F466871

General Info

Members Datasets Scaffolds Average Seq Length
589 225 1178 143

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10085246|Ga0265326_100852462
Length 160
Sequence MSASPPRCSSTRHAGNGMSEPTLYLFDGFNLLHAGGFGSPEELRDLLASWVAAQGARGVLVFDGEGKDEDLGPLSVRWAKDADTLLERLAAERRGQEQVAIVSSDAAVRETMGIDVRKFASQTFLSEFSRPTQPEAVRGDLRDRLNPETLSKLERLRRGQ

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 9
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 8.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10085246 3300028558 Bacteria 894
2 Ga0070658_10066008 3300005327 Bacteria 2955
3 Ga0070658_10892405 3300005327 Bacteria 773
4 Ga0070683_100000945 3300005329 Bacteria 21625
5 Ga0070683_100145628 3300005329 Bacteria 2244
6 Ga0070690_101392606 3300005330 Bacteria 564
7 Ga0070680_100276374 3300005336 Bacteria 1422
8 Ga0070680_100611244 3300005336 Bacteria 936
9 Ga0070680_100698926 3300005336 Bacteria 872
10 Ga0068868_101722300 3300005338 Bacteria 591
11 Ga0070660_100155157 3300005339 Bacteria 1843
12 Ga0070660_100421188 3300005339 Bacteria 1106
13 Ga0070692_10173649 3300005345 Unclassified 1244
14 Ga0070675_100326199 3300005354 Unclassified 1357
15 Ga0070659_100765839 3300005366 Unclassified 838
16 Ga0070659_101248150 3300005366 Bacteria 658
17 Ga0070709_10004248 3300005434 Bacteria 7727
18 Ga0070709_10305075 3300005434 Unclassified 1164
19 Ga0070709_10320879 3300005434 Bacteria 1137
20 Ga0070714_100008225 3300005435 Bacteria 8128
21 Ga0070714_100020749 3300005435 Bacteria 5370
22 Ga0070714_100063746 3300005435 Bacteria 3170
23 Ga0070714_100279209 3300005435 Bacteria 1551
24 Ga0070714_100664894 3300005435 Bacteria 1003
25 Ga0070714_101489954 3300005435 Bacteria 661
26 Ga0070713_100024528 3300005436 Bacteria 4699
27 Ga0070713_100048019 3300005436 Bacteria 3512
28 Ga0070713_100285424 3300005436 Bacteria 1515
29 Ga0070710_10002692 3300005437 Bacteria 8446
30 Ga0070710_10094607 3300005437 Bacteria 1768
31 Ga0070710_11061544 3300005437 Unclassified 593
32 Ga0070711_100027561 3300005439 Bacteria 3731
33 Ga0070711_100174044 3300005439 Bacteria 1643
34 Ga0070711_101376763 3300005439 Bacteria 613
35 Ga0070694_100559023 3300005444 Bacteria 917
36 Ga0070681_10161555 3300005458 Bacteria 2164
37 Ga0070681_10172634 3300005458 Bacteria 2084
38 Ga0070681_10338809 3300005458 Bacteria 1413
39 Ga0070681_11121632 3300005458 Bacteria 708
40 Ga0070707_100000130 3300005468 Bacteria 70270
41 Ga0070707_100759836 3300005468 Bacteria 933
42 Ga0070698_100098295 3300005471 Bacteria 2901
43 Ga0070698_100190694 3300005471 Bacteria 1987
44 Ga0070699_100675747 3300005518 Bacteria 943
45 Ga0070699_100761345 3300005518 Bacteria 886
46 Ga0070679_100059955 3300005530 Bacteria 3792
47 Ga0070679_100060031 3300005530 Bacteria 3790
48 Ga0070679_100100561 3300005530 Bacteria 2877
49 Ga0070679_100612323 3300005530 Bacteria 1032
50 Ga0070684_100011308 3300005535 Bacteria 7106
51 Ga0070684_100081002 3300005535 Bacteria 2872
52 Ga0070684_100214963 3300005535 Bacteria 1753
53 Ga0070684_100306970 3300005535 Bacteria 1457
54 Ga0070686_101690427 3300005544 Bacteria 537
55 Ga0070695_100000284 3300005545 Bacteria 25552
56 Ga0070704_100499046 3300005549 Bacteria 1056
57 Ga0068855_100594012 3300005563 Bacteria 1194
58 Ga0068855_101048328 3300005563 Bacteria 855
59 Ga0070664_100339131 3300005564 Unclassified 1365
60 Ga0070664_100356329 3300005564 Bacteria 1332
61 Ga0068856_100068513 3300005614 Bacteria 3508
62 Ga0068856_100565401 3300005614 Bacteria 1158
63 Ga0068856_101230715 3300005614 Bacteria 765
64 Ga0068852_100923566 3300005616 Bacteria 890
65 Ga0068852_101581155 3300005616 Bacteria 678
66 Ga0068863_100556618 3300005841 Bacteria 1133
67 Ga0070717_10002696 3300006028 Bacteria 12513
68 Ga0070717_10013962 3300006028 Bacteria 6168
69 Ga0070717_10020465 3300006028 Bacteria 5205
70 Ga0070717_10056826 3300006028 Bacteria 3234
71 Ga0070717_10159300 3300006028 Bacteria 1957
72 Ga0070715_10006359 3300006163 Bacteria 4012
73 Ga0070716_100037740 3300006173 Bacteria 2671
74 Ga0070716_100059063 3300006173 Bacteria 2210
75 Ga0070712_100026752 3300006175 Bacteria 3847
76 Ga0070712_100091489 3300006175 Bacteria 2229
77 Ga0070712_100239569 3300006175 Bacteria 1445
78 Ga0068871_100866332 3300006358 Bacteria 836
79 Ga0075434_100020908 3300006871 Bacteria 6355
80 Ga0068865_100069446 3300006881 Bacteria 2493
81 Ga0105240_10005808 3300009093 Bacteria 18306
82 Ga0105240_10179150 3300009093 Bacteria 2503
83 Ga0105240_10336514 3300009093 Bacteria 1716
84 Ga0105245_10084871 3300009098 Bacteria 2902
85 Ga0105247_10195648 3300009101 Bacteria 1356
86 Ga0105241_10316454 3300009174 Bacteria 1344
87 Ga0105241_10447519 3300009174 Bacteria 1142
88 Ga0105248_10108139 3300009177 Bacteria 3136
89 Ga0105248_11126400 3300009177 Unclassified 887
90 Ga0105248_11897257 3300009177 Bacteria 676
91 Ga0105237_10031553 3300009545 Bacteria 5368
92 Ga0105238_10371944 3300009551 Bacteria 1419
93 Ga0105238_10450932 3300009551 Bacteria 1283
94 Ga0105238_11404551 3300009551 Bacteria 725
95 Ga0105238_12048153 3300009551 Bacteria 606
96 Ga0099796_10563052 3300010159 Bacteria 513
97 Ga0105246_10361210 3300011119 Bacteria 1193
98 Ga0157370_10683117 3300013104 Bacteria 937
99 Ga0157369_10164766 3300013105 Bacteria 2338
100 Ga0157369_10484879 3300013105 Bacteria 1279
101 Ga0157369_10732237 3300013105 Bacteria 1018
102 Ga0157374_10054596 3300013296 Bacteria 3727
103 Ga0157378_10981446 3300013297 Bacteria 878
104 Ga0157372_10030454 3300013307 Bacteria 5904
105 Ga0157372_10850476 3300013307 Bacteria 1059
106 Ga0157372_11300244 3300013307 Bacteria 839
107 Ga0157375_12434877 3300013308 Bacteria 625
108 Ga0157379_11053890 3300014968 Bacteria 777
109 Ga0206354_10136659 3300020081 Bacteria 940
110 Ga0206354_11554034 3300020081 Bacteria 1288
111 Ga0206353_10573216 3300020082 Bacteria 17205
112 Ga0206353_11395593 3300020082 Bacteria 667
113 Ga0207692_10065231 3300025898 Bacteria 1898
114 Ga0207710_10042635 3300025900 Bacteria 2016
115 Ga0207685_10049700 3300025905 Bacteria 1612
116 Ga0207699_10023470 3300025906 Bacteria 3357
117 Ga0207699_10053373 3300025906 Bacteria 2396
118 Ga0207699_10340643 3300025906 Unclassified 1056
119 Ga0207705_10550654 3300025909 Bacteria 897
120 Ga0207705_11243722 3300025909 Bacteria 570
121 Ga0207707_10064573 3300025912 Bacteria 3187
122 Ga0207707_10747387 3300025912 Bacteria 818
123 Ga0207695_10164474 3300025913 Bacteria 2148
124 Ga0207695_10224547 3300025913 Bacteria 1785
125 Ga0207695_10591638 3300025913 Bacteria 991
126 Ga0207671_10328556 3300025914 Bacteria 1211
127 Ga0207693_10003626 3300025915 Bacteria 13194
128 Ga0207693_10007363 3300025915 Bacteria 9052
129 Ga0207663_10002934 3300025916 Bacteria 8243
130 Ga0207663_10222794 3300025916 Bacteria 1373
131 Ga0207663_10529173 3300025916 Unclassified 919
132 Ga0207660_10244708 3300025917 Bacteria 1414
133 Ga0207660_10745396 3300025917 Bacteria 799
134 Ga0207657_10311863 3300025919 Bacteria 1245
135 Ga0207649_10756808 3300025920 Unclassified 756
136 Ga0207652_10078929 3300025921 Bacteria 2875
137 Ga0207652_10133342 3300025921 Bacteria 2217
138 Ga0207652_10318847 3300025921 Bacteria 1403
139 Ga0207652_10496296 3300025921 Bacteria 1099
140 Ga0207646_10002873 3300025922 Bacteria 19985
141 Ga0207646_10048571 3300025922 Bacteria 3804
142 Ga0207646_10639281 3300025922 Bacteria 954
143 Ga0207694_10720451 3300025924 Bacteria 842
144 Ga0207659_11438542 3300025926 Bacteria 590
145 Ga0207700_10021518 3300025928 Bacteria 4405
146 Ga0207700_10535670 3300025928 Bacteria 1038
147 Ga0207700_10825739 3300025928 Bacteria 829
148 Ga0207700_11051165 3300025928 Bacteria 728
149 Ga0207664_10011845 3300025929 Bacteria 6220
150 Ga0207664_10060060 3300025929 Bacteria 3030
151 Ga0207664_10089009 3300025929 Bacteria 2527
152 Ga0207664_10163507 3300025929 Bacteria 1900
153 Ga0207664_10187247 3300025929 Bacteria 1780
154 Ga0207644_10033702 3300025931 Bacteria 3582
155 Ga0207690_10173914 3300025932 Bacteria 1615
156 Ga0207690_10659336 3300025932 Unclassified 858
157 Ga0207704_10046702 3300025938 Bacteria 2583
158 Ga0207665_10002192 3300025939 Bacteria 13202
159 Ga0207665_10748608 3300025939 Unclassified 770
160 Ga0207711_11207469 3300025941 Bacteria 698
161 Ga0207661_10009983 3300025944 Bacteria 6822
162 Ga0207661_10140453 3300025944 Bacteria 2078
163 Ga0207661_10146191 3300025944 Bacteria 2040
164 Ga0207661_10211912 3300025944 Bacteria 1708
165 Ga0207679_10418240 3300025945 Bacteria 1182
166 Ga0207702_10062714 3300026078 Bacteria 3175
167 Ga0207702_10941586 3300026078 Bacteria 856
168 Ga0268266_11495913 3300028379 Bacteria 651
169 Ga0265319_1001860 3300028563 Bacteria 12024
170 Ga0265334_10000248 3300028573 Bacteria 30961
171 Ga0265334_10007441 3300028573 Bacteria 4698
172 Ga0265318_10000303 3300028577 Bacteria 39690
173 Ga0265322_10002134 3300028654 Bacteria 6173
174 Ga0265336_10003097 3300028666 Bacteria 6623
175 Ga0265338_10003159 3300028800 Bacteria 23517
176 Ga0265338_10007888 3300028800 Bacteria 13060
177 Ga0265338_10011006 3300028800 Bacteria 10506
178 Ga0265338_10017799 3300028800 Bacteria 7640
179 Ga0265338_10260383 3300028800 Bacteria 1275
180 Ga0265324_10017209 3300029957 Bacteria 2631
181 Ga0265324_10046679 3300029957 Bacteria 1490
182 Ga0265324_10139809 3300029957 Bacteria 822
183 Ga0265330_10000567 3300031235 Bacteria 24058
184 Ga0265330_10221589 3300031235 Unclassified 798
185 Ga0265332_10000636 3300031238 Bacteria 22880
186 Ga0265332_10095691 3300031238 Unclassified 1254
187 Ga0265328_10000722 3300031239 Bacteria 15320
188 Ga0265320_10025274 3300031240 Bacteria 3124
189 Ga0265320_10078160 3300031240 Bacteria 1548
190 Ga0265325_10000058 3300031241 Bacteria 76250
191 Ga0265329_10000705 3300031242 Bacteria 17072
192 Ga0265340_10000951 3300031247 Bacteria 16478
193 Ga0265340_10085505 3300031247 Unclassified 1480
194 Ga0265339_10001644 3300031249 Bacteria 16472
195 Ga0265331_10015054 3300031250 Bacteria 4097
196 Ga0265331_10037890 3300031250 Bacteria 2359
197 Ga0265327_10003281 3300031251 Bacteria 15672
198 Ga0265327_10060390 3300031251 Bacteria 1938
199 Ga0265327_10210521 3300031251 Unclassified 877
200 Ga0265316_10000677 3300031344 Bacteria 37948
201 Ga0265316_10461135 3300031344 Bacteria 911
202 Ga0265313_10001221 3300031595 Bacteria 24519
203 Ga0265313_10009565 3300031595 Bacteria 6275
204 Ga0265314_10006284 3300031711 Bacteria 10534
205 Ga0265314_10021181 3300031711 Bacteria 5005
206 Ga0265342_10001041 3300031712 Bacteria 27186
207 Ga0265342_10026447 3300031712 Bacteria 3636
208 Ga0265342_10401502 3300031712 Bacteria 708
209 Ga0373934_0106605 3300035086 Bacteria 1135
210 Ga0373934_0118340 3300035086 Bacteria 1077
211 Ga0373944_0060470 3300035089 Bacteria 1214
212 Ga0373956_0014163 3300035119 Bacteria 3327
213 Ga0373956_0296560 3300035119 Bacteria 770
214 Ga0373943_0004448 3300035170 Bacteria 6343
215 Ga0373955_0022590 3300035172 Bacteria 3193
216 Ga0373924_0384595 3300035410 Unclassified 627
217 Ga0373935_0006714 3300035692 Bacteria 6877
218 Ga0373927_0019257 3300035695 Bacteria 4476
219 Ga0373947_0002586 3300035725 Bacteria 10869
220 Ga0373947_0555497 3300035725 Bacteria 782
221 Ga0373947_0923178 3300035725 Bacteria 596
222 Ga0373937_0000579 3300036401 Bacteria 32471
223 Ga0373937_0079604 3300036401 Bacteria 3028
224 Ga0373925_0001980 3300037068 Bacteria 16963
225 Ga0395899_0218874 3300037312 Bacteria 1320
226 Ga0395900_1677777 3300037418 Unclassified 546
227 Ga0395898_0311989 3300037466 Bacteria 1500
228 Ga0395898_0467132 3300037466 Bacteria 1201
229 Ga0395898_0772343 3300037466 Bacteria 902
230 Ga0395905_0551548 3300037471 Bacteria 1054
231 Ga0395901_0614724 3300038443 Bacteria 1094
232 Ga0395901_0914707 3300038443 Bacteria 858
233 Ga0436360_0849851 3300039438 Bacteria 928
234 Ga0466969_0005046 3300044656 Bacteria 7025
235 Ga0466969_0036549 3300044656 Bacteria 2480
236 Ga0466972_0535513 3300044658 Bacteria 552
237 Ga0466966_0027987 3300044684 Bacteria 3673
238 Ga0466966_0070982 3300044684 Bacteria 2183
239 Ga0466966_0087993 3300044684 Bacteria 1930
240 Ga0466966_0784470 3300044684 Bacteria 574
241 Ga0466961_0001915 3300044693 Bacteria 12981
242 Ga0466961_0003128 3300044693 Bacteria 10302
243 Ga0466961_0014955 3300044693 Bacteria 4983
244 Ga0466961_0035806 3300044693 Bacteria 3187
245 Ga0466961_0090590 3300044693 Bacteria 1931
246 Ga0466961_0128602 3300044693 Bacteria 1588
247 Ga0466961_0570009 3300044693 Bacteria 681
248 Ga0466963_0000349 3300044694 Bacteria 20897
249 Ga0466963_0000783 3300044694 Bacteria 15788
250 Ga0466963_0005818 3300044694 Bacteria 7255
251 Ga0466963_0008899 3300044694 Bacteria 6024
252 Ga0466963_0011023 3300044694 Bacteria 5495
253 Ga0466963_0013068 3300044694 Bacteria 5091
254 Ga0466963_0015022 3300044694 Bacteria 4785
255 Ga0466963_0017652 3300044694 Bacteria 4449
256 Ga0466963_0022131 3300044694 Bacteria 4022
257 Ga0466963_0028350 3300044694 Bacteria 3594
258 Ga0466963_0040199 3300044694 Bacteria 3065
259 Ga0466963_0078164 3300044694 Bacteria 2236
260 Ga0466963_0140022 3300044694 Bacteria 1675
261 Ga0466963_0442937 3300044694 Bacteria 916
262 Ga0466963_0460081 3300044694 Bacteria 898
263 Ga0466963_0561423 3300044694 Bacteria 806
264 Ga0466963_0679342 3300044694 Unclassified 727
265 Ga0466963_0715853 3300044694 Unclassified 706
266 Ga0466964_0001035 3300044706 Bacteria 9261
267 Ga0466964_0028847 3300044706 Bacteria 2188
268 Ga0466964_0028967 3300044706 Bacteria 2184
269 Ga0466964_0037516 3300044706 Bacteria 1946
270 Ga0466964_0045237 3300044706 Bacteria 1791
271 Ga0466964_0113579 3300044706 Bacteria 1211
272 Ga0466964_0164179 3300044706 Bacteria 1040
273 Ga0466964_0175733 3300044706 Bacteria 1012
274 Ga0466964_0304297 3300044706 Bacteria 805
275 Ga0466971_0001513 3300044719 Bacteria 9798
276 Ga0466971_0004106 3300044719 Bacteria 6270
277 Ga0466971_0021048 3300044719 Bacteria 2900
278 Ga0466971_0073329 3300044719 Bacteria 1556
279 Ga0466971_0148689 3300044719 Bacteria 1093
280 Ga0466971_0485597 3300044719 Bacteria 608
281 Ga0466968_0001052 3300044735 Bacteria 9782
282 Ga0466968_0013537 3300044735 Bacteria 3208
283 Ga0466968_0016300 3300044735 Bacteria 2957
284 Ga0466968_0027002 3300044735 Bacteria 2360
285 Ga0466968_0049989 3300044735 Bacteria 1782
286 Ga0466968_0137873 3300044735 Bacteria 1114
287 Ga0466970_0004014 3300044765 Bacteria 7222
288 Ga0466970_0018705 3300044765 Bacteria 3590
289 Ga0466970_0111248 3300044765 Bacteria 1496
290 Ga0466957_0003260 3300044842 Bacteria 8886
291 Ga0466957_0006011 3300044842 Bacteria 6847
292 Ga0466957_0006647 3300044842 Bacteria 6538
293 Ga0466957_0034034 3300044842 Bacteria 3057
294 Ga0466957_0116092 3300044842 Bacteria 1702
295 Ga0466957_0159484 3300044842 Bacteria 1464
296 Ga0466957_0186228 3300044842 Bacteria 1358
297 Ga0466957_0203031 3300044842 Bacteria 1303
298 Ga0466960_0014522 3300044901 Bacteria 3374
299 Ga0466960_0076213 3300044901 Bacteria 1680
300 Ga0466960_0201278 3300044901 Bacteria 1088
301 Ga0466959_0010199 3300045049 Bacteria 6707
302 Ga0466959_0013696 3300045049 Bacteria 5886
303 Ga0466959_0023456 3300045049 Bacteria 4565
304 Ga0466959_0049975 3300045049 Bacteria 3071
305 Ga0466959_0061348 3300045049 Bacteria 2734
306 Ga0466959_0357763 3300045049 Bacteria 995
307 Ga0466958_0001185 3300045836 Bacteria 12156
308 Ga0466958_0008147 3300045836 Bacteria 5802
309 Ga0466958_0008369 3300045836 Bacteria 5734
310 Ga0466958_0032865 3300045836 Bacteria 3088
311 Ga0466958_0057893 3300045836 Bacteria 2355
312 Ga0466958_0090501 3300045836 Bacteria 1893
313 Ga0466958_0126809 3300045836 Bacteria 1600
314 Ga0466958_0128267 3300045836 Bacteria 1591
315 Ga0466958_0240368 3300045836 Bacteria 1157
316 Ga0466958_0478312 3300045836 Bacteria 807
317 Ga0466958_0489307 3300045836 Bacteria 798
318 Ga0466967_0000955 3300045976 Bacteria 15638
319 Ga0466967_0002334 3300045976 Bacteria 11735
320 Ga0466967_0002378 3300045976 Bacteria 11653
321 Ga0466967_0014152 3300045976 Bacteria 6199
322 Ga0466967_0014497 3300045976 Bacteria 6143
323 Ga0466967_0015661 3300045976 Bacteria 5952
324 Ga0466967_0018632 3300045976 Bacteria 5555
325 Ga0466967_0028004 3300045976 Bacteria 4696
326 Ga0466967_0030694 3300045976 Bacteria 4512
327 Ga0466967_0033979 3300045976 Bacteria 4322
328 Ga0466967_0037874 3300045976 Bacteria 4131
329 Ga0466967_0045069 3300045976 Bacteria 3830
330 Ga0466967_0054866 3300045976 Bacteria 3509
331 Ga0466967_0055619 3300045976 Bacteria 3486
332 Ga0466967_0063292 3300045976 Bacteria 3286
333 Ga0466967_0085777 3300045976 Bacteria 2851
334 Ga0466967_0173223 3300045976 Bacteria 2031
335 Ga0466967_0197243 3300045976 Bacteria 1905
336 Ga0466967_0218241 3300045976 Bacteria 1811
337 Ga0466967_0263571 3300045976 Bacteria 1649
338 Ga0466967_0374414 3300045976 Bacteria 1382
339 Ga0466967_0433094 3300045976 Bacteria 1283
340 Ga0466967_0466226 3300045976 Unclassified 1236
341 Ga0466967_0571154 3300045976 Bacteria 1114
342 Ga0466967_0800908 3300045976 Unclassified 935
343 Ga0466967_0832839 3300045976 Bacteria 916
344 Ga0466967_1864922 3300045976 Bacteria 598
345 Ga0466967_2329956 3300045976 Bacteria 531
346 Ga0495592_0000048 3300046454 Bacteria 114599
347 Ga0495592_0006691 3300046454 Bacteria 8595
348 Ga0495592_0044514 3300046454 Bacteria 3315
349 Ga0495592_0129205 3300046454 Bacteria 1769
350 Ga0495592_0457875 3300046454 Unclassified 798
351 Ga0495592_0882765 3300046454 Bacteria 526
352 Ga0495603_0848540 3300046455 Unclassified 520
353 Ga0495629_0002856 3300046459 Bacteria 13193
354 Ga0495629_0029895 3300046459 Bacteria 3862
355 Ga0495629_0038581 3300046459 Bacteria 3363
356 Ga0495629_0046777 3300046459 Bacteria 3035
357 Ga0495629_0133293 3300046459 Unclassified 1730
358 Ga0495641_0004677 3300046461 Bacteria 9549
359 Ga0495641_0019706 3300046461 Bacteria 3442
360 Ga0495641_0029314 3300046461 Bacteria 2653
361 Ga0495651_0000049 3300046462 Bacteria 88249
362 Ga0495651_0092944 3300046462 Bacteria 2259
363 Ga0495651_0234919 3300046462 Bacteria 1260
364 Ga0495653_0006883 3300046463 Bacteria 9344
365 Ga0495653_0087175 3300046463 Bacteria 2293
366 Ga0495653_0169893 3300046463 Unclassified 1506
367 Ga0495653_0293918 3300046463 Unclassified 1061
368 Ga0495653_0460912 3300046463 Bacteria 798
369 Ga0495580_0014821 3300046472 Bacteria 5908
370 Ga0495582_0003822 3300046473 Bacteria 8474
371 Ga0495639_0014953 3300046475 Bacteria 3363
372 Ga0495639_0347325 3300046475 Bacteria 745
373 Ga0495662_0010626 3300046476 Bacteria 4502
374 Ga0495662_0092874 3300046476 Bacteria 1472
375 Ga0495664_0023993 3300046477 Bacteria 3541
376 Ga0495584_0035330 3300046491 Bacteria 2527
377 Ga0495594_0270384 3300046499 Bacteria 968
378 Ga0495607_0027910 3300046501 Bacteria 3485
379 Ga0495608_0000437 3300046511 Bacteria 29080
380 Ga0495608_0033782 3300046511 Bacteria 3454
381 Ga0495618_0000786 3300046514 Bacteria 22158
382 Ga0495618_0014303 3300046514 Bacteria 4832
383 Ga0495618_0258201 3300046514 Bacteria 1092
384 Ga0495628_0000026 3300046516 Bacteria 127398
385 Ga0495628_0007363 3300046516 Bacteria 9524
386 Ga0495628_0023025 3300046516 Bacteria 5113
387 Ga0495628_0093433 3300046516 Bacteria 2326
388 Ga0495630_0002938 3300046517 Bacteria 11846
389 Ga0495630_0011557 3300046517 Bacteria 6392
390 Ga0495630_0092257 3300046517 Bacteria 2289
391 Ga0495630_0276955 3300046517 Unclassified 1282
392 Ga0495644_0009680 3300046523 Bacteria 3711
393 Ga0495666_0000682 3300046526 Bacteria 15403
394 Ga0495666_0283664 3300046526 Bacteria 751
395 Ga0495652_0000172 3300046529 Bacteria 74042
396 Ga0495652_0014665 3300046529 Bacteria 7027
397 Ga0495652_0043819 3300046529 Bacteria 3854
398 Ga0495652_0045769 3300046529 Bacteria 3759
399 Ga0495652_0406338 3300046529 Unclassified 963
400 Ga0495665_0004924 3300046531 Bacteria 7198
401 Ga0495640_0213934 3300046533 Bacteria 1217
402 Ga0495640_0218724 3300046533 Bacteria 1202
403 Ga0495640_0341349 3300046533 Bacteria 925
404 Ga0495586_0019114 3300046535 Bacteria 3645
405 Ga0495586_0025016 3300046535 Bacteria 3194
406 Ga0495586_0041780 3300046535 Bacteria 2469
407 Ga0495587_0000080 3300046536 Bacteria 75321
408 Ga0495587_0020329 3300046536 Bacteria 4099
409 Ga0495587_0023466 3300046536 Bacteria 3790
410 Ga0495587_0031279 3300046536 Bacteria 3223
411 Ga0495587_0248555 3300046536 Bacteria 1000
412 Ga0495645_0000016 3300046543 Bacteria 158415
413 Ga0495645_0017741 3300046543 Bacteria 5103
414 Ga0495645_0075402 3300046543 Bacteria 2427
415 Ga0495645_0140341 3300046543 Bacteria 1686
416 Ga0495667_0053180 3300046559 Bacteria 2667
417 Ga0495667_0123659 3300046559 Unclassified 1670
418 Ga0495667_0195951 3300046559 Bacteria 1294
419 Ga0495667_0820459 3300046559 Unclassified 573
420 Ga0495634_0025457 3300046642 Bacteria 4138
421 Ga0495634_0200073 3300046642 Bacteria 1241
422 Ga0495611_0044216 3300046648 Bacteria 1992
423 Ga0495635_0011367 3300046663 Bacteria 6243
424 Ga0495635_0041263 3300046663 Bacteria 3188
425 Ga0495635_0533853 3300046663 Unclassified 770
426 Ga0495588_0527777 3300046674 Bacteria 619
427 Ga0495657_0007726 3300046675 Bacteria 8271
428 Ga0495657_0114969 3300046675 Bacteria 1700
429 Ga0495657_0155194 3300046675 Bacteria 1419
430 Ga0495657_0546373 3300046675 Bacteria 673
431 Ga0495657_0660894 3300046675 Unclassified 602
432 Ga0495599_0000016 3300046678 Bacteria 169605
433 Ga0495599_0029086 3300046678 Bacteria 3463
434 Ga0495599_0034140 3300046678 Bacteria 3196
435 Ga0495623_0000046 3300046679 Bacteria 74571
436 Ga0495623_0036790 3300046679 Bacteria 3136
437 Ga0495623_0175437 3300046679 Bacteria 1249
438 Ga0495646_0000201 3300046680 Bacteria 29539
439 Ga0495646_0066618 3300046680 Bacteria 2129
440 Ga0495646_0129383 3300046680 Bacteria 1422
441 Ga0495647_0000668 3300046681 Bacteria 10201
442 Ga0495647_0205205 3300046681 Bacteria 865
443 Ga0495658_0003346 3300046683 Bacteria 7949
444 Ga0495658_0120384 3300046683 Bacteria 1587
445 Ga0495658_0230798 3300046683 Bacteria 1160
446 Ga0495613_0001879 3300046689 Bacteria 15954
447 Ga0495613_0007585 3300046689 Bacteria 8067
448 Ga0495613_0022457 3300046689 Bacteria 4700
449 Ga0495613_0328368 3300046689 Bacteria 1055
450 Ga0495624_0007965 3300046690 Bacteria 7428
451 Ga0495624_0126175 3300046690 Bacteria 1570
452 Ga0495624_0173680 3300046690 Bacteria 1314
453 Ga0495670_0080406 3300046691 Bacteria 1660
454 Ga0495600_0021080 3300046809 Bacteria 4171
455 Ga0495600_0073738 3300046809 Bacteria 2229
456 Ga0495600_0264457 3300046809 Unclassified 1092
457 Ga0495600_0612896 3300046809 Bacteria 660
458 Ga0495581_0006386 3300047315 Bacteria 6839
459 Ga0495581_0013882 3300047315 Bacteria 4669
460 Ga0495581_0278786 3300047315 Unclassified 977
461 Ga0495604_0000004 3300047317 Bacteria 456385
462 Ga0495604_0046700 3300047317 Bacteria 3377
463 Ga0495604_0106931 3300047317 Unclassified 2046
464 Ga0495674_0038743 3300047319 Bacteria 4276
465 Ga0495674_0201369 3300047319 Bacteria 1651
466 Ga0495674_0284101 3300047319 Bacteria 1355
467 Ga0495674_0303988 3300047319 Bacteria 1302
468 Ga0495676_0050538 3300047321 Bacteria 3333
469 Ga0495676_0081325 3300047321 Bacteria 2456
470 Ga0495676_0474533 3300047321 Unclassified 823
471 Ga0495680_0007775 3300047322 Bacteria 9790
472 Ga0495680_0013120 3300047322 Bacteria 7241
473 Ga0495680_0029370 3300047322 Bacteria 4502
474 Ga0495680_0034179 3300047322 Bacteria 4110
475 Ga0495680_0324409 3300047322 Bacteria 1077
476 Ga0495675_0000033 3300047444 Bacteria 98338
477 Ga0495675_0215701 3300047444 Bacteria 1163
478 Ga0495679_045869 3300047446 Bacteria 1333
479 Ga0495684_0072823 3300047471 Bacteria 2610
480 Ga0495684_0152275 3300047471 Bacteria 1728
481 Ga0495684_0266575 3300047471 Unclassified 1240
482 Ga0495684_0535349 3300047471 Bacteria 800
483 Ga0495593_0003259 3300047673 Bacteria 9732
484 Ga0495593_0222515 3300047673 Bacteria 947
485 Ga0495602_0000036 3300048088 Bacteria 133584
486 Ga0495602_0027322 3300048088 Bacteria 5485
487 Ga0495602_0362840 3300048088 Bacteria 1042
488 Ga0495614_0001811 3300048089 Bacteria 9359
489 Ga0496100_0005620 3300048903 Bacteria 6773
490 Ga0496100_0038291 3300048903 Bacteria 3038
491 Ga0496100_0665569 3300048903 Bacteria 811
492 Ga0496100_1273167 3300048903 Bacteria 580
493 Ga0496101_0016550 3300048904 Bacteria 4986
494 Ga0496101_0056424 3300048904 Bacteria 2839
495 Ga0496101_0166772 3300048904 Bacteria 1691
496 Ga0496101_0767593 3300048904 Bacteria 761
497 Ga0496101_0805865 3300048904 Bacteria 740
498 Ga0496102_0139776 3300048905 Bacteria 2270
499 Ga0496102_0144389 3300048905 Bacteria 2233
500 Ga0496103_0046732 3300048906 Bacteria 2674
501 Ga0496103_0166960 3300048906 Bacteria 1412
502 Ga0496104_0002459 3300048907 Bacteria 15959
503 Ga0496104_0011438 3300048907 Bacteria 7950
504 Ga0496104_0143618 3300048907 Bacteria 2292
505 Ga0496104_1204574 3300048907 Unclassified 660
506 Ga0496105_0003845 3300048908 Bacteria 11209
507 Ga0496105_0022429 3300048908 Bacteria 5113
508 Ga0496105_0044904 3300048908 Bacteria 3645
509 Ga0496105_0190169 3300048908 Bacteria 1679
510 Ga0496106_0046176 3300048909 Bacteria 3273
511 Ga0496106_0210481 3300048909 Bacteria 1549
512 Ga0496107_0065944 3300048910 Bacteria 2624
513 Ga0496107_0337993 3300048910 Bacteria 1120
514 Ga0496108_0002186 3300048911 Bacteria 15692
515 Ga0496108_0147551 3300048911 Bacteria 2028
516 Ga0496108_0255946 3300048911 Bacteria 1523
517 Ga0496108_0415853 3300048911 Bacteria 1174
518 Ga0496109_0000864 3300048912 Bacteria 25268
519 Ga0496109_0005050 3300048912 Bacteria 11027
520 Ga0496109_0144198 3300048912 Bacteria 2227
521 Ga0496109_0314080 3300048912 Bacteria 1478
522 Ga0496109_0332106 3300048912 Unclassified 1435
523 Ga0496110_0104947 3300048913 Bacteria 2535
524 Ga0496110_1564410 3300048913 Bacteria 569
525 Ga0496111_0063668 3300048914 Bacteria 2674
526 Ga0496111_0257848 3300048914 Bacteria 1294
527 Ga0496112_0049488 3300048915 Bacteria 4121
528 Ga0496112_0233283 3300048915 Bacteria 1794
529 Ga0496113_0008933 3300048916 Bacteria 6559
530 Ga0496113_0032852 3300048916 Bacteria 3773
531 Ga0496113_0790984 3300048916 Bacteria 754
532 Ga0496113_0830298 3300048916 Unclassified 733
533 Ga0496114_0007407 3300048917 Bacteria 8672
534 Ga0496114_0020962 3300048917 Bacteria 5309
535 Ga0496114_0158664 3300048917 Bacteria 1965
536 Ga0496114_0187042 3300048917 Bacteria 1810
537 Ga0496114_0206240 3300048917 Unclassified 1723
538 Ga0496115_0021607 3300048918 Bacteria 4973
539 Ga0496115_0032214 3300048918 Bacteria 4135
540 Ga0496115_0781623 3300048918 Bacteria 744
541 Ga0496115_0941748 3300048918 Bacteria 663
542 Ga0501031_0790594 3300049568 Bacteria 608
543 Ga0501034_0012564 3300049571 Bacteria 8741
544 Ga0501046_0471114 3300049580 Unclassified 902
545 Ga0501069_0389113 3300049585 Bacteria 824
546 Ga0501070_0008234 3300049586 Bacteria 8814
547 Ga0501070_0308480 3300049586 Bacteria 1288
548 Ga0501070_0903625 3300049586 Unclassified 689
549 Ga0501072_0009384 3300049588 Bacteria 7442
550 Ga0501073_0007319 3300049589 Bacteria 8215
551 Ga0501073_0372384 3300049589 Bacteria 986
552 Ga0501074_0004290 3300049590 Bacteria 10180
553 Ga0501074_0022238 3300049590 Bacteria 4608
554 Ga0501079_0058007 3300049741 Bacteria 2987
555 Ga0501079_0297567 3300049741 Bacteria 1262
556 Ga0501080_0027448 3300049742 Bacteria 5293
557 Ga0501083_0161697 3300049744 Unclassified 1465
558 nmdc:mga08y16_47319_c1 3300050511 Bacteria 1638
559 nmdc:mga0n895_2154_c1 3300050512 Bacteria 15207
560 nmdc:mga0rr50_684518_c1 3300050513 Bacteria 875
561 nmdc:mga08x19_880202_c1 3300050514 Bacteria 636
562 Ga0495601_0117085 3300053077 Bacteria 1728
563 Ga0495601_0143765 3300053077 Bacteria 1556
564 Ga0495601_0177768 3300053077 Bacteria 1391
565 Ga0495601_0370957 3300053077 Unclassified 929
566 Ga0495612_0001139 3300053078 Bacteria 10902
567 Ga0495612_0052224 3300053078 Bacteria 1681
568 Ga0495612_0179471 3300053078 Bacteria 929
569 Ga0495595_0012182 3300053084 Bacteria 3610
570 Ga0495595_0097454 3300053084 Bacteria 1416
571 Ga0495595_0338777 3300053084 Bacteria 758
572 Ga0495595_0583850 3300053084 Unclassified 571
573 Ga0495619_0001661 3300053085 Bacteria 14689
574 Ga0495619_0001883 3300053085 Bacteria 13971
575 Ga0495619_0019829 3300053085 Bacteria 4279
576 Ga0495619_0062225 3300053085 Bacteria 2484
577 Ga0495619_0141338 3300053085 Unclassified 1658
578 Ga0495619_0201003 3300053085 Bacteria 1379
579 Ga0495619_0251927 3300053085 Bacteria 1223
580 Ga0495619_0270653 3300053085 Unclassified 1177
581 Ga0500566_0107576 3300053094 Bacteria 1520
582 Ga0501084_0341512 3300054114 Bacteria 1265
583 Ga0466962_0001080 3300061719 Bacteria 12520
584 Ga0466962_0004094 3300061719 Bacteria 6984
585 Ga0466962_0005484 3300061719 Bacteria 6099
586 Ga0466962_0031140 3300061719 Bacteria 2554
587 Ga0466962_0060704 3300061719 Bacteria 1805
588 Ga0466962_0074278 3300061719 Bacteria 1625
589 Ga0466962_0151543 3300061719 Bacteria 1125
590 Ga0265326_10085246
591 Ga0070658_10066008
592 Ga0070658_10892405
593 Ga0070683_100000945
594 Ga0070683_100145628
595 Ga0070690_101392606
596 Ga0070680_100276374
597 Ga0070680_100611244
598 Ga0070680_100698926
599 Ga0068868_101722300
600 Ga0070660_100155157
601 Ga0070660_100421188
602 Ga0070692_10173649
603 Ga0070675_100326199
604 Ga0070659_100765839
605 Ga0070659_101248150
606 Ga0070709_10004248
607 Ga0070709_10305075
608 Ga0070709_10320879
609 Ga0070714_100008225
610 Ga0070714_100020749
611 Ga0070714_100063746
612 Ga0070714_100279209
613 Ga0070714_100664894
614 Ga0070714_101489954
615 Ga0070713_100024528
616 Ga0070713_100048019
617 Ga0070713_100285424
618 Ga0070710_10002692
619 Ga0070710_10094607
620 Ga0070710_11061544
621 Ga0070711_100027561
622 Ga0070711_100174044
623 Ga0070711_101376763
624 Ga0070694_100559023
625 Ga0070681_10161555
626 Ga0070681_10172634
627 Ga0070681_10338809
628 Ga0070681_11121632
629 Ga0070707_100000130
630 Ga0070707_100759836
631 Ga0070698_100098295
632 Ga0070698_100190694
633 Ga0070699_100675747
634 Ga0070699_100761345
635 Ga0070679_100059955
636 Ga0070679_100060031
637 Ga0070679_100100561
638 Ga0070679_100612323
639 Ga0070684_100011308
640 Ga0070684_100081002
641 Ga0070684_100214963
642 Ga0070684_100306970
643 Ga0070686_101690427
644 Ga0070695_100000284
645 Ga0070704_100499046
646 Ga0068855_100594012
647 Ga0068855_101048328
648 Ga0070664_100339131
649 Ga0070664_100356329
650 Ga0068856_100068513
651 Ga0068856_100565401
652 Ga0068856_101230715
653 Ga0068852_100923566
654 Ga0068852_101581155
655 Ga0068863_100556618
656 Ga0070717_10002696
657 Ga0070717_10013962
658 Ga0070717_10020465
659 Ga0070717_10056826
660 Ga0070717_10159300
661 Ga0070715_10006359
662 Ga0070716_100037740
663 Ga0070716_100059063
664 Ga0070712_100026752
665 Ga0070712_100091489
666 Ga0070712_100239569
667 Ga0068871_100866332
668 Ga0075434_100020908
669 Ga0068865_100069446
670 Ga0105240_10005808
671 Ga0105240_10179150
672 Ga0105240_10336514
673 Ga0105245_10084871
674 Ga0105247_10195648
675 Ga0105241_10316454
676 Ga0105241_10447519
677 Ga0105248_10108139
678 Ga0105248_11126400
679 Ga0105248_11897257
680 Ga0105237_10031553
681 Ga0105238_10371944
682 Ga0105238_10450932
683 Ga0105238_11404551
684 Ga0105238_12048153
685 Ga0099796_10563052
686 Ga0105246_10361210
687 Ga0157370_10683117
688 Ga0157369_10164766
689 Ga0157369_10484879
690 Ga0157369_10732237
691 Ga0157374_10054596
692 Ga0157378_10981446
693 Ga0157372_10030454
694 Ga0157372_10850476
695 Ga0157372_11300244
696 Ga0157375_12434877
697 Ga0157379_11053890
698 Ga0206354_10136659
699 Ga0206354_11554034
700 Ga0206353_10573216
701 Ga0206353_11395593
702 Ga0207692_10065231
703 Ga0207710_10042635
704 Ga0207685_10049700
705 Ga0207699_10023470
706 Ga0207699_10053373
707 Ga0207699_10340643
708 Ga0207705_10550654
709 Ga0207705_11243722
710 Ga0207707_10064573
711 Ga0207707_10747387
712 Ga0207695_10164474
713 Ga0207695_10224547
714 Ga0207695_10591638
715 Ga0207671_10328556
716 Ga0207693_10003626
717 Ga0207693_10007363
718 Ga0207663_10002934
719 Ga0207663_10222794
720 Ga0207663_10529173
721 Ga0207660_10244708
722 Ga0207660_10745396
723 Ga0207657_10311863
724 Ga0207649_10756808
725 Ga0207652_10078929
726 Ga0207652_10133342
727 Ga0207652_10318847
728 Ga0207652_10496296
729 Ga0207646_10002873
730 Ga0207646_10048571
731 Ga0207646_10639281
732 Ga0207694_10720451
733 Ga0207659_11438542
734 Ga0207700_10021518
735 Ga0207700_10535670
736 Ga0207700_10825739
737 Ga0207700_11051165
738 Ga0207664_10011845
739 Ga0207664_10060060
740 Ga0207664_10089009
741 Ga0207664_10163507
742 Ga0207664_10187247
743 Ga0207644_10033702
744 Ga0207690_10173914
745 Ga0207690_10659336
746 Ga0207704_10046702
747 Ga0207665_10002192
748 Ga0207665_10748608
749 Ga0207711_11207469
750 Ga0207661_10009983
751 Ga0207661_10140453
752 Ga0207661_10146191
753 Ga0207661_10211912
754 Ga0207679_10418240
755 Ga0207702_10062714
756 Ga0207702_10941586
757 Ga0268266_11495913
758 Ga0265319_1001860
759 Ga0265334_10000248
760 Ga0265334_10007441
761 Ga0265318_10000303
762 Ga0265322_10002134
763 Ga0265336_10003097
764 Ga0265338_10003159
765 Ga0265338_10007888
766 Ga0265338_10011006
767 Ga0265338_10017799
768 Ga0265338_10260383
769 Ga0265324_10017209
770 Ga0265324_10046679
771 Ga0265324_10139809
772 Ga0265330_10000567
773 Ga0265330_10221589
774 Ga0265332_10000636
775 Ga0265332_10095691
776 Ga0265328_10000722
777 Ga0265320_10025274
778 Ga0265320_10078160
779 Ga0265325_10000058
780 Ga0265329_10000705
781 Ga0265340_10000951
782 Ga0265340_10085505
783 Ga0265339_10001644
784 Ga0265331_10015054
785 Ga0265331_10037890
786 Ga0265327_10003281
787 Ga0265327_10060390
788 Ga0265327_10210521
789 Ga0265316_10000677
790 Ga0265316_10461135
791 Ga0265313_10001221
792 Ga0265313_10009565
793 Ga0265314_10006284
794 Ga0265314_10021181
795 Ga0265342_10001041
796 Ga0265342_10026447
797 Ga0265342_10401502
798 Ga0373934_0106605
799 Ga0373934_0118340
800 Ga0373944_0060470
801 Ga0373956_0014163
802 Ga0373956_0296560
803 Ga0373943_0004448
804 Ga0373955_0022590
805 Ga0373924_0384595
806 Ga0373935_0006714
807 Ga0373927_0019257
808 Ga0373947_0002586
809 Ga0373947_0555497
810 Ga0373947_0923178
811 Ga0373937_0000579
812 Ga0373937_0079604
813 Ga0373925_0001980
814 Ga0395899_0218874
815 Ga0395900_1677777
816 Ga0395898_0311989
817 Ga0395898_0467132
818 Ga0395898_0772343
819 Ga0395905_0551548
820 Ga0395901_0614724
821 Ga0395901_0914707
822 Ga0436360_0849851
823 Ga0466969_0005046
824 Ga0466969_0036549
825 Ga0466972_0535513
826 Ga0466966_0027987
827 Ga0466966_0070982
828 Ga0466966_0087993
829 Ga0466966_0784470
830 Ga0466961_0001915
831 Ga0466961_0003128
832 Ga0466961_0014955
833 Ga0466961_0035806
834 Ga0466961_0090590
835 Ga0466961_0128602
836 Ga0466961_0570009
837 Ga0466963_0000349
838 Ga0466963_0000783
839 Ga0466963_0005818
840 Ga0466963_0008899
841 Ga0466963_0011023
842 Ga0466963_0013068
843 Ga0466963_0015022
844 Ga0466963_0017652
845 Ga0466963_0022131
846 Ga0466963_0028350
847 Ga0466963_0040199
848 Ga0466963_0078164
849 Ga0466963_0140022
850 Ga0466963_0442937
851 Ga0466963_0460081
852 Ga0466963_0561423
853 Ga0466963_0679342
854 Ga0466963_0715853
855 Ga0466964_0001035
856 Ga0466964_0028847
857 Ga0466964_0028967
858 Ga0466964_0037516
859 Ga0466964_0045237
860 Ga0466964_0113579
861 Ga0466964_0164179
862 Ga0466964_0175733
863 Ga0466964_0304297
864 Ga0466971_0001513
865 Ga0466971_0004106
866 Ga0466971_0021048
867 Ga0466971_0073329
868 Ga0466971_0148689
869 Ga0466971_0485597
870 Ga0466968_0001052
871 Ga0466968_0013537
872 Ga0466968_0016300
873 Ga0466968_0027002
874 Ga0466968_0049989
875 Ga0466968_0137873
876 Ga0466970_0004014
877 Ga0466970_0018705
878 Ga0466970_0111248
879 Ga0466957_0003260
880 Ga0466957_0006011
881 Ga0466957_0006647
882 Ga0466957_0034034
883 Ga0466957_0116092
884 Ga0466957_0159484
885 Ga0466957_0186228
886 Ga0466957_0203031
887 Ga0466960_0014522
888 Ga0466960_0076213
889 Ga0466960_0201278
890 Ga0466959_0010199
891 Ga0466959_0013696
892 Ga0466959_0023456
893 Ga0466959_0049975
894 Ga0466959_0061348
895 Ga0466959_0357763
896 Ga0466958_0001185
897 Ga0466958_0008147
898 Ga0466958_0008369
899 Ga0466958_0032865
900 Ga0466958_0057893
901 Ga0466958_0090501
902 Ga0466958_0126809
903 Ga0466958_0128267
904 Ga0466958_0240368
905 Ga0466958_0478312
906 Ga0466958_0489307
907 Ga0466967_0000955
908 Ga0466967_0002334
909 Ga0466967_0002378
910 Ga0466967_0014152
911 Ga0466967_0014497
912 Ga0466967_0015661
913 Ga0466967_0018632
914 Ga0466967_0028004
915 Ga0466967_0030694
916 Ga0466967_0033979
917 Ga0466967_0037874
918 Ga0466967_0045069
919 Ga0466967_0054866
920 Ga0466967_0055619
921 Ga0466967_0063292
922 Ga0466967_0085777
923 Ga0466967_0173223
924 Ga0466967_0197243
925 Ga0466967_0218241
926 Ga0466967_0263571
927 Ga0466967_0374414
928 Ga0466967_0433094
929 Ga0466967_0466226
930 Ga0466967_0571154
931 Ga0466967_0800908
932 Ga0466967_0832839
933 Ga0466967_1864922
934 Ga0466967_2329956
935 Ga0495592_0000048
936 Ga0495592_0006691
937 Ga0495592_0044514
938 Ga0495592_0129205
939 Ga0495592_0457875
940 Ga0495592_0882765
941 Ga0495603_0848540
942 Ga0495629_0002856
943 Ga0495629_0029895
944 Ga0495629_0038581
945 Ga0495629_0046777
946 Ga0495629_0133293
947 Ga0495641_0004677
948 Ga0495641_0019706
949 Ga0495641_0029314
950 Ga0495651_0000049
951 Ga0495651_0092944
952 Ga0495651_0234919
953 Ga0495653_0006883
954 Ga0495653_0087175
955 Ga0495653_0169893
956 Ga0495653_0293918
957 Ga0495653_0460912
958 Ga0495580_0014821
959 Ga0495582_0003822
960 Ga0495639_0014953
961 Ga0495639_0347325
962 Ga0495662_0010626
963 Ga0495662_0092874
964 Ga0495664_0023993
965 Ga0495584_0035330
966 Ga0495594_0270384
967 Ga0495607_0027910
968 Ga0495608_0000437
969 Ga0495608_0033782
970 Ga0495618_0000786
971 Ga0495618_0014303
972 Ga0495618_0258201
973 Ga0495628_0000026
974 Ga0495628_0007363
975 Ga0495628_0023025
976 Ga0495628_0093433
977 Ga0495630_0002938
978 Ga0495630_0011557
979 Ga0495630_0092257
980 Ga0495630_0276955
981 Ga0495644_0009680
982 Ga0495666_0000682
983 Ga0495666_0283664
984 Ga0495652_0000172
985 Ga0495652_0014665
986 Ga0495652_0043819
987 Ga0495652_0045769
988 Ga0495652_0406338
989 Ga0495665_0004924
990 Ga0495640_0213934
991 Ga0495640_0218724
992 Ga0495640_0341349
993 Ga0495586_0019114
994 Ga0495586_0025016
995 Ga0495586_0041780
996 Ga0495587_0000080
997 Ga0495587_0020329
998 Ga0495587_0023466
999 Ga0495587_0031279
1000 Ga0495587_0248555
1001 Ga0495645_0000016
1002 Ga0495645_0017741
1003 Ga0495645_0075402
1004 Ga0495645_0140341
1005 Ga0495667_0053180
1006 Ga0495667_0123659
1007 Ga0495667_0195951
1008 Ga0495667_0820459
1009 Ga0495634_0025457
1010 Ga0495634_0200073
1011 Ga0495611_0044216
1012 Ga0495635_0011367
1013 Ga0495635_0041263
1014 Ga0495635_0533853
1015 Ga0495588_0527777
1016 Ga0495657_0007726
1017 Ga0495657_0114969
1018 Ga0495657_0155194
1019 Ga0495657_0546373
1020 Ga0495657_0660894
1021 Ga0495599_0000016
1022 Ga0495599_0029086
1023 Ga0495599_0034140
1024 Ga0495623_0000046
1025 Ga0495623_0036790
1026 Ga0495623_0175437
1027 Ga0495646_0000201
1028 Ga0495646_0066618
1029 Ga0495646_0129383
1030 Ga0495647_0000668
1031 Ga0495647_0205205
1032 Ga0495658_0003346
1033 Ga0495658_0120384
1034 Ga0495658_0230798
1035 Ga0495613_0001879
1036 Ga0495613_0007585
1037 Ga0495613_0022457
1038 Ga0495613_0328368
1039 Ga0495624_0007965
1040 Ga0495624_0126175
1041 Ga0495624_0173680
1042 Ga0495670_0080406
1043 Ga0495600_0021080
1044 Ga0495600_0073738
1045 Ga0495600_0264457
1046 Ga0495600_0612896
1047 Ga0495581_0006386
1048 Ga0495581_0013882
1049 Ga0495581_0278786
1050 Ga0495604_0000004
1051 Ga0495604_0046700
1052 Ga0495604_0106931
1053 Ga0495674_0038743
1054 Ga0495674_0201369
1055 Ga0495674_0284101
1056 Ga0495674_0303988
1057 Ga0495676_0050538
1058 Ga0495676_0081325
1059 Ga0495676_0474533
1060 Ga0495680_0007775
1061 Ga0495680_0013120
1062 Ga0495680_0029370
1063 Ga0495680_0034179
1064 Ga0495680_0324409
1065 Ga0495675_0000033
1066 Ga0495675_0215701
1067 Ga0495679_045869
1068 Ga0495684_0072823
1069 Ga0495684_0152275
1070 Ga0495684_0266575
1071 Ga0495684_0535349
1072 Ga0495593_0003259
1073 Ga0495593_0222515
1074 Ga0495602_0000036
1075 Ga0495602_0027322
1076 Ga0495602_0362840
1077 Ga0495614_0001811
1078 Ga0496100_0005620
1079 Ga0496100_0038291
1080 Ga0496100_0665569
1081 Ga0496100_1273167
1082 Ga0496101_0016550
1083 Ga0496101_0056424
1084 Ga0496101_0166772
1085 Ga0496101_0767593
1086 Ga0496101_0805865
1087 Ga0496102_0139776
1088 Ga0496102_0144389
1089 Ga0496103_0046732
1090 Ga0496103_0166960
1091 Ga0496104_0002459
1092 Ga0496104_0011438
1093 Ga0496104_0143618
1094 Ga0496104_1204574
1095 Ga0496105_0003845
1096 Ga0496105_0022429
1097 Ga0496105_0044904
1098 Ga0496105_0190169
1099 Ga0496106_0046176
1100 Ga0496106_0210481
1101 Ga0496107_0065944
1102 Ga0496107_0337993
1103 Ga0496108_0002186
1104 Ga0496108_0147551
1105 Ga0496108_0255946
1106 Ga0496108_0415853
1107 Ga0496109_0000864
1108 Ga0496109_0005050
1109 Ga0496109_0144198
1110 Ga0496109_0314080
1111 Ga0496109_0332106
1112 Ga0496110_0104947
1113 Ga0496110_1564410
1114 Ga0496111_0063668
1115 Ga0496111_0257848
1116 Ga0496112_0049488
1117 Ga0496112_0233283
1118 Ga0496113_0008933
1119 Ga0496113_0032852
1120 Ga0496113_0790984
1121 Ga0496113_0830298
1122 Ga0496114_0007407
1123 Ga0496114_0020962
1124 Ga0496114_0158664
1125 Ga0496114_0187042
1126 Ga0496114_0206240
1127 Ga0496115_0021607
1128 Ga0496115_0032214
1129 Ga0496115_0781623
1130 Ga0496115_0941748
1131 Ga0501031_0790594
1132 Ga0501034_0012564
1133 Ga0501046_0471114
1134 Ga0501069_0389113
1135 Ga0501070_0008234
1136 Ga0501070_0308480
1137 Ga0501070_0903625
1138 Ga0501072_0009384
1139 Ga0501073_0007319
1140 Ga0501073_0372384
1141 Ga0501074_0004290
1142 Ga0501074_0022238
1143 Ga0501079_0058007
1144 Ga0501079_0297567
1145 Ga0501080_0027448
1146 Ga0501083_0161697
1147 nmdc:mga08y16_47319_c1
1148 nmdc:mga0n895_2154_c1
1149 nmdc:mga0rr50_684518_c1
1150 nmdc:mga08x19_880202_c1
1151 Ga0495601_0117085
1152 Ga0495601_0143765
1153 Ga0495601_0177768
1154 Ga0495601_0370957
1155 Ga0495612_0001139
1156 Ga0495612_0052224
1157 Ga0495612_0179471
1158 Ga0495595_0012182
1159 Ga0495595_0097454
1160 Ga0495595_0338777
1161 Ga0495595_0583850
1162 Ga0495619_0001661
1163 Ga0495619_0001883
1164 Ga0495619_0019829
1165 Ga0495619_0062225
1166 Ga0495619_0141338
1167 Ga0495619_0201003
1168 Ga0495619_0251927
1169 Ga0495619_0270653
1170 Ga0500566_0107576
1171 Ga0501084_0341512
1172 Ga0466962_0001080
1173 Ga0466962_0004094
1174 Ga0466962_0005484
1175 Ga0466962_0031140
1176 Ga0466962_0060704
1177 Ga0466962_0074278
1178 Ga0466962_0151543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05991

NYN_YacP

YacP-like NYN domain

24

158

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mq9-assembly2.cif.gz_B crystal structure of rae1 (yacp) from bacillus subtilis (w164l mutant) 0.7187 6 111
5mq9-assembly1.cif.gz_A crystal structure of rae1 (yacp) from bacillus subtilis (w164l mutant) 0.6875 6 111
6tbk-assembly8.cif.gz_H structure of a beta galactosidase with inhibitor 0.678 5 45
4rou-assembly3.cif.gz_B auto-inhibition mechanism of human mitochondrial rnase p protein complex 0.6778 2 83
6tbf-assembly1.cif.gz_A structure of a beta galactosidase with inhibitor 0.6769 5 45
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.6941 1 106 3.40.50.1010
af_O62245_1_207_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.6905 4 91 3.40.50.1010
af_B0UXL7_2_187_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.6357 3 89 3.40.50.1010
af_I1KNP9_112_278_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.6328 8 140 3.40.50.1010
af_Q59002_1_190_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6275 6 84 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7V9IAD6-F1-model_v4 NYN domain-containing protein 0.7915 6 111
AF-A0A538I3V7-F1-model_v4 NYN domain-containing protein 0.7857 2 144
AF-A0A538FZV7-F1-model_v4 NYN domain-containing protein 0.7829 2 112
AF-A0A538I3V7-F1-model_v4 NYN domain-containing protein 0.775 2 144
AF-A0A538DLQ5-F1-model_v4 NYN domain-containing protein 0.7734 1 141

Map