F466856

General Info

Members Datasets Scaffolds Average Seq Length
589 285 1178 235

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10707698|Ga0105249_107076982
Length 262
Sequence VSAASEPATAPAVLELDRLTVRYGGVTAVRELSVEVRGGEIVGLIGPNGAGKSTTLHAIMGAVPVEDGDVRLSGRSVRGRAPEAIARSGVALVPEGRRIFAELTVEENLRLGLSGRRSREGAEEAVEEVYDLFPVVREFGRRQAGALSGGQQQQLAIGRALVAGPDLLLLDEPSLGLAPRIVDVVFDALAQIRRRGITVLLVEQRAQRTVAFADRTYLMANGEVASRSRTAWAVRRPASWRVSRHARGSVRTPKTADRLRTA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
279 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
280 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
281 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
282 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
283 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
284 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
285 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 1.36
Rhizoplane 10.53
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10707698 3300009553 Bacteria 1068
2 JGI25406J46586_10005629 3300003203 Bacteria 5798
3 JGI25165J46597_1000020 3300003214 Bacteria 370477
4 Ga0070658_10051336 3300005327 Bacteria 3342
5 Ga0070683_100066478 3300005329 Bacteria 3358
6 Ga0070683_100142312 3300005329 Bacteria 2272
7 Ga0070683_100145952 3300005329 Bacteria 2242
8 Ga0070683_100191154 3300005329 Bacteria 1943
9 Ga0070683_100851920 3300005329 Bacteria 874
10 Ga0070670_100456640 3300005331 Bacteria 1133
11 Ga0070680_100013449 3300005336 Bacteria 6374
12 Ga0070680_100159353 3300005336 Bacteria 1896
13 Ga0070680_100405278 3300005336 Bacteria 1163
14 Ga0070682_100020112 3300005337 Bacteria 3924
15 Ga0070682_100044924 3300005337 Bacteria 2736
16 Ga0070682_100347294 3300005337 Bacteria 1105
17 Ga0068868_100485422 3300005338 Bacteria 1080
18 Ga0070660_100457365 3300005339 Bacteria 1059
19 Ga0070689_100420941 3300005340 Bacteria 1132
20 Ga0070661_100189858 3300005344 Bacteria 1567
21 Ga0070661_100417032 3300005344 Bacteria 1064
22 Ga0070671_100155149 3300005355 Bacteria 1934
23 Ga0070671_100278337 3300005355 Bacteria 1423
24 Ga0070674_100062151 3300005356 Bacteria 2609
25 Ga0070674_100126186 3300005356 Bacteria 1901
26 Ga0070659_100029859 3300005366 Bacteria 4215
27 Ga0070659_100068073 3300005366 Bacteria 2824
28 Ga0070709_10011697 3300005434 Bacteria 4900
29 Ga0070709_10039618 3300005434 Bacteria 2892
30 Ga0070714_100015294 3300005435 Bacteria 6173
31 Ga0070714_100033226 3300005435 Bacteria 4312
32 Ga0070714_100046287 3300005435 Bacteria 3690
33 Ga0070714_100309715 3300005435 Bacteria 1474
34 Ga0070713_100013329 3300005436 Bacteria 6067
35 Ga0070713_100664749 3300005436 Bacteria 993
36 Ga0070710_10011548 3300005437 Bacteria 4366
37 Ga0070711_100075992 3300005439 Bacteria 2380
38 Ga0070711_100350041 3300005439 Bacteria 1188
39 Ga0070705_100142892 3300005440 Bacteria 1577
40 Ga0070700_100366715 3300005441 Bacteria 1073
41 Ga0070708_100311814 3300005445 Bacteria 1482
42 Ga0070708_100410553 3300005445 Bacteria 1277
43 Ga0070663_100234884 3300005455 Bacteria 1445
44 Ga0070678_100098413 3300005456 Bacteria 2261
45 Ga0070681_10004844 3300005458 Bacteria 12903
46 Ga0070681_10008276 3300005458 Bacteria 10182
47 Ga0070681_10063813 3300005458 Bacteria 3656
48 Ga0070681_10077807 3300005458 Bacteria 3274
49 Ga0068867_100669477 3300005459 Bacteria 913
50 Ga0070685_10017372 3300005466 Bacteria 3850
51 Ga0070706_100037610 3300005467 Bacteria 4469
52 Ga0070707_100006284 3300005468 Bacteria 11050
53 Ga0070707_100038254 3300005468 Bacteria 4581
54 Ga0070707_100687317 3300005468 Bacteria 986
55 Ga0070698_100070736 3300005471 Bacteria 3500
56 Ga0070698_100138695 3300005471 Bacteria 2385
57 Ga0070699_100053688 3300005518 Bacteria 3488
58 Ga0070679_100095560 3300005530 Bacteria 2959
59 Ga0070679_100120328 3300005530 Bacteria 2610
60 Ga0070684_100110476 3300005535 Bacteria 2465
61 Ga0070684_100286271 3300005535 Bacteria 1510
62 Ga0070684_100609756 3300005535 Bacteria 1015
63 Ga0070672_100347049 3300005543 Bacteria 1265
64 Ga0070695_100003825 3300005545 Bacteria 8781
65 Ga0070693_100127036 3300005547 Bacteria 1589
66 Ga0070665_100250231 3300005548 Bacteria 1773
67 Ga0070704_100014855 3300005549 Bacteria 4873
68 Ga0068855_100212765 3300005563 Bacteria 2171
69 Ga0068855_100244002 3300005563 Bacteria 2006
70 Ga0068855_100687564 3300005563 Bacteria 1096
71 Ga0070664_100109499 3300005564 Bacteria 2409
72 Ga0070664_100143673 3300005564 Bacteria 2103
73 Ga0070664_100252202 3300005564 Bacteria 1586
74 Ga0070664_100480622 3300005564 Bacteria 1143
75 Ga0068857_100093854 3300005577 Bacteria 2687
76 Ga0068854_100078102 3300005578 Bacteria 2438
77 Ga0068856_100003371 3300005614 Bacteria 16176
78 Ga0068856_100120042 3300005614 Bacteria 2631
79 Ga0068856_100147829 3300005614 Bacteria 2357
80 Ga0070702_100346363 3300005615 Bacteria 1045
81 Ga0068852_100344612 3300005616 Bacteria 1453
82 Ga0068864_100899953 3300005618 Bacteria 874
83 Ga0068866_10055249 3300005718 Bacteria 2038
84 Ga0068870_10087154 3300005840 Bacteria 1738
85 Ga0068860_100071131 3300005843 Bacteria 3307
86 Ga0068860_100167995 3300005843 Bacteria 2118
87 Ga0068860_100549322 3300005843 Bacteria 1157
88 Ga0081455_10020423 3300005937 Bacteria 6237
89 Ga0081538_10038887 3300005981 Bacteria 3059
90 Ga0081539_10000288 3300005985 Bacteria 113905
91 Ga0070717_10017472 3300006028 Bacteria 5582
92 Ga0070717_10041661 3300006028 Bacteria 3743
93 Ga0070717_10071119 3300006028 Bacteria 2901
94 Ga0070717_10186924 3300006028 Bacteria 1809
95 Ga0075365_10034751 3300006038 Bacteria 3257
96 Ga0075365_10172015 3300006038 Bacteria 1512
97 Ga0075365_10441618 3300006038 Bacteria 919
98 Ga0075364_10129881 3300006051 Bacteria 1690
99 Ga0075364_10265981 3300006051 Bacteria 1166
100 Ga0070715_10002907 3300006163 Bacteria 5344
101 Ga0070716_100018225 3300006173 Bacteria 3653
102 Ga0070716_100046987 3300006173 Bacteria 2433
103 Ga0070712_100017760 3300006175 Bacteria 4608
104 Ga0070712_100020338 3300006175 Bacteria 4344
105 Ga0070712_100261281 3300006175 Bacteria 1387
106 Ga0097621_100012081 3300006237 Bacteria 6391
107 Ga0097621_100157418 3300006237 Bacteria 1950
108 Ga0068871_100013798 3300006358 Bacteria 6006
109 Ga0068871_100771077 3300006358 Bacteria 885
110 Ga0075434_100032199 3300006871 Bacteria 5169
111 Ga0075436_100024693 3300006914 Bacteria 4132
112 Ga0075436_100031849 3300006914 Bacteria 3633
113 Ga0075436_100224293 3300006914 Bacteria 1334
114 Ga0097620_100168157 3300006931 Bacteria 2273
115 Ga0075435_100220398 3300007076 Bacteria 1611
116 Ga0105240_10032220 3300009093 Bacteria 6788
117 Ga0105240_10512096 3300009093 Bacteria 1333
118 Ga0105245_10064332 3300009098 Bacteria 3314
119 Ga0105245_10303161 3300009098 Bacteria 1568
120 Ga0105245_10444849 3300009098 Bacteria 1303
121 Ga0105247_10049603 3300009101 Bacteria 2581
122 Ga0105243_10016623 3300009148 Bacteria 5565
123 Ga0105241_10011364 3300009174 Bacteria 6527
124 Ga0105242_10015122 3300009176 Bacteria 5990
125 Ga0105242_10017818 3300009176 Bacteria 5542
126 Ga0105242_10376789 3300009176 Bacteria 1318
127 Ga0105242_10669783 3300009176 Bacteria 1011
128 Ga0105248_10421451 3300009177 Bacteria 1503
129 Ga0105248_10436482 3300009177 Bacteria 1475
130 Ga0105237_10026808 3300009545 Bacteria 5889
131 Ga0105238_10077066 3300009551 Bacteria 3326
132 Ga0105249_10336538 3300009553 Bacteria 1525
133 Ga0105239_10064774 3300010375 Bacteria 4013
134 Ga0105239_10778151 3300010375 Bacteria 1096
135 Ga0105246_10012799 3300011119 Bacteria 5245
136 Ga0105246_10132289 3300011119 Bacteria 1865
137 Ga0105246_10138737 3300011119 Bacteria 1825
138 Ga0105246_10145182 3300011119 Bacteria 1789
139 Ga0157369_10049222 3300013105 Bacteria 4570
140 Ga0157369_10819606 3300013105 Bacteria 956
141 Ga0157374_10047242 3300013296 Bacteria 3991
142 Ga0157374_10876806 3300013296 Bacteria 915
143 Ga0157378_10015965 3300013297 Bacteria 6577
144 Ga0157378_10588061 3300013297 Bacteria 1123
145 Ga0157372_10017920 3300013307 Bacteria 7610
146 Ga0157372_10184504 3300013307 Bacteria 2416
147 Ga0157372_10450272 3300013307 Bacteria 1500
148 Ga0157375_10159309 3300013308 Bacteria 2398
149 Ga0157375_10327278 3300013308 Bacteria 1697
150 Ga0163163_10926546 3300014325 Bacteria 935
151 Ga0157380_10031894 3300014326 Bacteria 4047
152 Ga0157379_10020818 3300014968 Bacteria 5805
153 Ga0157379_10178033 3300014968 Bacteria 1921
154 Ga0157379_10225629 3300014968 Bacteria 1698
155 Ga0157376_10003286 3300014969 Bacteria 11129
156 Ga0157376_10010143 3300014969 Bacteria 6878
157 Ga0157376_10150827 3300014969 Bacteria 2096
158 Ga0213871_10009099 3300021441 Bacteria 2213
159 Ga0209233_1000047 3300025261 Bacteria 459614
160 Ga0207692_10010323 3300025898 Bacteria 3931
161 Ga0207688_10305107 3300025901 Bacteria 974
162 Ga0207685_10016858 3300025905 Bacteria 2347
163 Ga0207699_10048701 3300025906 Bacteria 2490
164 Ga0207643_10056830 3300025908 Bacteria 2226
165 Ga0207643_10329208 3300025908 Bacteria 955
166 Ga0207705_10602750 3300025909 Bacteria 854
167 Ga0207684_10098639 3300025910 Bacteria 2495
168 Ga0207654_10040756 3300025911 Bacteria 2618
169 Ga0207654_10154603 3300025911 Bacteria 1476
170 Ga0207707_10385574 3300025912 Bacteria 1204
171 Ga0207707_10638219 3300025912 Bacteria 898
172 Ga0207695_10551730 3300025913 Bacteria 1034
173 Ga0207671_10519010 3300025914 Bacteria 950
174 Ga0207693_10000818 3300025915 Bacteria 27776
175 Ga0207693_10008617 3300025915 Bacteria 8347
176 Ga0207663_10091098 3300025916 Bacteria 2023
177 Ga0207660_10023172 3300025917 Bacteria 4191
178 Ga0207660_10203961 3300025917 Bacteria 1545
179 Ga0207660_10476525 3300025917 Bacteria 1011
180 Ga0207662_10528817 3300025918 Bacteria 815
181 Ga0207652_10098672 3300025921 Bacteria 2576
182 Ga0207652_10186132 3300025921 Bacteria 1867
183 Ga0207646_10003389 3300025922 Bacteria 18004
184 Ga0207646_10594287 3300025922 Bacteria 994
185 Ga0207650_10406519 3300025925 Bacteria 1128
186 Ga0207659_10212611 3300025926 Bacteria 1551
187 Ga0207687_10200621 3300025927 Bacteria 1559
188 Ga0207687_10736799 3300025927 Bacteria 838
189 Ga0207700_10018613 3300025928 Bacteria 4674
190 Ga0207700_10100122 3300025928 Bacteria 2309
191 Ga0207700_10658261 3300025928 Bacteria 934
192 Ga0207664_10006143 3300025929 Bacteria 8234
193 Ga0207664_10007134 3300025929 Bacteria 7747
194 Ga0207664_10008819 3300025929 Bacteria 7053
195 Ga0207664_10036124 3300025929 Bacteria 3817
196 Ga0207664_10119608 3300025929 Bacteria 2202
197 Ga0207664_10199802 3300025929 Bacteria 1725
198 Ga0207686_10017712 3300025934 Bacteria 4018
199 Ga0207686_10024720 3300025934 Bacteria 3484
200 Ga0207686_10032296 3300025934 Bacteria 3115
201 Ga0207686_10180395 3300025934 Bacteria 1497
202 Ga0207709_10358068 3300025935 Bacteria 1104
203 Ga0207669_10196577 3300025937 Bacteria 1460
204 Ga0207704_10070519 3300025938 Bacteria 2213
205 Ga0207665_10003767 3300025939 Bacteria 10128
206 Ga0207665_10088985 3300025939 Bacteria 2137
207 Ga0207691_10065970 3300025940 Bacteria 3275
208 Ga0207691_10494565 3300025940 Bacteria 1039
209 Ga0207711_10691453 3300025941 Bacteria 951
210 Ga0207661_10000903 3300025944 Bacteria 19452
211 Ga0207661_10031097 3300025944 Bacteria 4119
212 Ga0207661_10080274 3300025944 Bacteria 2691
213 Ga0207679_10175490 3300025945 Bacteria 1768
214 Ga0207651_10126862 3300025960 Bacteria 1946
215 Ga0207677_10761812 3300026023 Bacteria 864
216 Ga0207708_10018841 3300026075 Bacteria 5199
217 Ga0207648_10042113 3300026089 Bacteria 4009
218 Ga0207674_10021350 3300026116 Bacteria 6975
219 Ga0207683_10000244 3300026121 Bacteria 48306
220 Ga0207683_10020966 3300026121 Bacteria 5594
221 Ga0207683_10507707 3300026121 Bacteria 1114
222 Ga0207683_10747737 3300026121 Bacteria 907
223 Ga0207698_10093431 3300026142 Bacteria 2469
224 Ga0268266_10342368 3300028379 Bacteria 1404
225 Ga0268264_10241511 3300028381 Bacteria 1673
226 Ga0268264_10470739 3300028381 Bacteria 1221
227 Ga0265326_10038811 3300028558 Bacteria 1353
228 Ga0265319_1001131 3300028563 Bacteria 16576
229 Ga0265319_1003410 3300028563 Bacteria 8300
230 Ga0265319_1012716 3300028563 Bacteria 3387
231 Ga0265334_10000679 3300028573 Bacteria 17043
232 Ga0265318_10001580 3300028577 Bacteria 13181
233 Ga0265318_10157193 3300028577 Bacteria 834
234 Ga0265322_10006107 3300028654 Bacteria 3549
235 Ga0265322_10018353 3300028654 Bacteria 2011
236 Ga0265336_10009197 3300028666 Bacteria 3426
237 Ga0265338_10005145 3300028800 Bacteria 17221
238 Ga0265338_10022691 3300028800 Bacteria 6482
239 Ga0265338_10068766 3300028800 Bacteria 3048
240 Ga0265324_10017690 3300029957 Bacteria 2592
241 Ga0265330_10003515 3300031235 Bacteria 8164
242 Ga0265332_10004470 3300031238 Bacteria 6554
243 Ga0265328_10003815 3300031239 Bacteria 6624
244 Ga0265320_10003022 3300031240 Bacteria 11460
245 Ga0265320_10140255 3300031240 Bacteria 1095
246 Ga0265325_10007381 3300031241 Bacteria 6582
247 Ga0265329_10005179 3300031242 Bacteria 5303
248 Ga0265340_10017158 3300031247 Bacteria 3744
249 Ga0265339_10004787 3300031249 Bacteria 9165
250 Ga0265339_10086963 3300031249 Bacteria 1643
251 Ga0265331_10014887 3300031250 Bacteria 4125
252 Ga0265327_10021997 3300031251 Bacteria 3829
253 Ga0265327_10045002 3300031251 Bacteria 2348
254 Ga0265316_10017157 3300031344 Bacteria 6265
255 Ga0265316_10038639 3300031344 Bacteria 3842
256 Ga0265313_10007506 3300031595 Bacteria 7427
257 Ga0265314_10022143 3300031711 Bacteria 4871
258 Ga0265314_10023325 3300031711 Bacteria 4719
259 Ga0265314_10050670 3300031711 Bacteria 2896
260 Ga0265314_10128540 3300031711 Bacteria 1584
261 Ga0265342_10004174 3300031712 Bacteria 11498
262 Ga0265342_10006365 3300031712 Bacteria 8803
263 Ga0373926_0016182 3300035083 Bacteria 2549
264 Ga0373952_0038615 3300035092 Bacteria 1094
265 Ga0373923_0201087 3300035111 Bacteria 921
266 Ga0373945_0052004 3300035116 Bacteria 1508
267 Ga0373956_0152938 3300035119 Bacteria 1086
268 Ga0373943_0003602 3300035170 Bacteria 7049
269 Ga0373924_0132891 3300035410 Bacteria 1083
270 Ga0373935_0047112 3300035692 Bacteria 2725
271 Ga0373935_0069748 3300035692 Bacteria 2265
272 Ga0373933_0063662 3300035724 Bacteria 2230
273 Ga0373937_0001027 3300036401 Bacteria 23612
274 Ga0373937_0207177 3300036401 Bacteria 1844
275 Ga0373937_0374023 3300036401 Bacteria 1351
276 Ga0373925_0322841 3300037068 Bacteria 1249
277 Ga0395900_0211778 3300037418 Bacteria 1957
278 Ga0395900_0582883 3300037418 Bacteria 1060
279 Ga0395898_0024071 3300037466 Bacteria 6146
280 Ga0395898_0445408 3300037466 Bacteria 1234
281 Ga0395905_0511057 3300037471 Bacteria 1102
282 Ga0395905_0950571 3300037471 Bacteria 762
283 Ga0395901_0043481 3300038443 Bacteria 4660
284 Ga0436360_0989015 3300039438 Bacteria 14852
285 Ga0450920_003578 3300042122 Bacteria 2703
286 Ga0450906_006388 3300042145 Bacteria 2381
287 Ga0466969_0011062 3300044656 Bacteria 4778
288 Ga0466969_0101838 3300044656 Bacteria 1351
289 Ga0466965_0018905 3300044683 Bacteria 3307
290 Ga0466965_0061642 3300044683 Bacteria 1875
291 Ga0466966_0009037 3300044684 Bacteria 6602
292 Ga0466966_0087654 3300044684 Bacteria 1934
293 Ga0466966_0609149 3300044684 Bacteria 657
294 Ga0466961_0007831 3300044693 Bacteria 6802
295 Ga0466961_0009303 3300044693 Bacteria 6256
296 Ga0466963_0000333 3300044694 Bacteria 21482
297 Ga0466963_0002587 3300044694 Bacteria 10153
298 Ga0466963_0006101 3300044694 Bacteria 7107
299 Ga0466963_0010354 3300044694 Bacteria 5644
300 Ga0466963_0011554 3300044694 Bacteria 5376
301 Ga0466963_0017023 3300044694 Bacteria 4527
302 Ga0466963_0030241 3300044694 Bacteria 3493
303 Ga0466963_0032397 3300044694 Bacteria 3384
304 Ga0466963_0039521 3300044694 Bacteria 3089
305 Ga0466963_0121440 3300044694 Bacteria 1798
306 Ga0466963_0223554 3300044694 Bacteria 1319
307 Ga0466964_0015536 3300044706 Bacteria 2899
308 Ga0466964_0020166 3300044706 Bacteria 2565
309 Ga0466964_0075216 3300044706 Bacteria 1437
310 Ga0466964_0083026 3300044706 Bacteria 1379
311 Ga0466964_0120208 3300044706 Bacteria 1183
312 Ga0466964_0235667 3300044706 Bacteria 895
313 Ga0466971_0000446 3300044719 Bacteria 16156
314 Ga0466971_0004771 3300044719 Bacteria 5864
315 Ga0466971_0006466 3300044719 Bacteria 5091
316 Ga0466971_0011623 3300044719 Bacteria 3854
317 Ga0466971_0012207 3300044719 Bacteria 3763
318 Ga0466971_0051569 3300044719 Bacteria 1852
319 Ga0466968_0006794 3300044735 Bacteria 4327
320 Ga0466968_0011247 3300044735 Bacteria 3485
321 Ga0466968_0110616 3300044735 Bacteria 1235
322 Ga0466970_0173893 3300044765 Bacteria 1194
323 Ga0466957_0002093 3300044842 Bacteria 10677
324 Ga0466957_0002407 3300044842 Bacteria 10043
325 Ga0466957_0011232 3300044842 Bacteria 5158
326 Ga0466957_0021209 3300044842 Bacteria 3827
327 Ga0466957_0051591 3300044842 Bacteria 2504
328 Ga0466957_0085178 3300044842 Bacteria 1974
329 Ga0466957_0105625 3300044842 Bacteria 1780
330 Ga0466957_0219402 3300044842 Bacteria 1255
331 Ga0466957_0699571 3300044842 Bacteria 715
332 Ga0466960_0014853 3300044901 Bacteria 3345
333 Ga0466959_0019196 3300045049 Bacteria 5026
334 Ga0466959_0030275 3300045049 Bacteria 4008
335 Ga0466959_0052875 3300045049 Bacteria 2973
336 Ga0466959_0074538 3300045049 Bacteria 2454
337 Ga0466958_0001168 3300045836 Bacteria 12216
338 Ga0466958_0003504 3300045836 Bacteria 8151
339 Ga0466958_0004245 3300045836 Bacteria 7538
340 Ga0466958_0004419 3300045836 Bacteria 7423
341 Ga0466958_0011883 3300045836 Bacteria 4916
342 Ga0466958_0016262 3300045836 Bacteria 4280
343 Ga0466958_0017532 3300045836 Bacteria 4142
344 Ga0466958_0127130 3300045836 Bacteria 1598
345 Ga0466967_0000297 3300045976 Bacteria 22234
346 Ga0466967_0005024 3300045976 Bacteria 9066
347 Ga0466967_0019140 3300045976 Bacteria 5498
348 Ga0466967_0054027 3300045976 Bacteria 3533
349 Ga0466967_0076633 3300045976 Bacteria 3008
350 Ga0466967_0081917 3300045976 Bacteria 2915
351 Ga0466967_0099205 3300045976 Bacteria 2660
352 Ga0466967_0117318 3300045976 Bacteria 2453
353 Ga0466967_0560955 3300045976 Bacteria 1124
354 Ga0466967_0689434 3300045976 Bacteria 1011
355 Ga0466967_1376460 3300045976 Bacteria 703
356 Ga0495592_0011160 3300046454 Bacteria 6784
357 Ga0495592_0028377 3300046454 Bacteria 4239
358 Ga0495592_0029922 3300046454 Bacteria 4119
359 Ga0495592_0035034 3300046454 Bacteria 3783
360 Ga0495592_0340983 3300046454 Bacteria 963
361 Ga0495603_0268363 3300046455 Bacteria 982
362 Ga0495629_0057504 3300046459 Bacteria 2719
363 Ga0495629_0144504 3300046459 Bacteria 1655
364 Ga0495629_0270969 3300046459 Bacteria 1166
365 Ga0495629_0298738 3300046459 Bacteria 1103
366 Ga0495629_0407239 3300046459 Bacteria 924
367 Ga0495651_0011359 3300046462 Bacteria 6843
368 Ga0495651_0150887 3300046462 Bacteria 1675
369 Ga0495653_0011485 3300046463 Bacteria 7236
370 Ga0495653_0018387 3300046463 Bacteria 5678
371 Ga0495653_0086383 3300046463 Bacteria 2305
372 Ga0495653_0164672 3300046463 Bacteria 1536
373 Ga0495653_0384199 3300046463 Bacteria 896
374 Ga0495580_0127560 3300046472 Bacteria 1766
375 Ga0495582_0025768 3300046473 Bacteria 3221
376 Ga0495582_0215748 3300046473 Bacteria 1097
377 Ga0495662_0048496 3300046476 Bacteria 2050
378 Ga0495664_0029948 3300046477 Bacteria 3186
379 Ga0495664_0036078 3300046477 Bacteria 2913
380 Ga0495664_0056251 3300046477 Bacteria 2340
381 Ga0495664_0084738 3300046477 Bacteria 1902
382 Ga0495594_0160452 3300046499 Bacteria 1278
383 Ga0495608_0002831 3300046511 Bacteria 12429
384 Ga0495608_0023014 3300046511 Bacteria 4272
385 Ga0495608_0164315 3300046511 Bacteria 1410
386 Ga0495608_0371733 3300046511 Bacteria 877
387 Ga0495618_0011658 3300046514 Bacteria 5333
388 Ga0495618_0044065 3300046514 Bacteria 2814
389 Ga0495618_0212302 3300046514 Bacteria 1223
390 Ga0495628_0079207 3300046516 Bacteria 2554
391 Ga0495630_0079325 3300046517 Bacteria 2476
392 Ga0495631_0062149 3300046518 Bacteria 1619
393 Ga0495644_0078384 3300046523 Bacteria 1245
394 Ga0495644_0120444 3300046523 Bacteria 998
395 Ga0495666_0011855 3300046526 Bacteria 4348
396 Ga0495652_0000187 3300046529 Bacteria 70410
397 Ga0495652_0084780 3300046529 Bacteria 2605
398 Ga0495652_0102638 3300046529 Bacteria 2316
399 Ga0495652_0144436 3300046529 Bacteria 1867
400 Ga0495652_0158283 3300046529 Bacteria 1761
401 Ga0495665_0070986 3300046531 Bacteria 1834
402 Ga0495640_0018982 3300046533 Bacteria 5085
403 Ga0495640_0053648 3300046533 Bacteria 2763
404 Ga0495640_0106137 3300046533 Bacteria 1840
405 Ga0495586_0044790 3300046535 Bacteria 2383
406 Ga0495586_0300540 3300046535 Bacteria 920
407 Ga0495587_0006018 3300046536 Bacteria 7907
408 Ga0495587_0048583 3300046536 Bacteria 2512
409 Ga0495645_0003018 3300046543 Bacteria 11385
410 Ga0495645_0012459 3300046543 Bacteria 5992
411 Ga0495645_0225891 3300046543 Bacteria 1256
412 Ga0495667_0009311 3300046559 Bacteria 6656
413 Ga0495667_0024762 3300046559 Bacteria 4042
414 Ga0495634_0155432 3300046642 Bacteria 1444
415 Ga0495634_0193375 3300046642 Bacteria 1267
416 Ga0495635_0040119 3300046663 Bacteria 3236
417 Ga0495635_0049872 3300046663 Bacteria 2885
418 Ga0495635_0143030 3300046663 Bacteria 1629
419 Ga0495588_0116321 3300046674 Bacteria 1409
420 Ga0495588_0213134 3300046674 Bacteria 1020
421 Ga0495657_0048890 3300046675 Bacteria 2852
422 Ga0495599_0000196 3300046678 Bacteria 40261
423 Ga0495599_0028185 3300046678 Bacteria 3519
424 Ga0495599_0036200 3300046678 Bacteria 3098
425 Ga0495599_0324555 3300046678 Bacteria 926
426 Ga0495623_0000045 3300046679 Bacteria 76108
427 Ga0495623_0022977 3300046679 Bacteria 4026
428 Ga0495646_0000489 3300046680 Bacteria 21129
429 Ga0495646_0106108 3300046680 Bacteria 1604
430 Ga0495658_0166199 3300046683 Bacteria 1363
431 Ga0495613_0005875 3300046689 Bacteria 9185
432 Ga0495613_0262914 3300046689 Bacteria 1202
433 Ga0495624_0035503 3300046690 Bacteria 3219
434 Ga0495589_0026133 3300046794 Bacteria 2960
435 Ga0495589_0109028 3300046794 Bacteria 1337
436 Ga0495600_0014173 3300046809 Bacteria 5022
437 Ga0495600_0170458 3300046809 Bacteria 1405
438 Ga0495581_0199398 3300047315 Bacteria 1171
439 Ga0495604_0000221 3300047317 Bacteria 52090
440 Ga0495604_0029270 3300047317 Bacteria 4381
441 Ga0495604_0492228 3300047317 Bacteria 796
442 Ga0495674_0098948 3300047319 Bacteria 2483
443 Ga0495674_0140418 3300047319 Bacteria 2031
444 Ga0495674_0153138 3300047319 Bacteria 1932
445 Ga0495674_0198050 3300047319 Bacteria 1667
446 Ga0495676_0047688 3300047321 Bacteria 3460
447 Ga0495680_0006615 3300047322 Bacteria 10749
448 Ga0495680_0031451 3300047322 Bacteria 4320
449 Ga0495680_0081409 3300047322 Bacteria 2444
450 Ga0495680_0110533 3300047322 Bacteria 2037
451 Ga0495680_0185852 3300047322 Bacteria 1497
452 Ga0495675_0000301 3300047444 Bacteria 35499
453 Ga0495684_0003566 3300047471 Bacteria 12147
454 Ga0495684_0069065 3300047471 Bacteria 2686
455 Ga0495602_0000515 3300048088 Bacteria 36065
456 Ga0495602_0122357 3300048088 Bacteria 2091
457 Ga0495614_0002862 3300048089 Bacteria 7673
458 Ga0496100_0006416 3300048903 Bacteria 6409
459 Ga0496100_0025081 3300048903 Bacteria 3643
460 Ga0496100_0303552 3300048903 Bacteria 1195
461 Ga0496101_0006449 3300048904 Bacteria 7549
462 Ga0496102_0020359 3300048905 Bacteria 5863
463 Ga0496102_0036207 3300048905 Bacteria 4445
464 Ga0496102_0051477 3300048905 Bacteria 3752
465 Ga0496103_0012623 3300048906 Bacteria 5011
466 Ga0496103_0031239 3300048906 Bacteria 3244
467 Ga0496103_0131982 3300048906 Bacteria 1595
468 Ga0496104_0011272 3300048907 Bacteria 8002
469 Ga0496104_0013441 3300048907 Bacteria 7377
470 Ga0496104_0353416 3300048907 Bacteria 1382
471 Ga0496105_0008808 3300048908 Bacteria 7857
472 Ga0496105_0019849 3300048908 Bacteria 5422
473 Ga0496105_0073144 3300048908 Bacteria 2832
474 Ga0496105_0143635 3300048908 Bacteria 1963
475 Ga0496105_0151924 3300048908 Bacteria 1903
476 Ga0496105_0347970 3300048908 Bacteria 1184
477 Ga0496106_0066164 3300048909 Bacteria 2752
478 Ga0496106_0191662 3300048909 Bacteria 1625
479 Ga0496106_0192652 3300048909 Bacteria 1621
480 Ga0496108_0027598 3300048911 Bacteria 4691
481 Ga0496108_0072695 3300048911 Bacteria 2903
482 Ga0496108_0126970 3300048911 Bacteria 2190
483 Ga0496108_0191634 3300048911 Bacteria 1772
484 Ga0496108_0382580 3300048911 Bacteria 1229
485 Ga0496109_0003943 3300048912 Bacteria 12398
486 Ga0496109_0018128 3300048912 Bacteria 6182
487 Ga0496109_0043794 3300048912 Bacteria 4058
488 Ga0496109_0102352 3300048912 Bacteria 2658
489 Ga0496109_0163682 3300048912 Bacteria 2084
490 Ga0496109_0256996 3300048912 Bacteria 1645
491 Ga0496109_0281688 3300048912 Bacteria 1567
492 Ga0496109_0291095 3300048912 Bacteria 1540
493 Ga0496109_0321686 3300048912 Bacteria 1460
494 Ga0496109_0498388 3300048912 Bacteria 1150
495 Ga0496110_0003644 3300048913 Bacteria 11849
496 Ga0496110_0030595 3300048913 Bacteria 4641
497 Ga0496110_0060364 3300048913 Bacteria 3344
498 Ga0496110_0313219 3300048913 Bacteria 1429
499 Ga0496111_0006372 3300048914 Bacteria 7659
500 Ga0496111_0032136 3300048914 Bacteria 3742
501 Ga0496111_0090430 3300048914 Bacteria 2242
502 Ga0496111_0187727 3300048914 Bacteria 1537
503 Ga0496112_0009540 3300048915 Bacteria 8754
504 Ga0496112_0034969 3300048915 Bacteria 4890
505 Ga0496112_0132126 3300048915 Bacteria 2467
506 Ga0496112_0657391 3300048915 Bacteria 977
507 Ga0496113_0014117 3300048916 Bacteria 5438
508 Ga0496113_0056964 3300048916 Bacteria 2935
509 Ga0496113_0064547 3300048916 Bacteria 2769
510 Ga0496113_0068754 3300048916 Bacteria 2688
511 Ga0496113_0203534 3300048916 Bacteria 1574
512 Ga0496114_0069425 3300048917 Bacteria 2959
513 Ga0496114_0204961 3300048917 Bacteria 1728
514 Ga0496114_0243444 3300048917 Bacteria 1582
515 Ga0496114_0253645 3300048917 Bacteria 1548
516 Ga0496115_0004119 3300048918 Bacteria 10495
517 Ga0496115_0009199 3300048918 Bacteria 7334
518 Ga0496115_0178350 3300048918 Bacteria 1757
519 Ga0496115_0474913 3300048918 Bacteria 1007
520 Ga0496126_0229107 3300048929 Bacteria 1557
521 Ga0501031_0076311 3300049568 Bacteria 2182
522 Ga0501031_0228616 3300049568 Bacteria 1211
523 Ga0501033_0454977 3300049570 Bacteria 889
524 Ga0501036_0008839 3300049572 Bacteria 8270
525 Ga0501036_0403103 3300049572 Bacteria 1141
526 Ga0501039_0081823 3300049575 Bacteria 2514
527 Ga0501040_0008080 3300049576 Bacteria 6833
528 Ga0501041_0025193 3300049577 Bacteria 3576
529 Ga0501042_0007646 3300049578 Bacteria 7091
530 Ga0501042_0048798 3300049578 Bacteria 3019
531 Ga0501042_0191444 3300049578 Bacteria 1475
532 Ga0501046_0071449 3300049580 Bacteria 2697
533 Ga0501048_0265665 3300049582 Bacteria 1219
534 Ga0501068_0076808 3300049584 Bacteria 2045
535 Ga0501069_0162470 3300049585 Bacteria 1286
536 Ga0501071_0003413 3300049587 Bacteria 9927
537 Ga0501071_0117235 3300049587 Bacteria 1972
538 Ga0501071_0490991 3300049587 Bacteria 941
539 Ga0501072_0183023 3300049588 Bacteria 1671
540 Ga0501074_0405162 3300049590 Bacteria 967
541 Ga0501075_0128541 3300049591 Bacteria 1929
542 Ga0501075_0448082 3300049591 Bacteria 984
543 Ga0501076_0027524 3300049592 Bacteria 4408
544 Ga0501077_0029788 3300049593 Bacteria 3471
545 Ga0501079_0008087 3300049741 Bacteria 7966
546 Ga0501079_0070516 3300049741 Bacteria 2699
547 Ga0501079_0088419 3300049741 Bacteria 2399
548 Ga0501081_0043878 3300049743 Bacteria 3068
549 Ga0501035_0072296 3300049822 Bacteria 3053
550 Ga0501035_0403306 3300049822 Bacteria 1137
551 Ga0501045_0014561 3300049824 Bacteria 5574
552 Ga0501045_0193935 3300049824 Bacteria 1514
553 nmdc:mga00v17_203765_c1 3300050491 Bacteria 1279
554 nmdc:mga0yw44_388988_c1 3300050492 Bacteria 942
555 nmdc:mga0n895_15422_c1 3300050512 Bacteria 6967
556 nmdc:mga0rr50_139061_c1 3300050513 Bacteria 1952
557 nmdc:mga08x19_65888_c1 3300050514 Bacteria 2353
558 Ga0495601_0011380 3300053077 Bacteria 5319
559 Ga0495601_0023210 3300053077 Bacteria 3811
560 Ga0495601_0091859 3300053077 Bacteria 1954
561 Ga0495601_0453318 3300053077 Bacteria 829
562 Ga0495612_0045168 3300053078 Bacteria 1803
563 Ga0495612_0082517 3300053078 Bacteria 1352
564 Ga0495612_0157565 3300053078 Bacteria 990
565 Ga0495655_0073302 3300053083 Bacteria 962
566 Ga0495595_0039409 3300053084 Bacteria 2155
567 Ga0495595_0127264 3300053084 Bacteria 1243
568 Ga0495619_0014836 3300053085 Bacteria 4922
569 Ga0495619_0030023 3300053085 Bacteria 3517
570 Ga0495619_0060635 3300053085 Bacteria 2515
571 Ga0495619_0233113 3300053085 Bacteria 1275
572 Ga0501084_0103478 3300054114 Bacteria 2391
573 Ga0501082_0081914 3300060353 Bacteria 2785
574 Ga0501082_0110666 3300060353 Bacteria 2377
575 Ga0501082_0259023 3300060353 Bacteria 1513
576 Ga0466962_0002059 3300061719 Bacteria 9523
577 Ga0466962_0032746 3300061719 Bacteria 2487
578 Ga0466962_0038099 3300061719 Bacteria 2303
579 Ga0466962_0093981 3300061719 Bacteria 1437
580 Ga0530510_0149957 3300061734 Bacteria 1721
581 Ga0530510_0183469 3300061734 Bacteria 1552
582 2881852912 2881845957 Bacteria 6611900
583 2888352444 2888350351 Bacteria 7372807
584 2906358070 2906354277 Bacteria 6991324
585 2922134957 2922130491 Bacteria 7173936
586 2922191021 2922185730 Bacteria 7113964
587 2967998982 2967996073 Bacteria 6787468
588 2977976066 2977971508 Bacteria 7472917
589 2979747973 2979742915 Bacteria 7301278
590 Ga0105249_10707698
591 JGI25406J46586_10005629
592 JGI25165J46597_1000020
593 Ga0070658_10051336
594 Ga0070683_100066478
595 Ga0070683_100142312
596 Ga0070683_100145952
597 Ga0070683_100191154
598 Ga0070683_100851920
599 Ga0070670_100456640
600 Ga0070680_100013449
601 Ga0070680_100159353
602 Ga0070680_100405278
603 Ga0070682_100020112
604 Ga0070682_100044924
605 Ga0070682_100347294
606 Ga0068868_100485422
607 Ga0070660_100457365
608 Ga0070689_100420941
609 Ga0070661_100189858
610 Ga0070661_100417032
611 Ga0070671_100155149
612 Ga0070671_100278337
613 Ga0070674_100062151
614 Ga0070674_100126186
615 Ga0070659_100029859
616 Ga0070659_100068073
617 Ga0070709_10011697
618 Ga0070709_10039618
619 Ga0070714_100015294
620 Ga0070714_100033226
621 Ga0070714_100046287
622 Ga0070714_100309715
623 Ga0070713_100013329
624 Ga0070713_100664749
625 Ga0070710_10011548
626 Ga0070711_100075992
627 Ga0070711_100350041
628 Ga0070705_100142892
629 Ga0070700_100366715
630 Ga0070708_100311814
631 Ga0070708_100410553
632 Ga0070663_100234884
633 Ga0070678_100098413
634 Ga0070681_10004844
635 Ga0070681_10008276
636 Ga0070681_10063813
637 Ga0070681_10077807
638 Ga0068867_100669477
639 Ga0070685_10017372
640 Ga0070706_100037610
641 Ga0070707_100006284
642 Ga0070707_100038254
643 Ga0070707_100687317
644 Ga0070698_100070736
645 Ga0070698_100138695
646 Ga0070699_100053688
647 Ga0070679_100095560
648 Ga0070679_100120328
649 Ga0070684_100110476
650 Ga0070684_100286271
651 Ga0070684_100609756
652 Ga0070672_100347049
653 Ga0070695_100003825
654 Ga0070693_100127036
655 Ga0070665_100250231
656 Ga0070704_100014855
657 Ga0068855_100212765
658 Ga0068855_100244002
659 Ga0068855_100687564
660 Ga0070664_100109499
661 Ga0070664_100143673
662 Ga0070664_100252202
663 Ga0070664_100480622
664 Ga0068857_100093854
665 Ga0068854_100078102
666 Ga0068856_100003371
667 Ga0068856_100120042
668 Ga0068856_100147829
669 Ga0070702_100346363
670 Ga0068852_100344612
671 Ga0068864_100899953
672 Ga0068866_10055249
673 Ga0068870_10087154
674 Ga0068860_100071131
675 Ga0068860_100167995
676 Ga0068860_100549322
677 Ga0081455_10020423
678 Ga0081538_10038887
679 Ga0081539_10000288
680 Ga0070717_10017472
681 Ga0070717_10041661
682 Ga0070717_10071119
683 Ga0070717_10186924
684 Ga0075365_10034751
685 Ga0075365_10172015
686 Ga0075365_10441618
687 Ga0075364_10129881
688 Ga0075364_10265981
689 Ga0070715_10002907
690 Ga0070716_100018225
691 Ga0070716_100046987
692 Ga0070712_100017760
693 Ga0070712_100020338
694 Ga0070712_100261281
695 Ga0097621_100012081
696 Ga0097621_100157418
697 Ga0068871_100013798
698 Ga0068871_100771077
699 Ga0075434_100032199
700 Ga0075436_100024693
701 Ga0075436_100031849
702 Ga0075436_100224293
703 Ga0097620_100168157
704 Ga0075435_100220398
705 Ga0105240_10032220
706 Ga0105240_10512096
707 Ga0105245_10064332
708 Ga0105245_10303161
709 Ga0105245_10444849
710 Ga0105247_10049603
711 Ga0105243_10016623
712 Ga0105241_10011364
713 Ga0105242_10015122
714 Ga0105242_10017818
715 Ga0105242_10376789
716 Ga0105242_10669783
717 Ga0105248_10421451
718 Ga0105248_10436482
719 Ga0105237_10026808
720 Ga0105238_10077066
721 Ga0105249_10336538
722 Ga0105239_10064774
723 Ga0105239_10778151
724 Ga0105246_10012799
725 Ga0105246_10132289
726 Ga0105246_10138737
727 Ga0105246_10145182
728 Ga0157369_10049222
729 Ga0157369_10819606
730 Ga0157374_10047242
731 Ga0157374_10876806
732 Ga0157378_10015965
733 Ga0157378_10588061
734 Ga0157372_10017920
735 Ga0157372_10184504
736 Ga0157372_10450272
737 Ga0157375_10159309
738 Ga0157375_10327278
739 Ga0163163_10926546
740 Ga0157380_10031894
741 Ga0157379_10020818
742 Ga0157379_10178033
743 Ga0157379_10225629
744 Ga0157376_10003286
745 Ga0157376_10010143
746 Ga0157376_10150827
747 Ga0213871_10009099
748 Ga0209233_1000047
749 Ga0207692_10010323
750 Ga0207688_10305107
751 Ga0207685_10016858
752 Ga0207699_10048701
753 Ga0207643_10056830
754 Ga0207643_10329208
755 Ga0207705_10602750
756 Ga0207684_10098639
757 Ga0207654_10040756
758 Ga0207654_10154603
759 Ga0207707_10385574
760 Ga0207707_10638219
761 Ga0207695_10551730
762 Ga0207671_10519010
763 Ga0207693_10000818
764 Ga0207693_10008617
765 Ga0207663_10091098
766 Ga0207660_10023172
767 Ga0207660_10203961
768 Ga0207660_10476525
769 Ga0207662_10528817
770 Ga0207652_10098672
771 Ga0207652_10186132
772 Ga0207646_10003389
773 Ga0207646_10594287
774 Ga0207650_10406519
775 Ga0207659_10212611
776 Ga0207687_10200621
777 Ga0207687_10736799
778 Ga0207700_10018613
779 Ga0207700_10100122
780 Ga0207700_10658261
781 Ga0207664_10006143
782 Ga0207664_10007134
783 Ga0207664_10008819
784 Ga0207664_10036124
785 Ga0207664_10119608
786 Ga0207664_10199802
787 Ga0207686_10017712
788 Ga0207686_10024720
789 Ga0207686_10032296
790 Ga0207686_10180395
791 Ga0207709_10358068
792 Ga0207669_10196577
793 Ga0207704_10070519
794 Ga0207665_10003767
795 Ga0207665_10088985
796 Ga0207691_10065970
797 Ga0207691_10494565
798 Ga0207711_10691453
799 Ga0207661_10000903
800 Ga0207661_10031097
801 Ga0207661_10080274
802 Ga0207679_10175490
803 Ga0207651_10126862
804 Ga0207677_10761812
805 Ga0207708_10018841
806 Ga0207648_10042113
807 Ga0207674_10021350
808 Ga0207683_10000244
809 Ga0207683_10020966
810 Ga0207683_10507707
811 Ga0207683_10747737
812 Ga0207698_10093431
813 Ga0268266_10342368
814 Ga0268264_10241511
815 Ga0268264_10470739
816 Ga0265326_10038811
817 Ga0265319_1001131
818 Ga0265319_1003410
819 Ga0265319_1012716
820 Ga0265334_10000679
821 Ga0265318_10001580
822 Ga0265318_10157193
823 Ga0265322_10006107
824 Ga0265322_10018353
825 Ga0265336_10009197
826 Ga0265338_10005145
827 Ga0265338_10022691
828 Ga0265338_10068766
829 Ga0265324_10017690
830 Ga0265330_10003515
831 Ga0265332_10004470
832 Ga0265328_10003815
833 Ga0265320_10003022
834 Ga0265320_10140255
835 Ga0265325_10007381
836 Ga0265329_10005179
837 Ga0265340_10017158
838 Ga0265339_10004787
839 Ga0265339_10086963
840 Ga0265331_10014887
841 Ga0265327_10021997
842 Ga0265327_10045002
843 Ga0265316_10017157
844 Ga0265316_10038639
845 Ga0265313_10007506
846 Ga0265314_10022143
847 Ga0265314_10023325
848 Ga0265314_10050670
849 Ga0265314_10128540
850 Ga0265342_10004174
851 Ga0265342_10006365
852 Ga0373926_0016182
853 Ga0373952_0038615
854 Ga0373923_0201087
855 Ga0373945_0052004
856 Ga0373956_0152938
857 Ga0373943_0003602
858 Ga0373924_0132891
859 Ga0373935_0047112
860 Ga0373935_0069748
861 Ga0373933_0063662
862 Ga0373937_0001027
863 Ga0373937_0207177
864 Ga0373937_0374023
865 Ga0373925_0322841
866 Ga0395900_0211778
867 Ga0395900_0582883
868 Ga0395898_0024071
869 Ga0395898_0445408
870 Ga0395905_0511057
871 Ga0395905_0950571
872 Ga0395901_0043481
873 Ga0436360_0989015
874 Ga0450920_003578
875 Ga0450906_006388
876 Ga0466969_0011062
877 Ga0466969_0101838
878 Ga0466965_0018905
879 Ga0466965_0061642
880 Ga0466966_0009037
881 Ga0466966_0087654
882 Ga0466966_0609149
883 Ga0466961_0007831
884 Ga0466961_0009303
885 Ga0466963_0000333
886 Ga0466963_0002587
887 Ga0466963_0006101
888 Ga0466963_0010354
889 Ga0466963_0011554
890 Ga0466963_0017023
891 Ga0466963_0030241
892 Ga0466963_0032397
893 Ga0466963_0039521
894 Ga0466963_0121440
895 Ga0466963_0223554
896 Ga0466964_0015536
897 Ga0466964_0020166
898 Ga0466964_0075216
899 Ga0466964_0083026
900 Ga0466964_0120208
901 Ga0466964_0235667
902 Ga0466971_0000446
903 Ga0466971_0004771
904 Ga0466971_0006466
905 Ga0466971_0011623
906 Ga0466971_0012207
907 Ga0466971_0051569
908 Ga0466968_0006794
909 Ga0466968_0011247
910 Ga0466968_0110616
911 Ga0466970_0173893
912 Ga0466957_0002093
913 Ga0466957_0002407
914 Ga0466957_0011232
915 Ga0466957_0021209
916 Ga0466957_0051591
917 Ga0466957_0085178
918 Ga0466957_0105625
919 Ga0466957_0219402
920 Ga0466957_0699571
921 Ga0466960_0014853
922 Ga0466959_0019196
923 Ga0466959_0030275
924 Ga0466959_0052875
925 Ga0466959_0074538
926 Ga0466958_0001168
927 Ga0466958_0003504
928 Ga0466958_0004245
929 Ga0466958_0004419
930 Ga0466958_0011883
931 Ga0466958_0016262
932 Ga0466958_0017532
933 Ga0466958_0127130
934 Ga0466967_0000297
935 Ga0466967_0005024
936 Ga0466967_0019140
937 Ga0466967_0054027
938 Ga0466967_0076633
939 Ga0466967_0081917
940 Ga0466967_0099205
941 Ga0466967_0117318
942 Ga0466967_0560955
943 Ga0466967_0689434
944 Ga0466967_1376460
945 Ga0495592_0011160
946 Ga0495592_0028377
947 Ga0495592_0029922
948 Ga0495592_0035034
949 Ga0495592_0340983
950 Ga0495603_0268363
951 Ga0495629_0057504
952 Ga0495629_0144504
953 Ga0495629_0270969
954 Ga0495629_0298738
955 Ga0495629_0407239
956 Ga0495651_0011359
957 Ga0495651_0150887
958 Ga0495653_0011485
959 Ga0495653_0018387
960 Ga0495653_0086383
961 Ga0495653_0164672
962 Ga0495653_0384199
963 Ga0495580_0127560
964 Ga0495582_0025768
965 Ga0495582_0215748
966 Ga0495662_0048496
967 Ga0495664_0029948
968 Ga0495664_0036078
969 Ga0495664_0056251
970 Ga0495664_0084738
971 Ga0495594_0160452
972 Ga0495608_0002831
973 Ga0495608_0023014
974 Ga0495608_0164315
975 Ga0495608_0371733
976 Ga0495618_0011658
977 Ga0495618_0044065
978 Ga0495618_0212302
979 Ga0495628_0079207
980 Ga0495630_0079325
981 Ga0495631_0062149
982 Ga0495644_0078384
983 Ga0495644_0120444
984 Ga0495666_0011855
985 Ga0495652_0000187
986 Ga0495652_0084780
987 Ga0495652_0102638
988 Ga0495652_0144436
989 Ga0495652_0158283
990 Ga0495665_0070986
991 Ga0495640_0018982
992 Ga0495640_0053648
993 Ga0495640_0106137
994 Ga0495586_0044790
995 Ga0495586_0300540
996 Ga0495587_0006018
997 Ga0495587_0048583
998 Ga0495645_0003018
999 Ga0495645_0012459
1000 Ga0495645_0225891
1001 Ga0495667_0009311
1002 Ga0495667_0024762
1003 Ga0495634_0155432
1004 Ga0495634_0193375
1005 Ga0495635_0040119
1006 Ga0495635_0049872
1007 Ga0495635_0143030
1008 Ga0495588_0116321
1009 Ga0495588_0213134
1010 Ga0495657_0048890
1011 Ga0495599_0000196
1012 Ga0495599_0028185
1013 Ga0495599_0036200
1014 Ga0495599_0324555
1015 Ga0495623_0000045
1016 Ga0495623_0022977
1017 Ga0495646_0000489
1018 Ga0495646_0106108
1019 Ga0495658_0166199
1020 Ga0495613_0005875
1021 Ga0495613_0262914
1022 Ga0495624_0035503
1023 Ga0495589_0026133
1024 Ga0495589_0109028
1025 Ga0495600_0014173
1026 Ga0495600_0170458
1027 Ga0495581_0199398
1028 Ga0495604_0000221
1029 Ga0495604_0029270
1030 Ga0495604_0492228
1031 Ga0495674_0098948
1032 Ga0495674_0140418
1033 Ga0495674_0153138
1034 Ga0495674_0198050
1035 Ga0495676_0047688
1036 Ga0495680_0006615
1037 Ga0495680_0031451
1038 Ga0495680_0081409
1039 Ga0495680_0110533
1040 Ga0495680_0185852
1041 Ga0495675_0000301
1042 Ga0495684_0003566
1043 Ga0495684_0069065
1044 Ga0495602_0000515
1045 Ga0495602_0122357
1046 Ga0495614_0002862
1047 Ga0496100_0006416
1048 Ga0496100_0025081
1049 Ga0496100_0303552
1050 Ga0496101_0006449
1051 Ga0496102_0020359
1052 Ga0496102_0036207
1053 Ga0496102_0051477
1054 Ga0496103_0012623
1055 Ga0496103_0031239
1056 Ga0496103_0131982
1057 Ga0496104_0011272
1058 Ga0496104_0013441
1059 Ga0496104_0353416
1060 Ga0496105_0008808
1061 Ga0496105_0019849
1062 Ga0496105_0073144
1063 Ga0496105_0143635
1064 Ga0496105_0151924
1065 Ga0496105_0347970
1066 Ga0496106_0066164
1067 Ga0496106_0191662
1068 Ga0496106_0192652
1069 Ga0496108_0027598
1070 Ga0496108_0072695
1071 Ga0496108_0126970
1072 Ga0496108_0191634
1073 Ga0496108_0382580
1074 Ga0496109_0003943
1075 Ga0496109_0018128
1076 Ga0496109_0043794
1077 Ga0496109_0102352
1078 Ga0496109_0163682
1079 Ga0496109_0256996
1080 Ga0496109_0281688
1081 Ga0496109_0291095
1082 Ga0496109_0321686
1083 Ga0496109_0498388
1084 Ga0496110_0003644
1085 Ga0496110_0030595
1086 Ga0496110_0060364
1087 Ga0496110_0313219
1088 Ga0496111_0006372
1089 Ga0496111_0032136
1090 Ga0496111_0090430
1091 Ga0496111_0187727
1092 Ga0496112_0009540
1093 Ga0496112_0034969
1094 Ga0496112_0132126
1095 Ga0496112_0657391
1096 Ga0496113_0014117
1097 Ga0496113_0056964
1098 Ga0496113_0064547
1099 Ga0496113_0068754
1100 Ga0496113_0203534
1101 Ga0496114_0069425
1102 Ga0496114_0204961
1103 Ga0496114_0243444
1104 Ga0496114_0253645
1105 Ga0496115_0004119
1106 Ga0496115_0009199
1107 Ga0496115_0178350
1108 Ga0496115_0474913
1109 Ga0496126_0229107
1110 Ga0501031_0076311
1111 Ga0501031_0228616
1112 Ga0501033_0454977
1113 Ga0501036_0008839
1114 Ga0501036_0403103
1115 Ga0501039_0081823
1116 Ga0501040_0008080
1117 Ga0501041_0025193
1118 Ga0501042_0007646
1119 Ga0501042_0048798
1120 Ga0501042_0191444
1121 Ga0501046_0071449
1122 Ga0501048_0265665
1123 Ga0501068_0076808
1124 Ga0501069_0162470
1125 Ga0501071_0003413
1126 Ga0501071_0117235
1127 Ga0501071_0490991
1128 Ga0501072_0183023
1129 Ga0501074_0405162
1130 Ga0501075_0128541
1131 Ga0501075_0448082
1132 Ga0501076_0027524
1133 Ga0501077_0029788
1134 Ga0501079_0008087
1135 Ga0501079_0070516
1136 Ga0501079_0088419
1137 Ga0501081_0043878
1138 Ga0501035_0072296
1139 Ga0501035_0403306
1140 Ga0501045_0014561
1141 Ga0501045_0193935
1142 nmdc:mga00v17_203765_c1
1143 nmdc:mga0yw44_388988_c1
1144 nmdc:mga0n895_15422_c1
1145 nmdc:mga0rr50_139061_c1
1146 nmdc:mga08x19_65888_c1
1147 Ga0495601_0011380
1148 Ga0495601_0023210
1149 Ga0495601_0091859
1150 Ga0495601_0453318
1151 Ga0495612_0045168
1152 Ga0495612_0082517
1153 Ga0495612_0157565
1154 Ga0495655_0073302
1155 Ga0495595_0039409
1156 Ga0495595_0127264
1157 Ga0495619_0014836
1158 Ga0495619_0030023
1159 Ga0495619_0060635
1160 Ga0495619_0233113
1161 Ga0501084_0103478
1162 Ga0501082_0081914
1163 Ga0501082_0110666
1164 Ga0501082_0259023
1165 Ga0466962_0002059
1166 Ga0466962_0032746
1167 Ga0466962_0038099
1168 Ga0466962_0093981
1169 Ga0530510_0149957
1170 Ga0530510_0183469
1171 2881852912
1172 2888352444
1173 2906358070
1174 2922134957
1175 2922191021
1176 2967998982
1177 2977976066
1178 2979747973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

175

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9237 1 237
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9195 7 234
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9174 5 225
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9163 1 237
3d31-assembly1.cif.gz_A modbc from methanosarcina acetivorans 0.9119 7 225
ID Description Score Start End Superfamily
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9475 7 70 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9469 2 238 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9391 2 238 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.936 5 70 3.40.50.300
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9348 5 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A254THI3-F1-model_v4 ABC transporter ATP-binding protein 0.9796 7 225 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A6F8YCS9-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein 0.9709 4 220 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1F7LUM7-F1-model_v4 ABC transporter domain-containing protein 0.9706 6 225 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1Q7D5U6-F1-model_v4 ABC transporter ATP-binding protein 0.9678 4 233 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A4Q2L748-F1-model_v4 ATP-binding cassette domain-containing protein 0.9608 1 237 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map