10195232 3300009147 Bacteria 2745
191 Ga0114129_10492231 3300009147 Unclassified 1603
192 Ga0114129_10530666 3300009147 Unclassified 1533
193 Ga0114129_10803868 3300009147 Bacteria 1199
194 Ga0114129_10906097 3300009147 Unclassified 1117
195 Ga0114129_11215859 3300009147 Bacteria 938
196 Ga0114129_11902665 3300009147 Bacteria 721
197 Ga0114129_11948840 3300009147 Unclassified 711
198 Ga0105243_11544118 3300009148 Bacteria 689
199 Ga0105241_10013072 3300009174 Bacteria 6087
200 Ga0105248_10126582 3300009177 Bacteria 2882
201 Ga0105248_10366257 3300009177 Bacteria 1622
202 Ga0105249_10018074 3300009553 Bacteria 6267
203 Ga0105249_10113285 3300009553 Bacteria 2566
204 Ga0105239_11680277 3300010375 Unclassified 735
205 Ga0105246_10381185 3300011119 Bacteria 1165
206 Ga0157320_1015867 3300012481 Bacteria 642
207 Ga0157347_1013010 3300012502 Bacteria 904
208 Ga0157327_1006552 3300012512 Bacteria 984
209 Ga0157338_1076315 3300012515 Unclassified 534
210 Ga0157371_10316512 3300013102 Bacteria 1132
211 Ga0157370_10645345 3300013104 Bacteria 968
212 Ga0157369_11398221 3300013105 Bacteria 712
213 Ga0157374_10172963 3300013296 Bacteria 2107
214 Ga0157374_10394737 3300013296 Unclassified 1379
215 Ga0157374_11532214 3300013296 Unclassified 690
216 Ga0157374_12124385 3300013296 Unclassified 588
217 Ga0157378_10076923 3300013297 Bacteria 3008
218 Ga0157378_10419383 3300013297 Bacteria 1322
219 Ga0157378_10440295 3300013297 Bacteria 1292
220 Ga0157378_10544437 3300013297 Bacteria 1165
221 Ga0157378_12929582 3300013297 Unclassified 529
222 Ga0163162_10047844 3300013306 Bacteria 4284
223 Ga0163162_10796732 3300013306 Unclassified 1062
224 Ga0163162_12366249 3300013306 Bacteria 610
225 Ga0157375_10078304 3300013308 Bacteria 3338
226 Ga0157375_11028609 3300013308 Bacteria 962
227 Ga0157380_12699908 3300014326 Bacteria 563
228 Ga0157377_10308597 3300014745 Bacteria 1047
229 Ga0157379_12224748 3300014968 Bacteria 545
230 Ga0157376_10073256 3300014969 Bacteria 2916
231 Ga0157376_10122943 3300014969 Bacteria 2303
232 Ga0163161_10343925 3300017792 Bacteria 1184
233 Ga0207666_1029815 3300025271 Unclassified 833
234 Ga0207697_10020145 3300025315 Bacteria 2732
235 Ga0207656_10184505 3300025321 Bacteria 1002
236 Ga0207682_10066818 3300025893 Bacteria 1516
237 Ga0207642_10522294 3300025899 Bacteria 730
238 Ga0207680_10095932 3300025903 Bacteria 1896
239 Ga0207680_10212760 3300025903 Bacteria 1322
240 Ga0207680_10589789 3300025903 Unclassified 795
241 Ga0207647_10092646 3300025904 Unclassified 1801
242 Ga0207684_10003194 3300025910 Bacteria 16085
243 Ga0207684_10084996 3300025910 Bacteria 2695
244 Ga0207684_10185997 3300025910 Bacteria 1791
245 Ga0207684_10362559 3300025910 Unclassified 1247
246 Ga0207654_10131245 3300025911 Bacteria 1586
247 Ga0207707_10026320 3300025912 Bacteria 5084
248 Ga0207707_10740487 3300025912 Unclassified 823
249 Ga0207660_10066997 3300025917 Bacteria 2599
250 Ga0207660_10324482 3300025917 Bacteria 1230
251 Ga0207662_10476349 3300025918 Bacteria 857
252 Ga0207657_10444916 3300025919 Unclassified 1017
253 Ga0207657_10446526 3300025919 Bacteria 1015
254 Ga0207649_10013431 3300025920 Bacteria 4572
255 Ga0207649_10031715 3300025920 Bacteria 3144
256 Ga0207646_10001925 3300025922 Bacteria 24971
257 Ga0207646_10011509 3300025922 Bacteria 8559
258 Ga0207646_10323224 3300025922 Bacteria 1394
259 Ga0207646_10808281 3300025922 Bacteria 835
260 Ga0207646_10895862 3300025922 Bacteria 787
261 Ga0207646_11154893 3300025922 Bacteria 680
262 Ga0207681_10072703 3300025923 Bacteria 2403
263 Ga0207681_10587218 3300025923 Bacteria 919
264 Ga0207681_11457510 3300025923 Unclassified 574
265 Ga0207650_10002842 3300025925 Bacteria 11960
266 Ga0207650_10016915 3300025925 Bacteria 5100
267 Ga0207659_10022534 3300025926 Bacteria 4194
268 Ga0207659_11243326 3300025926 Bacteria 640
269 Ga0207644_10044743 3300025931 Bacteria 3146
270 Ga0207644_10309711 3300025931 Bacteria 1274
271 Ga0207644_10632492 3300025931 Bacteria 890
272 Ga0207690_10009008 3300025932 Bacteria 5924
273 Ga0207690_10272438 3300025932 Bacteria 1315
274 Ga0207690_10899895 3300025932 Bacteria 734
275 Ga0207706_10104695 3300025933 Bacteria 2489
276 Ga0207706_10469817 3300025933 Bacteria 1087
277 Ga0207706_10551825 3300025933 Bacteria 992
278 Ga0207669_10152212 3300025937 Bacteria 1622
279 Ga0207669_10381773 3300025937 Bacteria 1098
280 Ga0207665_10179157 3300025939 Unclassified 1534
281 Ga0207691_10041423 3300025940 Bacteria 4252
282 Ga0207711_10281071 3300025941 Bacteria 1533
283 Ga0207711_10442449 3300025941 Bacteria 1210
284 Ga0207689_10205129 3300025942 Bacteria 1628
285 Ga0207661_10099043 3300025944 Bacteria 2444
286 Ga0207679_10002444 3300025945 Bacteria 11437
287 Ga0207679_10071549 3300025945 Bacteria 2616
288 Ga0207679_10133170 3300025945 Bacteria 1997
289 Ga0207679_11118638 3300025945 Bacteria 723
290 Ga0207679_12100962 3300025945 Unclassified 513
291 Ga0207651_10381541 3300025960 Bacteria 1194
292 Ga0207712_10013801 3300025961 Bacteria 5183
293 Ga0207712_10353754 3300025961 Bacteria 1222
294 Ga0207640_10017965 3300025981 Bacteria 4147
295 Ga0207658_10037461 3300025986 Bacteria 3486
296 Ga0207658_10569086 3300025986 Bacteria 1015
297 Ga0207677_10578845 3300026023 Bacteria 982
298 Ga0207639_11029063 3300026041 Unclassified 772
299 Ga0207678_10270487 3300026067 Bacteria 1457
300 Ga0207641_10198017 3300026088 Bacteria 1850
301 Ga0207676_10104103 3300026095 Bacteria 2360
302 Ga0207676_10463157 3300026095 Bacteria 1197
303 Ga0207674_10626058 3300026116 Bacteria 1039
304 Ga0207674_10977549 3300026116 Unclassified 815
305 Ga0207675_100636386 3300026118 Bacteria 1072
306 Ga0207675_100729693 3300026118 Unclassified 1001
307 Ga0207683_10056322 3300026121 Bacteria 3448
308 Ga0207683_10240682 3300026121 Bacteria 1651
309 Ga0209995_1038157 3300027471 Bacteria 809
310 Ga0209588_1003638 3300027671 Bacteria 4283
311 Ga0209971_1042426 3300027682 Bacteria 1095
312 Ga0268266_10284704 3300028379 Unclassified 1538
313 Ga0268266_10326652 3300028379 Bacteria 1437
314 Ga0268266_11484502 3300028379 Bacteria 653
315 Ga0268264_10218380 3300028381 Bacteria 1754
316 Ga0373932_0382405 3300035112 Unclassified 541
317 Ga0373942_0047189 3300035207 Bacteria 1196
318 Ga0373961_0096785 3300035241 Bacteria 950
319 Ga0373931_0001263 3300035691 Bacteria 10811
320 Ga0373931_0004033 3300035691 Bacteria 6656
321 Ga0373931_0326780 3300035691 Unclassified 954
322 Ga0451807_1041321 3300041486 Bacteria 914
323 Ga0439444_0161542 3300042437 Bacteria 547
324 Ga0439460_0011627 3300042461 Bacteria 2273
325 Ga0451577_0413913 3300042876 Bacteria 1224
326 Ga0451577_0580568 3300042876 Bacteria 1017
327 Ga0453683_0020338 3300044673 Bacteria 4243
328 Ga0453683_0062513 3300044673 Bacteria 2328
329 Ga0453683_0542870 3300044673 Bacteria 756
330 Ga0453684_0218626 3300044712 Bacteria 2209
331 Ga0453684_0222268 3300044712 Bacteria 2187
332 Ga0453684_0512362 3300044712 Bacteria 1327
333 Ga0453684_0651860 3300044712 Bacteria 1149
334 Ga0453684_1666261 3300044712 Bacteria 652
335 Ga0451576_0402535 3300045051 Bacteria 1435
336 Ga0451576_0427130 3300045051 Bacteria 1390
337 Ga0451576_0501934 3300045051 Bacteria 1274
338 Ga0451576_0747232 3300045051 Unclassified 1027
339 Ga0451576_0751765 3300045051 Bacteria 1024
340 Ga0451576_0819079 3300045051 Bacteria 977
341 Ga0451576_1294594 3300045051 Bacteria 760
342 Ga0495621_0074481 3300046539 Bacteria 1256
343 Ga0495669_0160048 3300046684 Bacteria 1068
344 Ga0496101_0706600 3300048904 Bacteria 796
345 Ga0496102_1419975 3300048905 Unclassified 613
346 Ga0496103_0838407 3300048906 Unclassified 578
347 Ga0496108_0193947 3300048911 Bacteria 1761
348 Ga0496108_0951743 3300048911 Unclassified 735
349 Ga0496108_1552025 3300048911 Unclassified 549
350 Ga0496109_0126143 3300048912 Bacteria 2387
351 Ga0496109_0720130 3300048912 Bacteria 935
352 Ga0496110_0226776 3300048913 Bacteria 1699
353 Ga0496110_1495471 3300048913 Unclassified 585
354 Ga0496111_0068249 3300048914 Bacteria 2584
355 Ga0496111_0387509 3300048914 Bacteria 1033
356 Ga0496111_0423330 3300048914 Unclassified 984
357 Ga0496112_0003621 3300048915 Bacteria 12865
358 Ga0496112_0019582 3300048915 Bacteria 6391
359 Ga0496112_0242896 3300048915 Bacteria 1753
360 Ga0496112_0915745 3300048915 Unclassified 798
361 Ga0496113_0123617 3300048916 Bacteria 2025
362 Ga0501031_0124315 3300049568 Bacteria 1685
363 Ga0501031_0730071 3300049568 Bacteria 635
364 Ga0501032_0038874 3300049569 Bacteria 3239
365 Ga0501033_0028751 3300049570 Bacteria 4177
366 Ga0501033_0051702 3300049570 Bacteria 3046
367 Ga0501036_0002440 3300049572 Bacteria 14560
368 Ga0501036_0007526 3300049572 Bacteria 8882
369 Ga0501036_1084061 3300049572 Bacteria 654
370 Ga0501036_1226123 3300049572 Bacteria 611
371 Ga0501037_0294480 3300049573 Bacteria 1128
372 Ga0501038_0014034 3300049574 Bacteria 7301
373 Ga0501038_0033103 3300049574 Bacteria 4553
374 Ga0501038_0115417 3300049574 Bacteria 2220
375 Ga0501038_0606925 3300049574 Bacteria 827
376 Ga0501039_0003346 3300049575 Bacteria 11974
377 Ga0501039_0010032 3300049575 Bacteria 7223
378 Ga0501039_0053789 3300049575 Bacteria 3116
379 Ga0501039_0165318 3300049575 Bacteria 1740
380 Ga0501039_0225812 3300049575 Bacteria 1472
381 Ga0501039_0767773 3300049575 Bacteria 752
382 Ga0501040_0000451 3300049576 Bacteria 24377
383 Ga0501040_0017630 3300049576 Bacteria 4740
384 Ga0501040_0044953 3300049576 Bacteria 3011
385 Ga0501040_0143249 3300049576 Bacteria 1684
386 Ga0501040_0413237 3300049576 Bacteria 969
387 Ga0501040_1189979 3300049576 Unclassified 553
388 Ga0501040_1285027 3300049576 Bacteria 531
389 Ga0501041_0015131 3300049577 Bacteria 4583
390 Ga0501041_0021425 3300049577 Bacteria 3872
391 Ga0501041_0247779 3300049577 Bacteria 1120
392 Ga0501041_0252787 3300049577 Bacteria 1108
393 Ga0501041_0721021 3300049577 Bacteria 638
394 Ga0501042_0001711 3300049578 Bacteria 13113
395 Ga0501042_0011359 3300049578 Bacteria 6008
396 Ga0501042_0112959 3300049578 Bacteria 1956
397 Ga0501042_0207268 3300049578 Bacteria 1414
398 Ga0501042_0438414 3300049578 Bacteria 947
399 Ga0501043_0341699 3300049579 Bacteria 1138
400 Ga0501046_0006844 3300049580 Bacteria 10057
401 Ga0501046_0098677 3300049580 Bacteria 2243
402 Ga0501046_0227358 3300049580 Bacteria 1380
403 Ga0501046_0475321 3300049580 Bacteria 897
404 Ga0501048_0026617 3300049582 Bacteria 4210
405 Ga0501048_0041539 3300049582 Bacteria 3293
406 Ga0501048_0113629 3300049582 Bacteria 1913
407 Ga0501068_0004521 3300049584 Bacteria 7571
408 Ga0501068_0014427 3300049584 Bacteria 4518
409 Ga0501068_0185556 3300049584 Bacteria 1316
410 Ga0501068_1163910 3300049584 Bacteria 511
411 Ga0501069_0266785 3300049585 Bacteria 1000
412 Ga0501070_0135513 3300049586 Bacteria 2033
413 Ga0501071_0001745 3300049587 Bacteria 12805
414 Ga0501071_0096397 3300049587 Bacteria 2177
415 Ga0501071_0100336 3300049587 Bacteria 2133
416 Ga0501071_0272297 3300049587 Bacteria 1280
417 Ga0501071_0309996 3300049587 Bacteria 1197
418 Ga0501071_0733622 3300049587 Bacteria 761
419 Ga0501071_1296013 3300049587 Bacteria 563
420 Ga0501072_0002827 3300049588 Bacteria 13024
421 Ga0501072_0021576 3300049588 Bacteria 4995
422 Ga0501072_0033480 3300049588 Bacteria 4026
423 Ga0501072_0166931 3300049588 Bacteria 1756
424 Ga0501072_1142830 3300049588 Bacteria 605
425 Ga0501072_1252490 3300049588 Bacteria 575
426 Ga0501072_1553401 3300049588 Bacteria 510
427 Ga0501074_0018250 3300049590 Bacteria 5097
428 Ga0501074_0089999 3300049590 Bacteria 2198
429 Ga0501074_0213732 3300049590 Bacteria 1373
430 Ga0501074_0729881 3300049590 Bacteria 699
431 Ga0501075_0000934 3300049591 Bacteria 18565
432 Ga0501075_0016669 3300049591 Bacteria 5298
433 Ga0501075_0030357 3300049591 Bacteria 4003
434 Ga0501075_0064276 3300049591 Bacteria 2768
435 Ga0501075_0065427 3300049591 Bacteria 2743
436 Ga0501075_0113101 3300049591 Bacteria 2064
437 Ga0501075_0672223 3300049591 Bacteria 789
438 Ga0501075_0788981 3300049591 Bacteria 723
439 Ga0501076_0000667 3300049592 Bacteria 22011
440 Ga0501076_0004300 3300049592 Bacteria 10101
441 Ga0501076_0020162 3300049592 Bacteria 5102
442 Ga0501076_0022999 3300049592 Bacteria 4797
443 Ga0501076_0038955 3300049592 Bacteria 3731
444 Ga0501076_0097211 3300049592 Bacteria 2372
445 Ga0501076_0203967 3300049592 Bacteria 1615
446 Ga0501076_0286882 3300049592 Bacteria 1349
447 Ga0501076_0497649 3300049592 Bacteria 1005
448 Ga0501076_0503238 3300049592 Bacteria 998
449 Ga0501076_0588136 3300049592 Bacteria 918
450 Ga0501077_0000074 3300049593 Bacteria 50267
451 Ga0501077_0025126 3300049593 Bacteria 3784
452 Ga0501077_0039201 3300049593 Bacteria 3017
453 Ga0501077_0120939 3300049593 Bacteria 1659
454 Ga0501077_0165804 3300049593 Bacteria 1403
455 Ga0501077_0172018 3300049593 Bacteria 1376
456 Ga0501077_0407566 3300049593 Bacteria 869
457 Ga0501077_0824940 3300049593 Bacteria 596
458 Ga0501079_0002434 3300049741 Bacteria 13520
459 Ga0501079_0013037 3300049741 Bacteria 6341
460 Ga0501079_0046013 3300049741 Bacteria 3367
461 Ga0501079_0105420 3300049741 Bacteria 2188
462 Ga0501079_0169862 3300049741 Bacteria 1700
463 Ga0501079_0184538 3300049741 Bacteria 1628
464 Ga0501079_0506122 3300049741 Bacteria 949
465 Ga0501079_0718730 3300049741 Bacteria 786
466 Ga0501079_0852247 3300049741 Bacteria 718
467 Ga0501080_0000477 3300049742 Bacteria 31151
468 Ga0501080_0008463 3300049742 Bacteria 9320
469 Ga0501080_0039859 3300049742 Bacteria 4383
470 Ga0501080_0349286 3300049742 Bacteria 1336
471 Ga0501080_0891540 3300049742 Bacteria 776
472 Ga0501080_1491454 3300049742 Bacteria 575
473 Ga0501081_0000044 3300049743 Bacteria 47269
474 Ga0501081_0004355 3300049743 Bacteria 9077
475 Ga0501081_0027075 3300049743 Bacteria 3870
476 Ga0501081_0031601 3300049743 Bacteria 3588
477 Ga0501081_0039281 3300049743 Bacteria 3238
478 Ga0501081_0146274 3300049743 Bacteria 1696
479 Ga0501081_0298653 3300049743 Bacteria 1181
480 Ga0501081_0413113 3300049743 Bacteria 1000
481 Ga0501081_0648849 3300049743 Bacteria 791
482 Ga0501081_0911378 3300049743 Bacteria 663
483 Ga0501083_0088964 3300049744 Bacteria 2041
484 Ga0501083_0202423 3300049744 Bacteria 1295
485 Ga0501083_0232257 3300049744 Bacteria 1201
486 Ga0501035_0008864 3300049822 Bacteria 9361
487 Ga0501035_0100974 3300049822 Bacteria 2532
488 Ga0501035_0393893 3300049822 Bacteria 1153
489 Ga0501035_0432811 3300049822 Bacteria 1091
490 Ga0501035_0964787 3300049822 Bacteria 672
491 Ga0501044_1231744 3300049823 Bacteria 616
492 Ga0501045_0002721 3300049824 Bacteria 12068
493 Ga0501045_0013262 3300049824 Bacteria 5817
494 Ga0501045_0031518 3300049824 Bacteria 3840
495 Ga0501045_0093548 3300049824 Bacteria 2223
496 Ga0501045_0261037 3300049824 Bacteria 1289
497 Ga0501045_0642284 3300049824 Bacteria 785
498 Ga0501045_0953473 3300049824 Bacteria 630
499 nmdc:mga05p37_101953_c1 3300050507 Unclassified 720
500 nmdc:mga05p37_1121250_c1 3300050507 Bacteria 822
501 nmdc:mga05p37_114964_c1 3300050507 Bacteria 3308
502 nmdc:mga05p37_11499_c1 3300050507 Bacteria 8763
503 nmdc:mga05p37_138495_c1 3300050507 Bacteria 2983
504 nmdc:mga05p37_182294_c1 3300050507 Unclassified 2554
505 nmdc:mga05p37_2038_c1 3300050507 Bacteria 23576
506 nmdc:mga05p37_2100_c1 3300050507 Bacteria 23261
507 nmdc:mga05p37_2665_c1 3300050507 Bacteria 20797
508 nmdc:mga05p37_307132_c1 3300050507 Bacteria 1882
509 nmdc:mga05p37_313793_c1 3300050507 Unclassified 1858
510 nmdc:mga05p37_39511_c1 3300050507 Bacteria 5794
511 nmdc:mga05p37_471067_c1 3300050507 Bacteria 1449
512 nmdc:mga05p37_508348_c1 3300050507 Bacteria 1381
513 nmdc:mga05p37_739222_c1 3300050507 Bacteria 1086
514 nmdc:mga09592_197_c1 3300050508 Bacteria 43343
515 nmdc:mga09592_277679_c1 3300050508 Bacteria 1453
516 nmdc:mga09592_28315_c1 3300050508 Bacteria 4654
517 nmdc:mga09592_34776_c1 3300050508 Bacteria 4214
518 nmdc:mga09592_974702_c1 3300050508 Bacteria 710
519 nmdc:mga06r32_107123_c1 3300050510 Bacteria 2746
520 nmdc:mga06r32_170018_c1 3300050510 Bacteria 2163
521 nmdc:mga06r32_282125_c1 3300050510 Bacteria 1648
522 nmdc:mga06r32_626072_c1 3300050510 Bacteria 1045
523 nmdc:mga06r32_634306_c1 3300050510 Bacteria 1037
524 nmdc:mga06r32_659103_c1 3300050510 Bacteria 1014
525 nmdc:mga06r32_76036_c1 3300050510 Bacteria 3260
526 nmdc:mga06r32_8482_c1 3300050510 Bacteria 9262
527 nmdc:mga06r32_92238_c1 3300050510 Bacteria 2961
528 nmdc:mga08y16_1173267_c1 3300050511 Unclassified 740
529 nmdc:mga08y16_208268_c1 3300050511 Bacteria 2025
530 nmdc:mga08y16_665469_c1 3300050511 Unclassified 1044
531 nmdc:mga0n895_11570_c1 3300050512 Bacteria 7883
532 nmdc:mga0n895_131573_c1 3300050512 Bacteria 2527
533 nmdc:mga0n895_29003_c1 3300050512 Bacteria 5273
534 nmdc:mga0n895_530519_c1 3300050512 Bacteria 1184
535 nmdc:mga0n895_542280_c1 3300050512 Unclassified 1169
536 nmdc:mga0n895_87390_c1 3300050512 Bacteria 3115
537 nmdc:mga0n895_98886_c1 3300050512 Bacteria 2925
538 nmdc:mga0rr50_105660_c1 3300050513 Bacteria 2220
539 nmdc:mga0rr50_3829_c1 3300050513 Bacteria 8735
540 nmdc:mga0rr50_578454_c1 3300050513 Unclassified 957
541 nmdc:mga0rr50_88058_c1 3300050513 Unclassified 2411
542 nmdc:mga08x19_11752_c1 3300050514 Bacteria 5272
543 nmdc:mga08x19_287926_c1 3300050514 Bacteria 1139
544 nmdc:mga08x19_383031_c1 3300050514 Unclassified 985
545 nmdc:mga08x19_472761_c1 3300050514 Unclassified 883
546 nmdc:mga08x19_87289_c1 3300050514 Bacteria 2055
547 nmdc:mga08x19_887654_c1 3300050514 Bacteria 633
548 nmdc:mga0a205_1047090_c1 3300050515 Unclassified 663
549 nmdc:mga0a205_11120_c1 3300050515 Bacteria 8283
550 nmdc:mga0a205_140301_c1 3300050515 Bacteria 2317
551 nmdc:mga0a205_15755_c1 3300050515 Bacteria 7067
552 nmdc:mga0a205_241586_c1 3300050515 Bacteria 1687
553 nmdc:mga0a205_407409_c1 3300050515 Unclassified 1223
554 nmdc:mga0a205_423106_c1 3300050515 Unclassified 1194
555 nmdc:mga0a205_485154_c1 3300050515 Unclassified 1094
556 nmdc:mga0a205_542253_c1 3300050515 Bacteria 1019
557 nmdc:mga0a205_63911_c2 3300050515 Bacteria 3040
558 nmdc:mga0a205_957244_c1 3300050515 Bacteria 703
559 Ga0501084_0000275 3300054114 Bacteria 38937
560 Ga0501084_0105338 3300054114 Bacteria 2369
561 Ga0501084_0121203 3300054114 Bacteria 2199
562 Ga0501084_0192787 3300054114 Bacteria 1719
563 Ga0501084_0373377 3300054114 Bacteria 1205
564 Ga0501084_0554718 3300054114 Bacteria 971
565 Ga0501084_0663437 3300054114 Bacteria 880
566 Ga0501084_0975464 3300054114 Bacteria 712
567 Ga0501082_0002550 3300060353 Bacteria 15961
568 Ga0501082_0005336 3300060353 Bacteria 11166
569 Ga0501082_0031901 3300060353 Bacteria 4544
570 Ga0501082_0185216 3300060353 Bacteria 1811
571 Ga0501082_0191433 3300060353 Bacteria 1779
572 Ga0501082_0204396 3300060353 Bacteria 1718
573 Ga0501082_0243819 3300060353 Bacteria 1564
574 Ga0501082_0484698 3300060353 Bacteria 1081
575 Ga0501082_0790003 3300060353 Bacteria 830
576 Ga0501082_1134382 3300060353 Bacteria 683
577 Ga0530510_0000627 3300061734 Bacteria 22781
578 Ga0530510_0006017 3300061734 Bacteria 8418
579 Ga0530510_0006605 3300061734 Bacteria 8089
580 Ga0530510_0037315 3300061734 Bacteria 3504
581 Ga0530510_0062827 3300061734 Bacteria 2688
582 Ga0530510_0067735 3300061734 Bacteria 2589
583 Ga0530510_0088185 3300061734 Bacteria 2261
584 Ga0530510_0141037 3300061734 Bacteria 1775
585 Ga0530510_0142049 3300061734 Bacteria 1769
586 Ga0530510_0259768 3300061734 Bacteria 1295
587 Ga0530510_0278044 3300061734 Bacteria 1250
588 Ga0530510_0321799 3300061734 Bacteria 1159
589 Ga0530510_0411669 3300061734 Bacteria 1020
590 Ga0501043_0183867
591 JGI24743J22301_10037471
592 JGI24033J26618_1051464
593 Ga0065714_10266228
594 Ga0065712_10028332
595 Ga0065712_10067755
596 Ga0065712_10069144
597 Ga0065712_10160499
598 Ga0065715_10014335
599 Ga0065715_10089069
600 Ga0065715_10092886
601 Ga0065707_10047137
602 Ga0065707_10047484
603 Ga0065707_10234837
604 Ga0065707_10251880
605 Ga0065707_10293366
606 Ga0065707_10432651
607 Ga0070683_100022873
608 Ga0070690_100277120
609 Ga0070670_100043025
610 Ga0070670_100182969
611 Ga0070670_101695122
612 Ga0070677_10010993
613 Ga0068869_100214258
614 Ga0068869_100669278
615 Ga0070666_10130962
616 Ga0070666_10131937
617 Ga0070666_10143890
618 Ga0070666_11328255
619 Ga0070680_100972943
620 Ga0070682_100298417
621 Ga0068868_100033583
622 Ga0070660_100015334
623 Ga0070660_100118147
624 Ga0070660_100438876
625 Ga0070661_100025715
626 Ga0070692_10314774
627 Ga0070692_10865840
628 Ga0070669_100256997
629 Ga0070675_100060969
630 Ga0070675_101300098
631 Ga0070671_100063918
632 Ga0070671_100188412
633 Ga0070671_100979735
634 Ga0070674_100334375
635 Ga0070674_100418554
636 Ga0070673_100071300
637 Ga0070673_100141535
638 Ga0070673_100329562
639 Ga0070659_100290360
640 Ga0070659_100999111
641 Ga0070667_100223391
642 Ga0070705_100027281
643 Ga0070705_100299425
644 Ga0070705_100951359
645 Ga0070694_100249175
646 Ga0070694_100432813
647 Ga0070708_100002144
648 Ga0070708_100006411
649 Ga0070708_100076223
650 Ga0070708_100486246
651 Ga0070678_100301112
652 Ga0070662_100057610
653 Ga0070662_100717375
654 Ga0070662_100789678
655 Ga0070681_10010147
656 Ga0070681_10940843
657 Ga0068867_100218456
658 Ga0070706_100252409
659 Ga0070706_100362100
660 Ga0070706_100555893
661 Ga0070706_100880607
662 Ga0070706_102167026
663 Ga0070707_100314333
664 Ga0070707_100331932
665 Ga0070707_100581270
666 Ga0070707_100814830
667 Ga0070698_100105754
668 Ga0070698_100144681
669 Ga0070698_100241053
670 Ga0070699_100010101
671 Ga0070699_100024437
672 Ga0070699_100187395
673 Ga0070699_100220122
674 Ga0070699_100696136
675 Ga0070699_101129527
676 Ga0070699_101266195
677 Ga0070699_102109434
678 Ga0070679_100061715
679 Ga0070684_100313491
680 Ga0070697_100011695
681 Ga0070697_100099546
682 Ga0070697_100196271
683 Ga0070697_101174884
684 Ga0070672_100011864
685 Ga0070695_100924053
686 Ga0070696_100079749
687 Ga0070693_100565479
688 Ga0070693_100779300
689 Ga0070665_100419006
690 Ga0070665_101627873
691 Ga0070704_100003067
692 Ga0070704_100104922
693 Ga0070664_100004304
694 Ga0070664_100018154
695 Ga0070664_101175717
696 Ga0068857_100457358
697 Ga0068857_101060150
698 Ga0068857_101446389
699 Ga0068854_100050038
700 Ga0070702_100112129
701 Ga0068852_100149051
702 Ga0068859_102341930
703 Ga0068864_100212199
704 Ga0068864_100237798
705 Ga0068866_10235516
706 Ga0068866_10279148
707 Ga0068861_100983434
708 Ga0068861_101141860
709 Ga0068851_10095495
710 Ga0068870_10301002
711 Ga0068863_100102915
712 Ga0068863_100152384
713 Ga0068858_100123384
714 Ga0068858_100423249
715 Ga0068860_100560203
716 Ga0081455_10005813
717 Ga0081455_10033313
718 Ga0081455_10369535
719 Ga0081455_10445513
720 Ga0081455_10831894
721 Ga0081538_10003350
722 Ga0081540_1094291
723 Ga0081540_1221716
724 Ga0097621_100081012
725 Ga0097621_100905851
726 Ga0068871_100118004
727 Ga0075428_100991276
728 Ga0075428_102141584
729 Ga0075430_100968337
730 Ga0075431_100010703
731 Ga0075431_100048280
732 Ga0075431_100108369
733 Ga0075431_100124178
734 Ga0075431_100247831
735 Ga0075431_100256912
736 Ga0075431_100566990
737 Ga0075433_10058770
738 Ga0075433_10127400
739 Ga0075433_10356863
740 Ga0075433_10425156
741 Ga0075433_10483618
742 Ga0075433_10561891
743 Ga0075433_10790944
744 Ga0075434_100018569
745 Ga0075434_100044050
746 Ga0075434_100056563
747 Ga0075434_100152137
748 Ga0075434_100468063
749 Ga0075434_101191359
750 Ga0075434_101463826
751 Ga0075429_100002115
752 Ga0075429_100040826
753 Ga0075429_100060779
754 Ga0075429_100134257
755 Ga0075429_100481109
756 Ga0075429_101116180
757 Ga0068865_100453434
758 Ga0075436_100011490
759 Ga0075436_100098284
760 Ga0075436_100418629
761 Ga0075436_100873945
762 Ga0075436_100894125
763 Ga0075436_101359938
764 Ga0097620_102342025
765 Ga0075435_100017591
766 Ga0075435_100094595
767 Ga0075435_100103793
768 Ga0075435_100233896
769 Ga0075435_100604759
770 Ga0111539_10295353
771 Ga0111539_10371327
772 Ga0111539_10544275
773 Ga0105245_10435301
774 Ga0114129_10001013
775 Ga0114129_10003126
776 Ga0114129_10019029
777 Ga0114129_10020002
778 Ga0114129_10079842
779 Ga0114129_10195232
780 Ga0114129_10492231
781 Ga0114129_10530666
782 Ga0114129_10803868
783 Ga0114129_10906097
784 Ga0114129_11215859
785 Ga0114129_11902665
786 Ga0114129_11948840
787 Ga0105243_11544118
788 Ga0105241_10013072
789 Ga0105248_10126582
790 Ga0105248_10366257
791 Ga0105249_10018074
792 Ga0105249_10113285
793 Ga0105239_11680277
794 Ga0105246_10381185
795 Ga0157320_1015867
796 Ga0157347_1013010
797 Ga0157327_1006552
798 Ga0157338_1076315
799 Ga0157371_10316512
800 Ga0157370_10645345
801 Ga0157369_11398221
802 Ga0157374_10172963
803 Ga0157374_10394737
804 Ga0157374_11532214
805 Ga0157374_12124385
806 Ga0157378_10076923
807 Ga0157378_10419383
808 Ga0157378_10440295
809 Ga0157378_10544437
810 Ga0157378_12929582
811 Ga0163162_10047844
812 Ga0163162_10796732
813 Ga0163162_12366249
814 Ga0157375_10078304
815 Ga0157375_11028609
816 Ga0157380_12699908
817 Ga0157377_10308597
818 Ga0157379_12224748
819 Ga0157376_10073256
820 Ga0157376_10122943
821 Ga0163161_10343925
822 Ga0207666_1029815
823 Ga0207697_10020145
824 Ga0207656_10184505
825 Ga0207682_10066818
826 Ga0207642_10522294
827 Ga0207680_10095932
828 Ga0207680_10212760
829 Ga0207680_10589789
830 Ga0207647_10092646
831 Ga0207684_10003194
832 Ga0207684_10084996
833 Ga0207684_10185997
834 Ga0207684_10362559
835 Ga0207654_10131245
836 Ga0207707_10026320
837 Ga0207707_10740487
838 Ga0207660_10066997
839 Ga0207660_10324482
840 Ga0207662_10476349
841 Ga0207657_10444916
842 Ga0207657_10446526
843 Ga0207649_10013431
844 Ga0207649_10031715
845 Ga0207646_10001925
846 Ga0207646_10011509
847 Ga0207646_10323224
848 Ga0207646_10808281
849 Ga0207646_10895862
850 Ga0207646_11154893
851 Ga0207681_10072703
852 Ga0207681_10587218
853 Ga0207681_11457510
854 Ga0207650_10002842
855 Ga0207650_10016915
856 Ga0207659_10022534
857 Ga0207659_11243326
858 Ga0207644_10044743
859 Ga0207644_10309711
860 Ga0207644_10632492
861 Ga0207690_10009008
862 Ga0207690_10272438
863 Ga0207690_10899895
864 Ga0207706_10104695
865 Ga0207706_10469817
866 Ga0207706_10551825
867 Ga0207669_10152212
868 Ga0207669_10381773
869 Ga0207665_10179157
870 Ga0207691_10041423
871 Ga0207711_10281071
872 Ga0207711_10442449
873 Ga0207689_10205129
874 Ga0207661_10099043
875 Ga0207679_10002444
876 Ga0207679_10071549
877 Ga0207679_10133170
878 Ga0207679_11118638
879 Ga0207679_12100962
880 Ga0207651_10381541
881 Ga0207712_10013801
882 Ga0207712_10353754
883 Ga0207640_10017965
884 Ga0207658_10037461
885 Ga0207658_10569086
886 Ga0207677_10578845
887 Ga0207639_11029063
888 Ga0207678_10270487
889 Ga0207641_10198017
890 Ga0207676_10104103
891 Ga0207676_10463157
892 Ga0207674_10626058
893 Ga0207674_10977549
894 Ga0207675_100636386
895 Ga0207675_100729693
896 Ga0207683_10056322
897 Ga0207683_10240682
898 Ga0209995_1038157
899 Ga0209588_1003638
900 Ga0209971_1042426
901 Ga0268266_10284704
902 Ga0268266_10326652
903 Ga0268266_11484502
904 Ga0268264_10218380
905 Ga0373932_0382405
906 Ga0373942_0047189
907 Ga0373961_0096785
908 Ga0373931_0001263
909 Ga0373931_0004033
910 Ga0373931_0326780
911 Ga0451807_1041321
912 Ga0439444_0161542
913 Ga0439460_0011627
914 Ga0451577_0413913
915 Ga0451577_0580568
916 Ga0453683_0020338
917 Ga0453683_0062513
918 Ga0453683_0542870
919 Ga0453684_0218626
920 Ga0453684_0222268
921 Ga0453684_0512362
922 Ga0453684_0651860
923 Ga0453684_1666261
924 Ga0451576_0402535
925 Ga0451576_0427130
926 Ga0451576_0501934
927 Ga0451576_0747232
928 Ga0451576_0751765
929 Ga0451576_0819079
930 Ga0451576_1294594
931 Ga0495621_0074481
932 Ga0495669_0160048
933 Ga0496101_0706600
934 Ga0496102_1419975
935 Ga0496103_0838407
936 Ga0496108_0193947
937 Ga0496108_0951743
938 Ga0496108_1552025
939 Ga0496109_0126143
940 Ga0496109_0720130
941 Ga0496110_0226776
942 Ga0496110_1495471
943 Ga0496111_0068249
944 Ga0496111_0387509
945 Ga0496111_0423330
946 Ga0496112_0003621
947 Ga0496112_0019582
948 Ga0496112_0242896
949 Ga0496112_0915745
950 Ga0496113_0123617
951 Ga0501031_0124315
952 Ga0501031_0730071
953 Ga0501032_0038874
954 Ga0501033_0028751
955 Ga0501033_0051702
956 Ga0501036_0002440
957 Ga0501036_0007526
958 Ga0501036_1084061
959 Ga0501036_1226123
960 Ga0501037_0294480
961 Ga0501038_0014034
962 Ga0501038_0033103
963 Ga0501038_0115417
964 Ga0501038_0606925
965 Ga0501039_0003346
966 Ga0501039_0010032
967 Ga0501039_0053789
968 Ga0501039_0165318
969 Ga0501039_0225812
970 Ga0501039_0767773
971 Ga0501040_0000451
972 Ga0501040_0017630
973 Ga0501040_0044953
974 Ga0501040_0143249
975 Ga0501040_0413237
976 Ga0501040_1189979
977 Ga0501040_1285027
978 Ga0501041_0015131
979 Ga0501041_0021425
980 Ga0501041_0247779
981 Ga0501041_0252787
982 Ga0501041_0721021
983 Ga0501042_0001711
984 Ga0501042_0011359
985 Ga0501042_0112959
986 Ga0501042_0207268
987 Ga0501042_0438414
988 Ga0501043_0341699
989 Ga0501046_0006844
990 Ga0501046_0098677
991 Ga0501046_0227358
992 Ga0501046_0475321
993 Ga0501048_0026617
994 Ga0501048_0041539
995 Ga0501048_0113629
996 Ga0501068_0004521
997 Ga0501068_0014427
998 Ga0501068_0185556
999 Ga0501068_1163910
1000 Ga0501069_0266785
1001 Ga0501070_0135513
1002 Ga0501071_0001745
1003 Ga0501071_0096397
1004 Ga0501071_0100336
1005 Ga0501071_0272297
1006 Ga0501071_0309996
1007 Ga0501071_0733622
1008 Ga0501071_1296013
1009 Ga0501072_0002827
1010 Ga0501072_0021576
1011 Ga0501072_0033480
1012 Ga0501072_0166931
1013 Ga0501072_1142830
1014 Ga0501072_1252490
1015 Ga0501072_1553401
1016 Ga0501074_0018250
1017 Ga0501074_0089999
1018 Ga0501074_0213732
1019 Ga0501074_0729881
1020 Ga0501075_0000934
1021 Ga0501075_0016669
1022 Ga0501075_0030357
1023 Ga0501075_0064276
1024 Ga0501075_0065427
1025 Ga0501075_0113101
1026 Ga0501075_0672223
1027 Ga0501075_0788981
1028 Ga0501076_0000667
1029 Ga0501076_0004300
1030 Ga0501076_0020162
1031 Ga0501076_0022999
1032 Ga0501076_0038955
1033 Ga0501076_0097211
1034 Ga0501076_0203967
1035 Ga0501076_0286882
1036 Ga0501076_0497649
1037 Ga0501076_0503238
1038 Ga0501076_0588136
1039 Ga0501077_0000074
1040 Ga0501077_0025126
1041 Ga0501077_0039201
1042 Ga0501077_0120939
1043 Ga0501077_0165804
1044 Ga0501077_0172018
1045 Ga0501077_0407566
1046 Ga0501077_0824940
1047 Ga0501079_0002434
1048 Ga0501079_0013037
1049 Ga0501079_0046013
1050 Ga0501079_0105420
1051 Ga0501079_0169862
1052 Ga0501079_0184538
1053 Ga0501079_0506122
1054 Ga0501079_0718730
1055 Ga0501079_0852247
1056 Ga0501080_0000477
1057 Ga0501080_0008463
1058 Ga0501080_0039859
1059 Ga0501080_0349286
1060 Ga0501080_0891540
1061 Ga0501080_1491454
1062 Ga0501081_0000044
1063 Ga0501081_0004355
1064 Ga0501081_0027075
1065 Ga0501081_0031601
1066 Ga0501081_0039281
1067 Ga0501081_0146274
1068 Ga0501081_0298653
1069 Ga0501081_0413113
1070 Ga0501081_0648849
1071 Ga0501081_0911378
1072 Ga0501083_0088964
1073 Ga0501083_0202423
1074 Ga0501083_0232257
1075 Ga0501035_0008864
1076 Ga0501035_0100974
1077 Ga0501035_0393893
1078 Ga0501035_0432811
1079 Ga0501035_0964787
1080 Ga0501044_1231744
1081 Ga0501045_0002721
1082 Ga0501045_0013262
1083 Ga0501045_0031518
1084 Ga0501045_0093548
1085 Ga0501045_0261037
1086 Ga0501045_0642284
1087 Ga0501045_0953473
1088 nmdc:mga05p37_101953_c1
1089 nmdc:mga05p37_1121250_c1
1090 nmdc:mga05p37_114964_c1
1091 nmdc:mga05p37_11499_c1
1092 nmdc:mga05p37_138495_c1
1093 nmdc:mga05p37_182294_c1
1094 nmdc:mga05p37_2038_c1
1095 nmdc:mga05p37_2100_c1
1096 nmdc:mga05p37_2665_c1
1097 nmdc:mga05p37_307132_c1
1098 nmdc:mga05p37_313793_c1
1099 nmdc:mga05p37_39511_c1
1100 nmdc:mga05p37_471067_c1
1101 nmdc:mga05p37_508348_c1
1102 nmdc:mga05p37_739222_c1
1103 nmdc:mga09592_197_c1
1104 nmdc:mga09592_277679_c1
1105 nmdc:mga09592_28315_c1
1106 nmdc:mga09592_34776_c1
1107 nmdc:mga09592_974702_c1
1108 nmdc:mga06r32_107123_c1
1109 nmdc:mga06r32_170018_c1
1110 nmdc:mga06r32_282125_c1
1111 nmdc:mga06r32_626072_c1
1112 nmdc:mga06r32_634306_c1
1113 nmdc:mga06r32_659103_c1
1114 nmdc:mga06r32_76036_c1
1115 nmdc:mga06r32_8482_c1
1116 nmdc:mga06r32_92238_c1
1117 nmdc:mga08y16_1173267_c1
1118 nmdc:mga08y16_208268_c1
1119 nmdc:mga08y16_665469_c1
1120 nmdc:mga0n895_11570_c1
1121 nmdc:mga0n895_131573_c1
1122 nmdc:mga0n895_29003_c1
1123 nmdc:mga0n895_530519_c1
1124 nmdc:mga0n895_542280_c1
1125 nmdc:mga0n895_87390_c1
1126 nmdc:mga0n895_98886_c1
1127 nmdc:mga0rr50_105660_c1
1128 nmdc:mga0rr50_3829_c1
1129 nmdc:mga0rr50_578454_c1
1130 nmdc:mga0rr50_88058_c1
1131 nmdc:mga08x19_11752_c1
1132 nmdc:mga08x19_287926_c1
1133 nmdc:mga08x19_383031_c1
1134 nmdc:mga08x19_472761_c1
1135 nmdc:mga08x19_87289_c1
1136 nmdc:mga08x19_887654_c1
1137 nmdc:mga0a205_1047090_c1
1138 nmdc:mga0a205_11120_c1
1139 nmdc:mga0a205_140301_c1
1140 nmdc:mga0a205_15755_c1
1141 nmdc:mga0a205_241586_c1
1142 nmdc:mga0a205_407409_c1
1143 nmdc:mga0a205_423106_c1
1144 nmdc:mga0a205_485154_c1
1145 nmdc:mga0a205_542253_c1
1146 nmdc:mga0a205_63911_c2
1147 nmdc:mga0a205_957244_c1
1148 Ga0501084_0000275
1149 Ga0501084_0105338
1150 Ga0501084_0121203
1151 Ga0501084_0192787
1152 Ga0501084_0373377
1153 Ga0501084_0554718
1154 Ga0501084_0663437
1155 Ga0501084_0975464
1156 Ga0501082_0002550
1157 Ga0501082_0005336
1158 Ga0501082_0031901
1159 Ga0501082_0185216
1160 Ga0501082_0191433
1161 Ga0501082_0204396
1162 Ga0501082_0243819
1163 Ga0501082_0484698
1164 Ga0501082_0790003
1165 Ga0501082_1134382
1166 Ga0530510_0000627
1167 Ga0530510_0006017
1168 Ga0530510_0006605
1169 Ga0530510_0037315
1170 Ga0530510_0062827
1171 Ga0530510_0067735
1172 Ga0530510_0088185
1173 Ga0530510_0141037
1174 Ga0530510_0142049
1175 Ga0530510_0259768
1176 Ga0530510_0278044
1177 Ga0530510_0321799
1178 Ga0530510_0411669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

103

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.9854 3 121
1m5u-assembly1.cif.gz_A crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form 0.9802 3 121
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.9788 3 121
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.9784 3 121
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9732 4 123
ID Description Score Start End Superfamily
1m5uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9802 3 121 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 3 85 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.97 4 85 3.40.50.2300
2wb4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9697 3 122 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9654 3 85 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V8BZ29-F1-model_v4 Response regulator 0.9947 4 124 GO:0000160
GO:0005524
GO:0005886
GO:0016301
AF-A0A6C0GBV1-F1-model_v4 Response regulator 0.9935 3 125 GO:0000160
GO:0003677
GO:0005737
GO:0006355
AF-A0A6N6ZKR4-F1-model_v4 LytT family response regulator 0.9926 4 124 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1M3IJ78-F1-model_v4 Transcriptional regulator 0.9899 4 127 GO:0000160
GO:0003677
GO:0005737
GO:0006355
AF-A0A5E7Y0R5-F1-model_v4 Protein PilH (Modular protein) 0.9896 4 127 GO:0000155
GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map