F466856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 589 | 285 | 1178 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10707698|Ga0105249_107076982 |
| Length | 262 |
| Sequence | VSAASEPATAPAVLELDRLTVRYGGVTAVRELSVEVRGGEIVGLIGPNGAGKSTTLHAIMGAVPVEDGDVRLSGRSVRGRAPEAIARSGVALVPEGRRIFAELTVEENLRLGLSGRRSREGAEEAVEEVYDLFPVVREFGRRQAGALSGGQQQQLAIGRALVAGPDLLLLDEPSLGLAPRIVDVVFDALAQIRRRGITVLLVEQRAQRTVAFADRTYLMANGEVASRSRTAWAVRRPASWRVSRHARGSVRTPKTADRLRTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 141 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 151 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 152 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 165 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 166 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 167 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 278 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 279 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 280 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 281 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 282 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 283 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 284 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 285 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 0 |
| Isolates | 1.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.53 |
| Nodule | 1.36 |
| Rhizoplane | 10.53 |
| Rhizosphere | 86.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105249_10707698 | 3300009553 | Bacteria | 1068 |
| 2 | JGI25406J46586_10005629 | 3300003203 | Bacteria | 5798 |
| 3 | JGI25165J46597_1000020 | 3300003214 | Bacteria | 370477 |
| 4 | Ga0070658_10051336 | 3300005327 | Bacteria | 3342 |
| 5 | Ga0070683_100066478 | 3300005329 | Bacteria | 3358 |
| 6 | Ga0070683_100142312 | 3300005329 | Bacteria | 2272 |
| 7 | Ga0070683_100145952 | 3300005329 | Bacteria | 2242 |
| 8 | Ga0070683_100191154 | 3300005329 | Bacteria | 1943 |
| 9 | Ga0070683_100851920 | 3300005329 | Bacteria | 874 |
| 10 | Ga0070670_100456640 | 3300005331 | Bacteria | 1133 |
| 11 | Ga0070680_100013449 | 3300005336 | Bacteria | 6374 |
| 12 | Ga0070680_100159353 | 3300005336 | Bacteria | 1896 |
| 13 | Ga0070680_100405278 | 3300005336 | Bacteria | 1163 |
| 14 | Ga0070682_100020112 | 3300005337 | Bacteria | 3924 |
| 15 | Ga0070682_100044924 | 3300005337 | Bacteria | 2736 |
| 16 | Ga0070682_100347294 | 3300005337 | Bacteria | 1105 |
| 17 | Ga0068868_100485422 | 3300005338 | Bacteria | 1080 |
| 18 | Ga0070660_100457365 | 3300005339 | Bacteria | 1059 |
| 19 | Ga0070689_100420941 | 3300005340 | Bacteria | 1132 |
| 20 | Ga0070661_100189858 | 3300005344 | Bacteria | 1567 |
| 21 | Ga0070661_100417032 | 3300005344 | Bacteria | 1064 |
| 22 | Ga0070671_100155149 | 3300005355 | Bacteria | 1934 |
| 23 | Ga0070671_100278337 | 3300005355 | Bacteria | 1423 |
| 24 | Ga0070674_100062151 | 3300005356 | Bacteria | 2609 |
| 25 | Ga0070674_100126186 | 3300005356 | Bacteria | 1901 |
| 26 | Ga0070659_100029859 | 3300005366 | Bacteria | 4215 |
| 27 | Ga0070659_100068073 | 3300005366 | Bacteria | 2824 |
| 28 | Ga0070709_10011697 | 3300005434 | Bacteria | 4900 |
| 29 | Ga0070709_10039618 | 3300005434 | Bacteria | 2892 |
| 30 | Ga0070714_100015294 | 3300005435 | Bacteria | 6173 |
| 31 | Ga0070714_100033226 | 3300005435 | Bacteria | 4312 |
| 32 | Ga0070714_100046287 | 3300005435 | Bacteria | 3690 |
| 33 | Ga0070714_100309715 | 3300005435 | Bacteria | 1474 |
| 34 | Ga0070713_100013329 | 3300005436 | Bacteria | 6067 |
| 35 | Ga0070713_100664749 | 3300005436 | Bacteria | 993 |
| 36 | Ga0070710_10011548 | 3300005437 | Bacteria | 4366 |
| 37 | Ga0070711_100075992 | 3300005439 | Bacteria | 2380 |
| 38 | Ga0070711_100350041 | 3300005439 | Bacteria | 1188 |
| 39 | Ga0070705_100142892 | 3300005440 | Bacteria | 1577 |
| 40 | Ga0070700_100366715 | 3300005441 | Bacteria | 1073 |
| 41 | Ga0070708_100311814 | 3300005445 | Bacteria | 1482 |
| 42 | Ga0070708_100410553 | 3300005445 | Bacteria | 1277 |
| 43 | Ga0070663_100234884 | 3300005455 | Bacteria | 1445 |
| 44 | Ga0070678_100098413 | 3300005456 | Bacteria | 2261 |
| 45 | Ga0070681_10004844 | 3300005458 | Bacteria | 12903 |
| 46 | Ga0070681_10008276 | 3300005458 | Bacteria | 10182 |
| 47 | Ga0070681_10063813 | 3300005458 | Bacteria | 3656 |
| 48 | Ga0070681_10077807 | 3300005458 | Bacteria | 3274 |
| 49 | Ga0068867_100669477 | 3300005459 | Bacteria | 913 |
| 50 | Ga0070685_10017372 | 3300005466 | Bacteria | 3850 |
| 51 | Ga0070706_100037610 | 3300005467 | Bacteria | 4469 |
| 52 | Ga0070707_100006284 | 3300005468 | Bacteria | 11050 |
| 53 | Ga0070707_100038254 | 3300005468 | Bacteria | 4581 |
| 54 | Ga0070707_100687317 | 3300005468 | Bacteria | 986 |
| 55 | Ga0070698_100070736 | 3300005471 | Bacteria | 3500 |
| 56 | Ga0070698_100138695 | 3300005471 | Bacteria | 2385 |
| 57 | Ga0070699_100053688 | 3300005518 | Bacteria | 3488 |
| 58 | Ga0070679_100095560 | 3300005530 | Bacteria | 2959 |
| 59 | Ga0070679_100120328 | 3300005530 | Bacteria | 2610 |
| 60 | Ga0070684_100110476 | 3300005535 | Bacteria | 2465 |
| 61 | Ga0070684_100286271 | 3300005535 | Bacteria | 1510 |
| 62 | Ga0070684_100609756 | 3300005535 | Bacteria | 1015 |
| 63 | Ga0070672_100347049 | 3300005543 | Bacteria | 1265 |
| 64 | Ga0070695_100003825 | 3300005545 | Bacteria | 8781 |
| 65 | Ga0070693_100127036 | 3300005547 | Bacteria | 1589 |
| 66 | Ga0070665_100250231 | 3300005548 | Bacteria | 1773 |
| 67 | Ga0070704_100014855 | 3300005549 | Bacteria | 4873 |
| 68 | Ga0068855_100212765 | 3300005563 | Bacteria | 2171 |
| 69 | Ga0068855_100244002 | 3300005563 | Bacteria | 2006 |
| 70 | Ga0068855_100687564 | 3300005563 | Bacteria | 1096 |
| 71 | Ga0070664_100109499 | 3300005564 | Bacteria | 2409 |
| 72 | Ga0070664_100143673 | 3300005564 | Bacteria | 2103 |
| 73 | Ga0070664_100252202 | 3300005564 | Bacteria | 1586 |
| 74 | Ga0070664_100480622 | 3300005564 | Bacteria | 1143 |
| 75 | Ga0068857_100093854 | 3300005577 | Bacteria | 2687 |
| 76 | Ga0068854_100078102 | 3300005578 | Bacteria | 2438 |
| 77 | Ga0068856_100003371 | 3300005614 | Bacteria | 16176 |
| 78 | Ga0068856_100120042 | 3300005614 | Bacteria | 2631 |
| 79 | Ga0068856_100147829 | 3300005614 | Bacteria | 2357 |
| 80 | Ga0070702_100346363 | 3300005615 | Bacteria | 1045 |
| 81 | Ga0068852_100344612 | 3300005616 | Bacteria | 1453 |
| 82 | Ga0068864_100899953 | 3300005618 | Bacteria | 874 |
| 83 | Ga0068866_10055249 | 3300005718 | Bacteria | 2038 |
| 84 | Ga0068870_10087154 | 3300005840 | Bacteria | 1738 |
| 85 | Ga0068860_100071131 | 3300005843 | Bacteria | 3307 |
| 86 | Ga0068860_100167995 | 3300005843 | Bacteria | 2118 |
| 87 | Ga0068860_100549322 | 3300005843 | Bacteria | 1157 |
| 88 | Ga0081455_10020423 | 3300005937 | Bacteria | 6237 |
| 89 | Ga0081538_10038887 | 3300005981 | Bacteria | 3059 |
| 90 | Ga0081539_10000288 | 3300005985 | Bacteria | 113905 |
| 91 | Ga0070717_10017472 | 3300006028 | Bacteria | 5582 |
| 92 | Ga0070717_10041661 | 3300006028 | Bacteria | 3743 |
| 93 | Ga0070717_10071119 | 3300006028 | Bacteria | 2901 |
| 94 | Ga0070717_10186924 | 3300006028 | Bacteria | 1809 |
| 95 | Ga0075365_10034751 | 3300006038 | Bacteria | 3257 |
| 96 | Ga0075365_10172015 | 3300006038 | Bacteria | 1512 |
| 97 | Ga0075365_10441618 | 3300006038 | Bacteria | 919 |
| 98 | Ga0075364_10129881 | 3300006051 | Bacteria | 1690 |
| 99 | Ga0075364_10265981 | 3300006051 | Bacteria | 1166 |
| 100 | Ga0070715_10002907 | 3300006163 | Bacteria | 5344 |
| 101 | Ga0070716_100018225 | 3300006173 | Bacteria | 3653 |
| 102 | Ga0070716_100046987 | 3300006173 | Bacteria | 2433 |
| 103 | Ga0070712_100017760 | 3300006175 | Bacteria | 4608 |
| 104 | Ga0070712_100020338 | 3300006175 | Bacteria | 4344 |
| 105 | Ga0070712_100261281 | 3300006175 | Bacteria | 1387 |
| 106 | Ga0097621_100012081 | 3300006237 | Bacteria | 6391 |
| 107 | Ga0097621_100157418 | 3300006237 | Bacteria | 1950 |
| 108 | Ga0068871_100013798 | 3300006358 | Bacteria | 6006 |
| 109 | Ga0068871_100771077 | 3300006358 | Bacteria | 885 |
| 110 | Ga0075434_100032199 | 3300006871 | Bacteria | 5169 |
| 111 | Ga0075436_100024693 | 3300006914 | Bacteria | 4132 |
| 112 | Ga0075436_100031849 | 3300006914 | Bacteria | 3633 |
| 113 | Ga0075436_100224293 | 3300006914 | Bacteria | 1334 |
| 114 | Ga0097620_100168157 | 3300006931 | Bacteria | 2273 |
| 115 | Ga0075435_100220398 | 3300007076 | Bacteria | 1611 |
| 116 | Ga0105240_10032220 | 3300009093 | Bacteria | 6788 |
| 117 | Ga0105240_10512096 | 3300009093 | Bacteria | 1333 |
| 118 | Ga0105245_10064332 | 3300009098 | Bacteria | 3314 |
| 119 | Ga0105245_10303161 | 3300009098 | Bacteria | 1568 |
| 120 | Ga0105245_10444849 | 3300009098 | Bacteria | 1303 |
| 121 | Ga0105247_10049603 | 3300009101 | Bacteria | 2581 |
| 122 | Ga0105243_10016623 | 3300009148 | Bacteria | 5565 |
| 123 | Ga0105241_10011364 | 3300009174 | Bacteria | 6527 |
| 124 | Ga0105242_10015122 | 3300009176 | Bacteria | 5990 |
| 125 | Ga0105242_10017818 | 3300009176 | Bacteria | 5542 |
| 126 | Ga0105242_10376789 | 3300009176 | Bacteria | 1318 |
| 127 | Ga0105242_10669783 | 3300009176 | Bacteria | 1011 |
| 128 | Ga0105248_10421451 | 3300009177 | Bacteria | 1503 |
| 129 | Ga0105248_10436482 | 3300009177 | Bacteria | 1475 |
| 130 | Ga0105237_10026808 | 3300009545 | Bacteria | 5889 |
| 131 | Ga0105238_10077066 | 3300009551 | Bacteria | 3326 |
| 132 | Ga0105249_10336538 | 3300009553 | Bacteria | 1525 |
| 133 | Ga0105239_10064774 | 3300010375 | Bacteria | 4013 |
| 134 | Ga0105239_10778151 | 3300010375 | Bacteria | 1096 |
| 135 | Ga0105246_10012799 | 3300011119 | Bacteria | 5245 |
| 136 | Ga0105246_10132289 | 3300011119 | Bacteria | 1865 |
| 137 | Ga0105246_10138737 | 3300011119 | Bacteria | 1825 |
| 138 | Ga0105246_10145182 | 3300011119 | Bacteria | 1789 |
| 139 | Ga0157369_10049222 | 3300013105 | Bacteria | 4570 |
| 140 | Ga0157369_10819606 | 3300013105 | Bacteria | 956 |
| 141 | Ga0157374_10047242 | 3300013296 | Bacteria | 3991 |
| 142 | Ga0157374_10876806 | 3300013296 | Bacteria | 915 |
| 143 | Ga0157378_10015965 | 3300013297 | Bacteria | 6577 |
| 144 | Ga0157378_10588061 | 3300013297 | Bacteria | 1123 |
| 145 | Ga0157372_10017920 | 3300013307 | Bacteria | 7610 |
| 146 | Ga0157372_10184504 | 3300013307 | Bacteria | 2416 |
| 147 | Ga0157372_10450272 | 3300013307 | Bacteria | 1500 |
| 148 | Ga0157375_10159309 | 3300013308 | Bacteria | 2398 |
| 149 | Ga0157375_10327278 | 3300013308 | Bacteria | 1697 |
| 150 | Ga0163163_10926546 | 3300014325 | Bacteria | 935 |
| 151 | Ga0157380_10031894 | 3300014326 | Bacteria | 4047 |
| 152 | Ga0157379_10020818 | 3300014968 | Bacteria | 5805 |
| 153 | Ga0157379_10178033 | 3300014968 | Bacteria | 1921 |
| 154 | Ga0157379_10225629 | 3300014968 | Bacteria | 1698 |
| 155 | Ga0157376_10003286 | 3300014969 | Bacteria | 11129 |
| 156 | Ga0157376_10010143 | 3300014969 | Bacteria | 6878 |
| 157 | Ga0157376_10150827 | 3300014969 | Bacteria | 2096 |
| 158 | Ga0213871_10009099 | 3300021441 | Bacteria | 2213 |
| 159 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 160 | Ga0207692_10010323 | 3300025898 | Bacteria | 3931 |
| 161 | Ga0207688_10305107 | 3300025901 | Bacteria | 974 |
| 162 | Ga0207685_10016858 | 3300025905 | Bacteria | 2347 |
| 163 | Ga0207699_10048701 | 3300025906 | Bacteria | 2490 |
| 164 | Ga0207643_10056830 | 3300025908 | Bacteria | 2226 |
| 165 | Ga0207643_10329208 | 3300025908 | Bacteria | 955 |
| 166 | Ga0207705_10602750 | 3300025909 | Bacteria | 854 |
| 167 | Ga0207684_10098639 | 3300025910 | Bacteria | 2495 |
| 168 | Ga0207654_10040756 | 3300025911 | Bacteria | 2618 |
| 169 | Ga0207654_10154603 | 3300025911 | Bacteria | 1476 |
| 170 | Ga0207707_10385574 | 3300025912 | Bacteria | 1204 |
| 171 | Ga0207707_10638219 | 3300025912 | Bacteria | 898 |
| 172 | Ga0207695_10551730 | 3300025913 | Bacteria | 1034 |
| 173 | Ga0207671_10519010 | 3300025914 | Bacteria | 950 |
| 174 | Ga0207693_10000818 | 3300025915 | Bacteria | 27776 |
| 175 | Ga0207693_10008617 | 3300025915 | Bacteria | 8347 |
| 176 | Ga0207663_10091098 | 3300025916 | Bacteria | 2023 |
| 177 | Ga0207660_10023172 | 3300025917 | Bacteria | 4191 |
| 178 | Ga0207660_10203961 | 3300025917 | Bacteria | 1545 |
| 179 | Ga0207660_10476525 | 3300025917 | Bacteria | 1011 |
| 180 | Ga0207662_10528817 | 3300025918 | Bacteria | 815 |
| 181 | Ga0207652_10098672 | 3300025921 | Bacteria | 2576 |
| 182 | Ga0207652_10186132 | 3300025921 | Bacteria | 1867 |
| 183 | Ga0207646_10003389 | 3300025922 | Bacteria | 18004 |
| 184 | Ga0207646_10594287 | 3300025922 | Bacteria | 994 |
| 185 | Ga0207650_10406519 | 3300025925 | Bacteria | 1128 |
| 186 | Ga0207659_10212611 | 3300025926 | Bacteria | 1551 |
| 187 | Ga0207687_10200621 | 3300025927 | Bacteria | 1559 |
| 188 | Ga0207687_10736799 | 3300025927 | Bacteria | 838 |
| 189 | Ga0207700_10018613 | 3300025928 | Bacteria | 4674 |
| 190 | Ga0207700_10100122 | 3300025928 | Bacteria | 2309 |
| 191 | Ga0207700_10658261 | 3300025928 | Bacteria | 934 |
| 192 | Ga0207664_10006143 | 3300025929 | Bacteria | 8234 |
| 193 | Ga0207664_10007134 | 3300025929 | Bacteria | 7747 |
| 194 | Ga0207664_10008819 | 3300025929 | Bacteria | 7053 |
| 195 | Ga0207664_10036124 | 3300025929 | Bacteria | 3817 |
| 196 | Ga0207664_10119608 | 3300025929 | Bacteria | 2202 |
| 197 | Ga0207664_10199802 | 3300025929 | Bacteria | 1725 |
| 198 | Ga0207686_10017712 | 3300025934 | Bacteria | 4018 |
| 199 | Ga0207686_10024720 | 3300025934 | Bacteria | 3484 |
| 200 | Ga0207686_10032296 | 3300025934 | Bacteria | 3115 |
| 201 | Ga0207686_10180395 | 3300025934 | Bacteria | 1497 |
| 202 | Ga0207709_10358068 | 3300025935 | Bacteria | 1104 |
| 203 | Ga0207669_10196577 | 3300025937 | Bacteria | 1460 |
| 204 | Ga0207704_10070519 | 3300025938 | Bacteria | 2213 |
| 205 | Ga0207665_10003767 | 3300025939 | Bacteria | 10128 |
| 206 | Ga0207665_10088985 | 3300025939 | Bacteria | 2137 |
| 207 | Ga0207691_10065970 | 3300025940 | Bacteria | 3275 |
| 208 | Ga0207691_10494565 | 3300025940 | Bacteria | 1039 |
| 209 | Ga0207711_10691453 | 3300025941 | Bacteria | 951 |
| 210 | Ga0207661_10000903 | 3300025944 | Bacteria | 19452 |
| 211 | Ga0207661_10031097 | 3300025944 | Bacteria | 4119 |
| 212 | Ga0207661_10080274 | 3300025944 | Bacteria | 2691 |
| 213 | Ga0207679_10175490 | 3300025945 | Bacteria | 1768 |
| 214 | Ga0207651_10126862 | 3300025960 | Bacteria | 1946 |
| 215 | Ga0207677_10761812 | 3300026023 | Bacteria | 864 |
| 216 | Ga0207708_10018841 | 3300026075 | Bacteria | 5199 |
| 217 | Ga0207648_10042113 | 3300026089 | Bacteria | 4009 |
| 218 | Ga0207674_10021350 | 3300026116 | Bacteria | 6975 |
| 219 | Ga0207683_10000244 | 3300026121 | Bacteria | 48306 |
| 220 | Ga0207683_10020966 | 3300026121 | Bacteria | 5594 |
| 221 | Ga0207683_10507707 | 3300026121 | Bacteria | 1114 |
| 222 | Ga0207683_10747737 | 3300026121 | Bacteria | 907 |
| 223 | Ga0207698_10093431 | 3300026142 | Bacteria | 2469 |
| 224 | Ga0268266_10342368 | 3300028379 | Bacteria | 1404 |
| 225 | Ga0268264_10241511 | 3300028381 | Bacteria | 1673 |
| 226 | Ga0268264_10470739 | 3300028381 | Bacteria | 1221 |
| 227 | Ga0265326_10038811 | 3300028558 | Bacteria | 1353 |
| 228 | Ga0265319_1001131 | 3300028563 | Bacteria | 16576 |
| 229 | Ga0265319_1003410 | 3300028563 | Bacteria | 8300 |
| 230 | Ga0265319_1012716 | 3300028563 | Bacteria | 3387 |
| 231 | Ga0265334_10000679 | 3300028573 | Bacteria | 17043 |
| 232 | Ga0265318_10001580 | 3300028577 | Bacteria | 13181 |
| 233 | Ga0265318_10157193 | 3300028577 | Bacteria | 834 |
| 234 | Ga0265322_10006107 | 3300028654 | Bacteria | 3549 |
| 235 | Ga0265322_10018353 | 3300028654 | Bacteria | 2011 |
| 236 | Ga0265336_10009197 | 3300028666 | Bacteria | 3426 |
| 237 | Ga0265338_10005145 | 3300028800 | Bacteria | 17221 |
| 238 | Ga0265338_10022691 | 3300028800 | Bacteria | 6482 |
| 239 | Ga0265338_10068766 | 3300028800 | Bacteria | 3048 |
| 240 | Ga0265324_10017690 | 3300029957 | Bacteria | 2592 |
| 241 | Ga0265330_10003515 | 3300031235 | Bacteria | 8164 |
| 242 | Ga0265332_10004470 | 3300031238 | Bacteria | 6554 |
| 243 | Ga0265328_10003815 | 3300031239 | Bacteria | 6624 |
| 244 | Ga0265320_10003022 | 3300031240 | Bacteria | 11460 |
| 245 | Ga0265320_10140255 | 3300031240 | Bacteria | 1095 |
| 246 | Ga0265325_10007381 | 3300031241 | Bacteria | 6582 |
| 247 | Ga0265329_10005179 | 3300031242 | Bacteria | 5303 |
| 248 | Ga0265340_10017158 | 3300031247 | Bacteria | 3744 |
| 249 | Ga0265339_10004787 | 3300031249 | Bacteria | 9165 |
| 250 | Ga0265339_10086963 | 3300031249 | Bacteria | 1643 |
| 251 | Ga0265331_10014887 | 3300031250 | Bacteria | 4125 |
| 252 | Ga0265327_10021997 | 3300031251 | Bacteria | 3829 |
| 253 | Ga0265327_10045002 | 3300031251 | Bacteria | 2348 |
| 254 | Ga0265316_10017157 | 3300031344 | Bacteria | 6265 |
| 255 | Ga0265316_10038639 | 3300031344 | Bacteria | 3842 |
| 256 | Ga0265313_10007506 | 3300031595 | Bacteria | 7427 |
| 257 | Ga0265314_10022143 | 3300031711 | Bacteria | 4871 |
| 258 | Ga0265314_10023325 | 3300031711 | Bacteria | 4719 |
| 259 | Ga0265314_10050670 | 3300031711 | Bacteria | 2896 |
| 260 | Ga0265314_10128540 | 3300031711 | Bacteria | 1584 |
| 261 | Ga0265342_10004174 | 3300031712 | Bacteria | 11498 |
| 262 | Ga0265342_10006365 | 3300031712 | Bacteria | 8803 |
| 263 | Ga0373926_0016182 | 3300035083 | Bacteria | 2549 |
| 264 | Ga0373952_0038615 | 3300035092 | Bacteria | 1094 |
| 265 | Ga0373923_0201087 | 3300035111 | Bacteria | 921 |
| 266 | Ga0373945_0052004 | 3300035116 | Bacteria | 1508 |
| 267 | Ga0373956_0152938 | 3300035119 | Bacteria | 1086 |
| 268 | Ga0373943_0003602 | 3300035170 | Bacteria | 7049 |
| 269 | Ga0373924_0132891 | 3300035410 | Bacteria | 1083 |
| 270 | Ga0373935_0047112 | 3300035692 | Bacteria | 2725 |
| 271 | Ga0373935_0069748 | 3300035692 | Bacteria | 2265 |
| 272 | Ga0373933_0063662 | 3300035724 | Bacteria | 2230 |
| 273 | Ga0373937_0001027 | 3300036401 | Bacteria | 23612 |
| 274 | Ga0373937_0207177 | 3300036401 | Bacteria | 1844 |
| 275 | Ga0373937_0374023 | 3300036401 | Bacteria | 1351 |
| 276 | Ga0373925_0322841 | 3300037068 | Bacteria | 1249 |
| 277 | Ga0395900_0211778 | 3300037418 | Bacteria | 1957 |
| 278 | Ga0395900_0582883 | 3300037418 | Bacteria | 1060 |
| 279 | Ga0395898_0024071 | 3300037466 | Bacteria | 6146 |
| 280 | Ga0395898_0445408 | 3300037466 | Bacteria | 1234 |
| 281 | Ga0395905_0511057 | 3300037471 | Bacteria | 1102 |
| 282 | Ga0395905_0950571 | 3300037471 | Bacteria | 762 |
| 283 | Ga0395901_0043481 | 3300038443 | Bacteria | 4660 |
| 284 | Ga0436360_0989015 | 3300039438 | Bacteria | 14852 |
| 285 | Ga0450920_003578 | 3300042122 | Bacteria | 2703 |
| 286 | Ga0450906_006388 | 3300042145 | Bacteria | 2381 |
| 287 | Ga0466969_0011062 | 3300044656 | Bacteria | 4778 |
| 288 | Ga0466969_0101838 | 3300044656 | Bacteria | 1351 |
| 289 | Ga0466965_0018905 | 3300044683 | Bacteria | 3307 |
| 290 | Ga0466965_0061642 | 3300044683 | Bacteria | 1875 |
| 291 | Ga0466966_0009037 | 3300044684 | Bacteria | 6602 |
| 292 | Ga0466966_0087654 | 3300044684 | Bacteria | 1934 |
| 293 | Ga0466966_0609149 | 3300044684 | Bacteria | 657 |
| 294 | Ga0466961_0007831 | 3300044693 | Bacteria | 6802 |
| 295 | Ga0466961_0009303 | 3300044693 | Bacteria | 6256 |
| 296 | Ga0466963_0000333 | 3300044694 | Bacteria | 21482 |
| 297 | Ga0466963_0002587 | 3300044694 | Bacteria | 10153 |
| 298 | Ga0466963_0006101 | 3300044694 | Bacteria | 7107 |
| 299 | Ga0466963_0010354 | 3300044694 | Bacteria | 5644 |
| 300 | Ga0466963_0011554 | 3300044694 | Bacteria | 5376 |
| 301 | Ga0466963_0017023 | 3300044694 | Bacteria | 4527 |
| 302 | Ga0466963_0030241 | 3300044694 | Bacteria | 3493 |
| 303 | Ga0466963_0032397 | 3300044694 | Bacteria | 3384 |
| 304 | Ga0466963_0039521 | 3300044694 | Bacteria | 3089 |
| 305 | Ga0466963_0121440 | 3300044694 | Bacteria | 1798 |
| 306 | Ga0466963_0223554 | 3300044694 | Bacteria | 1319 |
| 307 | Ga0466964_0015536 | 3300044706 | Bacteria | 2899 |
| 308 | Ga0466964_0020166 | 3300044706 | Bacteria | 2565 |
| 309 | Ga0466964_0075216 | 3300044706 | Bacteria | 1437 |
| 310 | Ga0466964_0083026 | 3300044706 | Bacteria | 1379 |
| 311 | Ga0466964_0120208 | 3300044706 | Bacteria | 1183 |
| 312 | Ga0466964_0235667 | 3300044706 | Bacteria | 895 |
| 313 | Ga0466971_0000446 | 3300044719 | Bacteria | 16156 |
| 314 | Ga0466971_0004771 | 3300044719 | Bacteria | 5864 |
| 315 | Ga0466971_0006466 | 3300044719 | Bacteria | 5091 |
| 316 | Ga0466971_0011623 | 3300044719 | Bacteria | 3854 |
| 317 | Ga0466971_0012207 | 3300044719 | Bacteria | 3763 |
| 318 | Ga0466971_0051569 | 3300044719 | Bacteria | 1852 |
| 319 | Ga0466968_0006794 | 3300044735 | Bacteria | 4327 |
| 320 | Ga0466968_0011247 | 3300044735 | Bacteria | 3485 |
| 321 | Ga0466968_0110616 | 3300044735 | Bacteria | 1235 |
| 322 | Ga0466970_0173893 | 3300044765 | Bacteria | 1194 |
| 323 | Ga0466957_0002093 | 3300044842 | Bacteria | 10677 |
| 324 | Ga0466957_0002407 | 3300044842 | Bacteria | 10043 |
| 325 | Ga0466957_0011232 | 3300044842 | Bacteria | 5158 |
| 326 | Ga0466957_0021209 | 3300044842 | Bacteria | 3827 |
| 327 | Ga0466957_0051591 | 3300044842 | Bacteria | 2504 |
| 328 | Ga0466957_0085178 | 3300044842 | Bacteria | 1974 |
| 329 | Ga0466957_0105625 | 3300044842 | Bacteria | 1780 |
| 330 | Ga0466957_0219402 | 3300044842 | Bacteria | 1255 |
| 331 | Ga0466957_0699571 | 3300044842 | Bacteria | 715 |
| 332 | Ga0466960_0014853 | 3300044901 | Bacteria | 3345 |
| 333 | Ga0466959_0019196 | 3300045049 | Bacteria | 5026 |
| 334 | Ga0466959_0030275 | 3300045049 | Bacteria | 4008 |
| 335 | Ga0466959_0052875 | 3300045049 | Bacteria | 2973 |
| 336 | Ga0466959_0074538 | 3300045049 | Bacteria | 2454 |
| 337 | Ga0466958_0001168 | 3300045836 | Bacteria | 12216 |
| 338 | Ga0466958_0003504 | 3300045836 | Bacteria | 8151 |
| 339 | Ga0466958_0004245 | 3300045836 | Bacteria | 7538 |
| 340 | Ga0466958_0004419 | 3300045836 | Bacteria | 7423 |
| 341 | Ga0466958_0011883 | 3300045836 | Bacteria | 4916 |
| 342 | Ga0466958_0016262 | 3300045836 | Bacteria | 4280 |
| 343 | Ga0466958_0017532 | 3300045836 | Bacteria | 4142 |
| 344 | Ga0466958_0127130 | 3300045836 | Bacteria | 1598 |
| 345 | Ga0466967_0000297 | 3300045976 | Bacteria | 22234 |
| 346 | Ga0466967_0005024 | 3300045976 | Bacteria | 9066 |
| 347 | Ga0466967_0019140 | 3300045976 | Bacteria | 5498 |
| 348 | Ga0466967_0054027 | 3300045976 | Bacteria | 3533 |
| 349 | Ga0466967_0076633 | 3300045976 | Bacteria | 3008 |
| 350 | Ga0466967_0081917 | 3300045976 | Bacteria | 2915 |
| 351 | Ga0466967_0099205 | 3300045976 | Bacteria | 2660 |
| 352 | Ga0466967_0117318 | 3300045976 | Bacteria | 2453 |
| 353 | Ga0466967_0560955 | 3300045976 | Bacteria | 1124 |
| 354 | Ga0466967_0689434 | 3300045976 | Bacteria | 1011 |
| 355 | Ga0466967_1376460 | 3300045976 | Bacteria | 703 |
| 356 | Ga0495592_0011160 | 3300046454 | Bacteria | 6784 |
| 357 | Ga0495592_0028377 | 3300046454 | Bacteria | 4239 |
| 358 | Ga0495592_0029922 | 3300046454 | Bacteria | 4119 |
| 359 | Ga0495592_0035034 | 3300046454 | Bacteria | 3783 |
| 360 | Ga0495592_0340983 | 3300046454 | Bacteria | 963 |
| 361 | Ga0495603_0268363 | 3300046455 | Bacteria | 982 |
| 362 | Ga0495629_0057504 | 3300046459 | Bacteria | 2719 |
| 363 | Ga0495629_0144504 | 3300046459 | Bacteria | 1655 |
| 364 | Ga0495629_0270969 | 3300046459 | Bacteria | 1166 |
| 365 | Ga0495629_0298738 | 3300046459 | Bacteria | 1103 |
| 366 | Ga0495629_0407239 | 3300046459 | Bacteria | 924 |
| 367 | Ga0495651_0011359 | 3300046462 | Bacteria | 6843 |
| 368 | Ga0495651_0150887 | 3300046462 | Bacteria | 1675 |
| 369 | Ga0495653_0011485 | 3300046463 | Bacteria | 7236 |
| 370 | Ga0495653_0018387 | 3300046463 | Bacteria | 5678 |
| 371 | Ga0495653_0086383 | 3300046463 | Bacteria | 2305 |
| 372 | Ga0495653_0164672 | 3300046463 | Bacteria | 1536 |
| 373 | Ga0495653_0384199 | 3300046463 | Bacteria | 896 |
| 374 | Ga0495580_0127560 | 3300046472 | Bacteria | 1766 |
| 375 | Ga0495582_0025768 | 3300046473 | Bacteria | 3221 |
| 376 | Ga0495582_0215748 | 3300046473 | Bacteria | 1097 |
| 377 | Ga0495662_0048496 | 3300046476 | Bacteria | 2050 |
| 378 | Ga0495664_0029948 | 3300046477 | Bacteria | 3186 |
| 379 | Ga0495664_0036078 | 3300046477 | Bacteria | 2913 |
| 380 | Ga0495664_0056251 | 3300046477 | Bacteria | 2340 |
| 381 | Ga0495664_0084738 | 3300046477 | Bacteria | 1902 |
| 382 | Ga0495594_0160452 | 3300046499 | Bacteria | 1278 |
| 383 | Ga0495608_0002831 | 3300046511 | Bacteria | 12429 |
| 384 | Ga0495608_0023014 | 3300046511 | Bacteria | 4272 |
| 385 | Ga0495608_0164315 | 3300046511 | Bacteria | 1410 |
| 386 | Ga0495608_0371733 | 3300046511 | Bacteria | 877 |
| 387 | Ga0495618_0011658 | 3300046514 | Bacteria | 5333 |
| 388 | Ga0495618_0044065 | 3300046514 | Bacteria | 2814 |
| 389 | Ga0495618_0212302 | 3300046514 | Bacteria | 1223 |
| 390 | Ga0495628_0079207 | 3300046516 | Bacteria | 2554 |
| 391 | Ga0495630_0079325 | 3300046517 | Bacteria | 2476 |
| 392 | Ga0495631_0062149 | 3300046518 | Bacteria | 1619 |
| 393 | Ga0495644_0078384 | 3300046523 | Bacteria | 1245 |
| 394 | Ga0495644_0120444 | 3300046523 | Bacteria | 998 |
| 395 | Ga0495666_0011855 | 3300046526 | Bacteria | 4348 |
| 396 | Ga0495652_0000187 | 3300046529 | Bacteria | 70410 |
| 397 | Ga0495652_0084780 | 3300046529 | Bacteria | 2605 |
| 398 | Ga0495652_0102638 | 3300046529 | Bacteria | 2316 |
| 399 | Ga0495652_0144436 | 3300046529 | Bacteria | 1867 |
| 400 | Ga0495652_0158283 | 3300046529 | Bacteria | 1761 |
| 401 | Ga0495665_0070986 | 3300046531 | Bacteria | 1834 |
| 402 | Ga0495640_0018982 | 3300046533 | Bacteria | 5085 |
| 403 | Ga0495640_0053648 | 3300046533 | Bacteria | 2763 |
| 404 | Ga0495640_0106137 | 3300046533 | Bacteria | 1840 |
| 405 | Ga0495586_0044790 | 3300046535 | Bacteria | 2383 |
| 406 | Ga0495586_0300540 | 3300046535 | Bacteria | 920 |
| 407 | Ga0495587_0006018 | 3300046536 | Bacteria | 7907 |
| 408 | Ga0495587_0048583 | 3300046536 | Bacteria | 2512 |
| 409 | Ga0495645_0003018 | 3300046543 | Bacteria | 11385 |
| 410 | Ga0495645_0012459 | 3300046543 | Bacteria | 5992 |
| 411 | Ga0495645_0225891 | 3300046543 | Bacteria | 1256 |
| 412 | Ga0495667_0009311 | 3300046559 | Bacteria | 6656 |
| 413 | Ga0495667_0024762 | 3300046559 | Bacteria | 4042 |
| 414 | Ga0495634_0155432 | 3300046642 | Bacteria | 1444 |
| 415 | Ga0495634_0193375 | 3300046642 | Bacteria | 1267 |
| 416 | Ga0495635_0040119 | 3300046663 | Bacteria | 3236 |
| 417 | Ga0495635_0049872 | 3300046663 | Bacteria | 2885 |
| 418 | Ga0495635_0143030 | 3300046663 | Bacteria | 1629 |
| 419 | Ga0495588_0116321 | 3300046674 | Bacteria | 1409 |
| 420 | Ga0495588_0213134 | 3300046674 | Bacteria | 1020 |
| 421 | Ga0495657_0048890 | 3300046675 | Bacteria | 2852 |
| 422 | Ga0495599_0000196 | 3300046678 | Bacteria | 40261 |
| 423 | Ga0495599_0028185 | 3300046678 | Bacteria | 3519 |
| 424 | Ga0495599_0036200 | 3300046678 | Bacteria | 3098 |
| 425 | Ga0495599_0324555 | 3300046678 | Bacteria | 926 |
| 426 | Ga0495623_0000045 | 3300046679 | Bacteria | 76108 |
| 427 | Ga0495623_0022977 | 3300046679 | Bacteria | 4026 |
| 428 | Ga0495646_0000489 | 3300046680 | Bacteria | 21129 |
| 429 | Ga0495646_0106108 | 3300046680 | Bacteria | 1604 |
| 430 | Ga0495658_0166199 | 3300046683 | Bacteria | 1363 |
| 431 | Ga0495613_0005875 | 3300046689 | Bacteria | 9185 |
| 432 | Ga0495613_0262914 | 3300046689 | Bacteria | 1202 |
| 433 | Ga0495624_0035503 | 3300046690 | Bacteria | 3219 |
| 434 | Ga0495589_0026133 | 3300046794 | Bacteria | 2960 |
| 435 | Ga0495589_0109028 | 3300046794 | Bacteria | 1337 |
| 436 | Ga0495600_0014173 | 3300046809 | Bacteria | 5022 |
| 437 | Ga0495600_0170458 | 3300046809 | Bacteria | 1405 |
| 438 | Ga0495581_0199398 | 3300047315 | Bacteria | 1171 |
| 439 | Ga0495604_0000221 | 3300047317 | Bacteria | 52090 |
| 440 | Ga0495604_0029270 | 3300047317 | Bacteria | 4381 |
| 441 | Ga0495604_0492228 | 3300047317 | Bacteria | 796 |
| 442 | Ga0495674_0098948 | 3300047319 | Bacteria | 2483 |
| 443 | Ga0495674_0140418 | 3300047319 | Bacteria | 2031 |
| 444 | Ga0495674_0153138 | 3300047319 | Bacteria | 1932 |
| 445 | Ga0495674_0198050 | 3300047319 | Bacteria | 1667 |
| 446 | Ga0495676_0047688 | 3300047321 | Bacteria | 3460 |
| 447 | Ga0495680_0006615 | 3300047322 | Bacteria | 10749 |
| 448 | Ga0495680_0031451 | 3300047322 | Bacteria | 4320 |
| 449 | Ga0495680_0081409 | 3300047322 | Bacteria | 2444 |
| 450 | Ga0495680_0110533 | 3300047322 | Bacteria | 2037 |
| 451 | Ga0495680_0185852 | 3300047322 | Bacteria | 1497 |
| 452 | Ga0495675_0000301 | 3300047444 | Bacteria | 35499 |
| 453 | Ga0495684_0003566 | 3300047471 | Bacteria | 12147 |
| 454 | Ga0495684_0069065 | 3300047471 | Bacteria | 2686 |
| 455 | Ga0495602_0000515 | 3300048088 | Bacteria | 36065 |
| 456 | Ga0495602_0122357 | 3300048088 | Bacteria | 2091 |
| 457 | Ga0495614_0002862 | 3300048089 | Bacteria | 7673 |
| 458 | Ga0496100_0006416 | 3300048903 | Bacteria | 6409 |
| 459 | Ga0496100_0025081 | 3300048903 | Bacteria | 3643 |
| 460 | Ga0496100_0303552 | 3300048903 | Bacteria | 1195 |
| 461 | Ga0496101_0006449 | 3300048904 | Bacteria | 7549 |
| 462 | Ga0496102_0020359 | 3300048905 | Bacteria | 5863 |
| 463 | Ga0496102_0036207 | 3300048905 | Bacteria | 4445 |
| 464 | Ga0496102_0051477 | 3300048905 | Bacteria | 3752 |
| 465 | Ga0496103_0012623 | 3300048906 | Bacteria | 5011 |
| 466 | Ga0496103_0031239 | 3300048906 | Bacteria | 3244 |
| 467 | Ga0496103_0131982 | 3300048906 | Bacteria | 1595 |
| 468 | Ga0496104_0011272 | 3300048907 | Bacteria | 8002 |
| 469 | Ga0496104_0013441 | 3300048907 | Bacteria | 7377 |
| 470 | Ga0496104_0353416 | 3300048907 | Bacteria | 1382 |
| 471 | Ga0496105_0008808 | 3300048908 | Bacteria | 7857 |
| 472 | Ga0496105_0019849 | 3300048908 | Bacteria | 5422 |
| 473 | Ga0496105_0073144 | 3300048908 | Bacteria | 2832 |
| 474 | Ga0496105_0143635 | 3300048908 | Bacteria | 1963 |
| 475 | Ga0496105_0151924 | 3300048908 | Bacteria | 1903 |
| 476 | Ga0496105_0347970 | 3300048908 | Bacteria | 1184 |
| 477 | Ga0496106_0066164 | 3300048909 | Bacteria | 2752 |
| 478 | Ga0496106_0191662 | 3300048909 | Bacteria | 1625 |
| 479 | Ga0496106_0192652 | 3300048909 | Bacteria | 1621 |
| 480 | Ga0496108_0027598 | 3300048911 | Bacteria | 4691 |
| 481 | Ga0496108_0072695 | 3300048911 | Bacteria | 2903 |
| 482 | Ga0496108_0126970 | 3300048911 | Bacteria | 2190 |
| 483 | Ga0496108_0191634 | 3300048911 | Bacteria | 1772 |
| 484 | Ga0496108_0382580 | 3300048911 | Bacteria | 1229 |
| 485 | Ga0496109_0003943 | 3300048912 | Bacteria | 12398 |
| 486 | Ga0496109_0018128 | 3300048912 | Bacteria | 6182 |
| 487 | Ga0496109_0043794 | 3300048912 | Bacteria | 4058 |
| 488 | Ga0496109_0102352 | 3300048912 | Bacteria | 2658 |
| 489 | Ga0496109_0163682 | 3300048912 | Bacteria | 2084 |
| 490 | Ga0496109_0256996 | 3300048912 | Bacteria | 1645 |
| 491 | Ga0496109_0281688 | 3300048912 | Bacteria | 1567 |
| 492 | Ga0496109_0291095 | 3300048912 | Bacteria | 1540 |
| 493 | Ga0496109_0321686 | 3300048912 | Bacteria | 1460 |
| 494 | Ga0496109_0498388 | 3300048912 | Bacteria | 1150 |
| 495 | Ga0496110_0003644 | 3300048913 | Bacteria | 11849 |
| 496 | Ga0496110_0030595 | 3300048913 | Bacteria | 4641 |
| 497 | Ga0496110_0060364 | 3300048913 | Bacteria | 3344 |
| 498 | Ga0496110_0313219 | 3300048913 | Bacteria | 1429 |
| 499 | Ga0496111_0006372 | 3300048914 | Bacteria | 7659 |
| 500 | Ga0496111_0032136 | 3300048914 | Bacteria | 3742 |
| 501 | Ga0496111_0090430 | 3300048914 | Bacteria | 2242 |
| 502 | Ga0496111_0187727 | 3300048914 | Bacteria | 1537 |
| 503 | Ga0496112_0009540 | 3300048915 | Bacteria | 8754 |
| 504 | Ga0496112_0034969 | 3300048915 | Bacteria | 4890 |
| 505 | Ga0496112_0132126 | 3300048915 | Bacteria | 2467 |
| 506 | Ga0496112_0657391 | 3300048915 | Bacteria | 977 |
| 507 | Ga0496113_0014117 | 3300048916 | Bacteria | 5438 |
| 508 | Ga0496113_0056964 | 3300048916 | Bacteria | 2935 |
| 509 | Ga0496113_0064547 | 3300048916 | Bacteria | 2769 |
| 510 | Ga0496113_0068754 | 3300048916 | Bacteria | 2688 |
| 511 | Ga0496113_0203534 | 3300048916 | Bacteria | 1574 |
| 512 | Ga0496114_0069425 | 3300048917 | Bacteria | 2959 |
| 513 | Ga0496114_0204961 | 3300048917 | Bacteria | 1728 |
| 514 | Ga0496114_0243444 | 3300048917 | Bacteria | 1582 |
| 515 | Ga0496114_0253645 | 3300048917 | Bacteria | 1548 |
| 516 | Ga0496115_0004119 | 3300048918 | Bacteria | 10495 |
| 517 | Ga0496115_0009199 | 3300048918 | Bacteria | 7334 |
| 518 | Ga0496115_0178350 | 3300048918 | Bacteria | 1757 |
| 519 | Ga0496115_0474913 | 3300048918 | Bacteria | 1007 |
| 520 | Ga0496126_0229107 | 3300048929 | Bacteria | 1557 |
| 521 | Ga0501031_0076311 | 3300049568 | Bacteria | 2182 |
| 522 | Ga0501031_0228616 | 3300049568 | Bacteria | 1211 |
| 523 | Ga0501033_0454977 | 3300049570 | Bacteria | 889 |
| 524 | Ga0501036_0008839 | 3300049572 | Bacteria | 8270 |
| 525 | Ga0501036_0403103 | 3300049572 | Bacteria | 1141 |
| 526 | Ga0501039_0081823 | 3300049575 | Bacteria | 2514 |
| 527 | Ga0501040_0008080 | 3300049576 | Bacteria | 6833 |
| 528 | Ga0501041_0025193 | 3300049577 | Bacteria | 3576 |
| 529 | Ga0501042_0007646 | 3300049578 | Bacteria | 7091 |
| 530 | Ga0501042_0048798 | 3300049578 | Bacteria | 3019 |
| 531 | Ga0501042_0191444 | 3300049578 | Bacteria | 1475 |
| 532 | Ga0501046_0071449 | 3300049580 | Bacteria | 2697 |
| 533 | Ga0501048_0265665 | 3300049582 | Bacteria | 1219 |
| 534 | Ga0501068_0076808 | 3300049584 | Bacteria | 2045 |
| 535 | Ga0501069_0162470 | 3300049585 | Bacteria | 1286 |
| 536 | Ga0501071_0003413 | 3300049587 | Bacteria | 9927 |
| 537 | Ga0501071_0117235 | 3300049587 | Bacteria | 1972 |
| 538 | Ga0501071_0490991 | 3300049587 | Bacteria | 941 |
| 539 | Ga0501072_0183023 | 3300049588 | Bacteria | 1671 |
| 540 | Ga0501074_0405162 | 3300049590 | Bacteria | 967 |
| 541 | Ga0501075_0128541 | 3300049591 | Bacteria | 1929 |
| 542 | Ga0501075_0448082 | 3300049591 | Bacteria | 984 |
| 543 | Ga0501076_0027524 | 3300049592 | Bacteria | 4408 |
| 544 | Ga0501077_0029788 | 3300049593 | Bacteria | 3471 |
| 545 | Ga0501079_0008087 | 3300049741 | Bacteria | 7966 |
| 546 | Ga0501079_0070516 | 3300049741 | Bacteria | 2699 |
| 547 | Ga0501079_0088419 | 3300049741 | Bacteria | 2399 |
| 548 | Ga0501081_0043878 | 3300049743 | Bacteria | 3068 |
| 549 | Ga0501035_0072296 | 3300049822 | Bacteria | 3053 |
| 550 | Ga0501035_0403306 | 3300049822 | Bacteria | 1137 |
| 551 | Ga0501045_0014561 | 3300049824 | Bacteria | 5574 |
| 552 | Ga0501045_0193935 | 3300049824 | Bacteria | 1514 |
| 553 | nmdc:mga00v17_203765_c1 | 3300050491 | Bacteria | 1279 |
| 554 | nmdc:mga0yw44_388988_c1 | 3300050492 | Bacteria | 942 |
| 555 | nmdc:mga0n895_15422_c1 | 3300050512 | Bacteria | 6967 |
| 556 | nmdc:mga0rr50_139061_c1 | 3300050513 | Bacteria | 1952 |
| 557 | nmdc:mga08x19_65888_c1 | 3300050514 | Bacteria | 2353 |
| 558 | Ga0495601_0011380 | 3300053077 | Bacteria | 5319 |
| 559 | Ga0495601_0023210 | 3300053077 | Bacteria | 3811 |
| 560 | Ga0495601_0091859 | 3300053077 | Bacteria | 1954 |
| 561 | Ga0495601_0453318 | 3300053077 | Bacteria | 829 |
| 562 | Ga0495612_0045168 | 3300053078 | Bacteria | 1803 |
| 563 | Ga0495612_0082517 | 3300053078 | Bacteria | 1352 |
| 564 | Ga0495612_0157565 | 3300053078 | Bacteria | 990 |
| 565 | Ga0495655_0073302 | 3300053083 | Bacteria | 962 |
| 566 | Ga0495595_0039409 | 3300053084 | Bacteria | 2155 |
| 567 | Ga0495595_0127264 | 3300053084 | Bacteria | 1243 |
| 568 | Ga0495619_0014836 | 3300053085 | Bacteria | 4922 |
| 569 | Ga0495619_0030023 | 3300053085 | Bacteria | 3517 |
| 570 | Ga0495619_0060635 | 3300053085 | Bacteria | 2515 |
| 571 | Ga0495619_0233113 | 3300053085 | Bacteria | 1275 |
| 572 | Ga0501084_0103478 | 3300054114 | Bacteria | 2391 |
| 573 | Ga0501082_0081914 | 3300060353 | Bacteria | 2785 |
| 574 | Ga0501082_0110666 | 3300060353 | Bacteria | 2377 |
| 575 | Ga0501082_0259023 | 3300060353 | Bacteria | 1513 |
| 576 | Ga0466962_0002059 | 3300061719 | Bacteria | 9523 |
| 577 | Ga0466962_0032746 | 3300061719 | Bacteria | 2487 |
| 578 | Ga0466962_0038099 | 3300061719 | Bacteria | 2303 |
| 579 | Ga0466962_0093981 | 3300061719 | Bacteria | 1437 |
| 580 | Ga0530510_0149957 | 3300061734 | Bacteria | 1721 |
| 581 | Ga0530510_0183469 | 3300061734 | Bacteria | 1552 |
| 582 | 2881852912 | 2881845957 | Bacteria | 6611900 |
| 583 | 2888352444 | 2888350351 | Bacteria | 7372807 |
| 584 | 2906358070 | 2906354277 | Bacteria | 6991324 |
| 585 | 2922134957 | 2922130491 | Bacteria | 7173936 |
| 586 | 2922191021 | 2922185730 | Bacteria | 7113964 |
| 587 | 2967998982 | 2967996073 | Bacteria | 6787468 |
| 588 | 2977976066 | 2977971508 | Bacteria | 7472917 |
| 589 | 2979747973 | 2979742915 | Bacteria | 7301278 |
| 590 | Ga0105249_10707698 | |||
| 591 | JGI25406J46586_10005629 | |||
| 592 | JGI25165J46597_1000020 | |||
| 593 | Ga0070658_10051336 | |||
| 594 | Ga0070683_100066478 | |||
| 595 | Ga0070683_100142312 | |||
| 596 | Ga0070683_100145952 | |||
| 597 | Ga0070683_100191154 | |||
| 598 | Ga0070683_100851920 | |||
| 599 | Ga0070670_100456640 | |||
| 600 | Ga0070680_100013449 | |||
| 601 | Ga0070680_100159353 | |||
| 602 | Ga0070680_100405278 | |||
| 603 | Ga0070682_100020112 | |||
| 604 | Ga0070682_100044924 | |||
| 605 | Ga0070682_100347294 | |||
| 606 | Ga0068868_100485422 | |||
| 607 | Ga0070660_100457365 | |||
| 608 | Ga0070689_100420941 | |||
| 609 | Ga0070661_100189858 | |||
| 610 | Ga0070661_100417032 | |||
| 611 | Ga0070671_100155149 | |||
| 612 | Ga0070671_100278337 | |||
| 613 | Ga0070674_100062151 | |||
| 614 | Ga0070674_100126186 | |||
| 615 | Ga0070659_100029859 | |||
| 616 | Ga0070659_100068073 | |||
| 617 | Ga0070709_10011697 | |||
| 618 | Ga0070709_10039618 | |||
| 619 | Ga0070714_100015294 | |||
| 620 | Ga0070714_100033226 | |||
| 621 | Ga0070714_100046287 | |||
| 622 | Ga0070714_100309715 | |||
| 623 | Ga0070713_100013329 | |||
| 624 | Ga0070713_100664749 | |||
| 625 | Ga0070710_10011548 | |||
| 626 | Ga0070711_100075992 | |||
| 627 | Ga0070711_100350041 | |||
| 628 | Ga0070705_100142892 | |||
| 629 | Ga0070700_100366715 | |||
| 630 | Ga0070708_100311814 | |||
| 631 | Ga0070708_100410553 | |||
| 632 | Ga0070663_100234884 | |||
| 633 | Ga0070678_100098413 | |||
| 634 | Ga0070681_10004844 | |||
| 635 | Ga0070681_10008276 | |||
| 636 | Ga0070681_10063813 | |||
| 637 | Ga0070681_10077807 | |||
| 638 | Ga0068867_100669477 | |||
| 639 | Ga0070685_10017372 | |||
| 640 | Ga0070706_100037610 | |||
| 641 | Ga0070707_100006284 | |||
| 642 | Ga0070707_100038254 | |||
| 643 | Ga0070707_100687317 | |||
| 644 | Ga0070698_100070736 | |||
| 645 | Ga0070698_100138695 | |||
| 646 | Ga0070699_100053688 | |||
| 647 | Ga0070679_100095560 | |||
| 648 | Ga0070679_100120328 | |||
| 649 | Ga0070684_100110476 | |||
| 650 | Ga0070684_100286271 | |||
| 651 | Ga0070684_100609756 | |||
| 652 | Ga0070672_100347049 | |||
| 653 | Ga0070695_100003825 | |||
| 654 | Ga0070693_100127036 | |||
| 655 | Ga0070665_100250231 | |||
| 656 | Ga0070704_100014855 | |||
| 657 | Ga0068855_100212765 | |||
| 658 | Ga0068855_100244002 | |||
| 659 | Ga0068855_100687564 | |||
| 660 | Ga0070664_100109499 | |||
| 661 | Ga0070664_100143673 | |||
| 662 | Ga0070664_100252202 | |||
| 663 | Ga0070664_100480622 | |||
| 664 | Ga0068857_100093854 | |||
| 665 | Ga0068854_100078102 | |||
| 666 | Ga0068856_100003371 | |||
| 667 | Ga0068856_100120042 | |||
| 668 | Ga0068856_100147829 | |||
| 669 | Ga0070702_100346363 | |||
| 670 | Ga0068852_100344612 | |||
| 671 | Ga0068864_100899953 | |||
| 672 | Ga0068866_10055249 | |||
| 673 | Ga0068870_10087154 | |||
| 674 | Ga0068860_100071131 | |||
| 675 | Ga0068860_100167995 | |||
| 676 | Ga0068860_100549322 | |||
| 677 | Ga0081455_10020423 | |||
| 678 | Ga0081538_10038887 | |||
| 679 | Ga0081539_10000288 | |||
| 680 | Ga0070717_10017472 | |||
| 681 | Ga0070717_10041661 | |||
| 682 | Ga0070717_10071119 | |||
| 683 | Ga0070717_10186924 | |||
| 684 | Ga0075365_10034751 | |||
| 685 | Ga0075365_10172015 | |||
| 686 | Ga0075365_10441618 | |||
| 687 | Ga0075364_10129881 | |||
| 688 | Ga0075364_10265981 | |||
| 689 | Ga0070715_10002907 | |||
| 690 | Ga0070716_100018225 | |||
| 691 | Ga0070716_100046987 | |||
| 692 | Ga0070712_100017760 | |||
| 693 | Ga0070712_100020338 | |||
| 694 | Ga0070712_100261281 | |||
| 695 | Ga0097621_100012081 | |||
| 696 | Ga0097621_100157418 | |||
| 697 | Ga0068871_100013798 | |||
| 698 | Ga0068871_100771077 | |||
| 699 | Ga0075434_100032199 | |||
| 700 | Ga0075436_100024693 | |||
| 701 | Ga0075436_100031849 | |||
| 702 | Ga0075436_100224293 | |||
| 703 | Ga0097620_100168157 | |||
| 704 | Ga0075435_100220398 | |||
| 705 | Ga0105240_10032220 | |||
| 706 | Ga0105240_10512096 | |||
| 707 | Ga0105245_10064332 | |||
| 708 | Ga0105245_10303161 | |||
| 709 | Ga0105245_10444849 | |||
| 710 | Ga0105247_10049603 | |||
| 711 | Ga0105243_10016623 | |||
| 712 | Ga0105241_10011364 | |||
| 713 | Ga0105242_10015122 | |||
| 714 | Ga0105242_10017818 | |||
| 715 | Ga0105242_10376789 | |||
| 716 | Ga0105242_10669783 | |||
| 717 | Ga0105248_10421451 | |||
| 718 | Ga0105248_10436482 | |||
| 719 | Ga0105237_10026808 | |||
| 720 | Ga0105238_10077066 | |||
| 721 | Ga0105249_10336538 | |||
| 722 | Ga0105239_10064774 | |||
| 723 | Ga0105239_10778151 | |||
| 724 | Ga0105246_10012799 | |||
| 725 | Ga0105246_10132289 | |||
| 726 | Ga0105246_10138737 | |||
| 727 | Ga0105246_10145182 | |||
| 728 | Ga0157369_10049222 | |||
| 729 | Ga0157369_10819606 | |||
| 730 | Ga0157374_10047242 | |||
| 731 | Ga0157374_10876806 | |||
| 732 | Ga0157378_10015965 | |||
| 733 | Ga0157378_10588061 | |||
| 734 | Ga0157372_10017920 | |||
| 735 | Ga0157372_10184504 | |||
| 736 | Ga0157372_10450272 | |||
| 737 | Ga0157375_10159309 | |||
| 738 | Ga0157375_10327278 | |||
| 739 | Ga0163163_10926546 | |||
| 740 | Ga0157380_10031894 | |||
| 741 | Ga0157379_10020818 | |||
| 742 | Ga0157379_10178033 | |||
| 743 | Ga0157379_10225629 | |||
| 744 | Ga0157376_10003286 | |||
| 745 | Ga0157376_10010143 | |||
| 746 | Ga0157376_10150827 | |||
| 747 | Ga0213871_10009099 | |||
| 748 | Ga0209233_1000047 | |||
| 749 | Ga0207692_10010323 | |||
| 750 | Ga0207688_10305107 | |||
| 751 | Ga0207685_10016858 | |||
| 752 | Ga0207699_10048701 | |||
| 753 | Ga0207643_10056830 | |||
| 754 | Ga0207643_10329208 | |||
| 755 | Ga0207705_10602750 | |||
| 756 | Ga0207684_10098639 | |||
| 757 | Ga0207654_10040756 | |||
| 758 | Ga0207654_10154603 | |||
| 759 | Ga0207707_10385574 | |||
| 760 | Ga0207707_10638219 | |||
| 761 | Ga0207695_10551730 | |||
| 762 | Ga0207671_10519010 | |||
| 763 | Ga0207693_10000818 | |||
| 764 | Ga0207693_10008617 | |||
| 765 | Ga0207663_10091098 | |||
| 766 | Ga0207660_10023172 | |||
| 767 | Ga0207660_10203961 | |||
| 768 | Ga0207660_10476525 | |||
| 769 | Ga0207662_10528817 | |||
| 770 | Ga0207652_10098672 | |||
| 771 | Ga0207652_10186132 | |||
| 772 | Ga0207646_10003389 | |||
| 773 | Ga0207646_10594287 | |||
| 774 | Ga0207650_10406519 | |||
| 775 | Ga0207659_10212611 | |||
| 776 | Ga0207687_10200621 | |||
| 777 | Ga0207687_10736799 | |||
| 778 | Ga0207700_10018613 | |||
| 779 | Ga0207700_10100122 | |||
| 780 | Ga0207700_10658261 | |||
| 781 | Ga0207664_10006143 | |||
| 782 | Ga0207664_10007134 | |||
| 783 | Ga0207664_10008819 | |||
| 784 | Ga0207664_10036124 | |||
| 785 | Ga0207664_10119608 | |||
| 786 | Ga0207664_10199802 | |||
| 787 | Ga0207686_10017712 | |||
| 788 | Ga0207686_10024720 | |||
| 789 | Ga0207686_10032296 | |||
| 790 | Ga0207686_10180395 | |||
| 791 | Ga0207709_10358068 | |||
| 792 | Ga0207669_10196577 | |||
| 793 | Ga0207704_10070519 | |||
| 794 | Ga0207665_10003767 | |||
| 795 | Ga0207665_10088985 | |||
| 796 | Ga0207691_10065970 | |||
| 797 | Ga0207691_10494565 | |||
| 798 | Ga0207711_10691453 | |||
| 799 | Ga0207661_10000903 | |||
| 800 | Ga0207661_10031097 | |||
| 801 | Ga0207661_10080274 | |||
| 802 | Ga0207679_10175490 | |||
| 803 | Ga0207651_10126862 | |||
| 804 | Ga0207677_10761812 | |||
| 805 | Ga0207708_10018841 | |||
| 806 | Ga0207648_10042113 | |||
| 807 | Ga0207674_10021350 | |||
| 808 | Ga0207683_10000244 | |||
| 809 | Ga0207683_10020966 | |||
| 810 | Ga0207683_10507707 | |||
| 811 | Ga0207683_10747737 | |||
| 812 | Ga0207698_10093431 | |||
| 813 | Ga0268266_10342368 | |||
| 814 | Ga0268264_10241511 | |||
| 815 | Ga0268264_10470739 | |||
| 816 | Ga0265326_10038811 | |||
| 817 | Ga0265319_1001131 | |||
| 818 | Ga0265319_1003410 | |||
| 819 | Ga0265319_1012716 | |||
| 820 | Ga0265334_10000679 | |||
| 821 | Ga0265318_10001580 | |||
| 822 | Ga0265318_10157193 | |||
| 823 | Ga0265322_10006107 | |||
| 824 | Ga0265322_10018353 | |||
| 825 | Ga0265336_10009197 | |||
| 826 | Ga0265338_10005145 | |||
| 827 | Ga0265338_10022691 | |||
| 828 | Ga0265338_10068766 | |||
| 829 | Ga0265324_10017690 | |||
| 830 | Ga0265330_10003515 | |||
| 831 | Ga0265332_10004470 | |||
| 832 | Ga0265328_10003815 | |||
| 833 | Ga0265320_10003022 | |||
| 834 | Ga0265320_10140255 | |||
| 835 | Ga0265325_10007381 | |||
| 836 | Ga0265329_10005179 | |||
| 837 | Ga0265340_10017158 | |||
| 838 | Ga0265339_10004787 | |||
| 839 | Ga0265339_10086963 | |||
| 840 | Ga0265331_10014887 | |||
| 841 | Ga0265327_10021997 | |||
| 842 | Ga0265327_10045002 | |||
| 843 | Ga0265316_10017157 | |||
| 844 | Ga0265316_10038639 | |||
| 845 | Ga0265313_10007506 | |||
| 846 | Ga0265314_10022143 | |||
| 847 | Ga0265314_10023325 | |||
| 848 | Ga0265314_10050670 | |||
| 849 | Ga0265314_10128540 | |||
| 850 | Ga0265342_10004174 | |||
| 851 | Ga0265342_10006365 | |||
| 852 | Ga0373926_0016182 | |||
| 853 | Ga0373952_0038615 | |||
| 854 | Ga0373923_0201087 | |||
| 855 | Ga0373945_0052004 | |||
| 856 | Ga0373956_0152938 | |||
| 857 | Ga0373943_0003602 | |||
| 858 | Ga0373924_0132891 | |||
| 859 | Ga0373935_0047112 | |||
| 860 | Ga0373935_0069748 | |||
| 861 | Ga0373933_0063662 | |||
| 862 | Ga0373937_0001027 | |||
| 863 | Ga0373937_0207177 | |||
| 864 | Ga0373937_0374023 | |||
| 865 | Ga0373925_0322841 | |||
| 866 | Ga0395900_0211778 | |||
| 867 | Ga0395900_0582883 | |||
| 868 | Ga0395898_0024071 | |||
| 869 | Ga0395898_0445408 | |||
| 870 | Ga0395905_0511057 | |||
| 871 | Ga0395905_0950571 | |||
| 872 | Ga0395901_0043481 | |||
| 873 | Ga0436360_0989015 | |||
| 874 | Ga0450920_003578 | |||
| 875 | Ga0450906_006388 | |||
| 876 | Ga0466969_0011062 | |||
| 877 | Ga0466969_0101838 | |||
| 878 | Ga0466965_0018905 | |||
| 879 | Ga0466965_0061642 | |||
| 880 | Ga0466966_0009037 | |||
| 881 | Ga0466966_0087654 | |||
| 882 | Ga0466966_0609149 | |||
| 883 | Ga0466961_0007831 | |||
| 884 | Ga0466961_0009303 | |||
| 885 | Ga0466963_0000333 | |||
| 886 | Ga0466963_0002587 | |||
| 887 | Ga0466963_0006101 | |||
| 888 | Ga0466963_0010354 | |||
| 889 | Ga0466963_0011554 | |||
| 890 | Ga0466963_0017023 | |||
| 891 | Ga0466963_0030241 | |||
| 892 | Ga0466963_0032397 | |||
| 893 | Ga0466963_0039521 | |||
| 894 | Ga0466963_0121440 | |||
| 895 | Ga0466963_0223554 | |||
| 896 | Ga0466964_0015536 | |||
| 897 | Ga0466964_0020166 | |||
| 898 | Ga0466964_0075216 | |||
| 899 | Ga0466964_0083026 | |||
| 900 | Ga0466964_0120208 | |||
| 901 | Ga0466964_0235667 | |||
| 902 | Ga0466971_0000446 | |||
| 903 | Ga0466971_0004771 | |||
| 904 | Ga0466971_0006466 | |||
| 905 | Ga0466971_0011623 | |||
| 906 | Ga0466971_0012207 | |||
| 907 | Ga0466971_0051569 | |||
| 908 | Ga0466968_0006794 | |||
| 909 | Ga0466968_0011247 | |||
| 910 | Ga0466968_0110616 | |||
| 911 | Ga0466970_0173893 | |||
| 912 | Ga0466957_0002093 | |||
| 913 | Ga0466957_0002407 | |||
| 914 | Ga0466957_0011232 | |||
| 915 | Ga0466957_0021209 | |||
| 916 | Ga0466957_0051591 | |||
| 917 | Ga0466957_0085178 | |||
| 918 | Ga0466957_0105625 | |||
| 919 | Ga0466957_0219402 | |||
| 920 | Ga0466957_0699571 | |||
| 921 | Ga0466960_0014853 | |||
| 922 | Ga0466959_0019196 | |||
| 923 | Ga0466959_0030275 | |||
| 924 | Ga0466959_0052875 | |||
| 925 | Ga0466959_0074538 | |||
| 926 | Ga0466958_0001168 | |||
| 927 | Ga0466958_0003504 | |||
| 928 | Ga0466958_0004245 | |||
| 929 | Ga0466958_0004419 | |||
| 930 | Ga0466958_0011883 | |||
| 931 | Ga0466958_0016262 | |||
| 932 | Ga0466958_0017532 | |||
| 933 | Ga0466958_0127130 | |||
| 934 | Ga0466967_0000297 | |||
| 935 | Ga0466967_0005024 | |||
| 936 | Ga0466967_0019140 | |||
| 937 | Ga0466967_0054027 | |||
| 938 | Ga0466967_0076633 | |||
| 939 | Ga0466967_0081917 | |||
| 940 | Ga0466967_0099205 | |||
| 941 | Ga0466967_0117318 | |||
| 942 | Ga0466967_0560955 | |||
| 943 | Ga0466967_0689434 | |||
| 944 | Ga0466967_1376460 | |||
| 945 | Ga0495592_0011160 | |||
| 946 | Ga0495592_0028377 | |||
| 947 | Ga0495592_0029922 | |||
| 948 | Ga0495592_0035034 | |||
| 949 | Ga0495592_0340983 | |||
| 950 | Ga0495603_0268363 | |||
| 951 | Ga0495629_0057504 | |||
| 952 | Ga0495629_0144504 | |||
| 953 | Ga0495629_0270969 | |||
| 954 | Ga0495629_0298738 | |||
| 955 | Ga0495629_0407239 | |||
| 956 | Ga0495651_0011359 | |||
| 957 | Ga0495651_0150887 | |||
| 958 | Ga0495653_0011485 | |||
| 959 | Ga0495653_0018387 | |||
| 960 | Ga0495653_0086383 | |||
| 961 | Ga0495653_0164672 | |||
| 962 | Ga0495653_0384199 | |||
| 963 | Ga0495580_0127560 | |||
| 964 | Ga0495582_0025768 | |||
| 965 | Ga0495582_0215748 | |||
| 966 | Ga0495662_0048496 | |||
| 967 | Ga0495664_0029948 | |||
| 968 | Ga0495664_0036078 | |||
| 969 | Ga0495664_0056251 | |||
| 970 | Ga0495664_0084738 | |||
| 971 | Ga0495594_0160452 | |||
| 972 | Ga0495608_0002831 | |||
| 973 | Ga0495608_0023014 | |||
| 974 | Ga0495608_0164315 | |||
| 975 | Ga0495608_0371733 | |||
| 976 | Ga0495618_0011658 | |||
| 977 | Ga0495618_0044065 | |||
| 978 | Ga0495618_0212302 | |||
| 979 | Ga0495628_0079207 | |||
| 980 | Ga0495630_0079325 | |||
| 981 | Ga0495631_0062149 | |||
| 982 | Ga0495644_0078384 | |||
| 983 | Ga0495644_0120444 | |||
| 984 | Ga0495666_0011855 | |||
| 985 | Ga0495652_0000187 | |||
| 986 | Ga0495652_0084780 | |||
| 987 | Ga0495652_0102638 | |||
| 988 | Ga0495652_0144436 | |||
| 989 | Ga0495652_0158283 | |||
| 990 | Ga0495665_0070986 | |||
| 991 | Ga0495640_0018982 | |||
| 992 | Ga0495640_0053648 | |||
| 993 | Ga0495640_0106137 | |||
| 994 | Ga0495586_0044790 | |||
| 995 | Ga0495586_0300540 | |||
| 996 | Ga0495587_0006018 | |||
| 997 | Ga0495587_0048583 | |||
| 998 | Ga0495645_0003018 | |||
| 999 | Ga0495645_0012459 | |||
| 1000 | Ga0495645_0225891 | |||
| 1001 | Ga0495667_0009311 | |||
| 1002 | Ga0495667_0024762 | |||
| 1003 | Ga0495634_0155432 | |||
| 1004 | Ga0495634_0193375 | |||
| 1005 | Ga0495635_0040119 | |||
| 1006 | Ga0495635_0049872 | |||
| 1007 | Ga0495635_0143030 | |||
| 1008 | Ga0495588_0116321 | |||
| 1009 | Ga0495588_0213134 | |||
| 1010 | Ga0495657_0048890 | |||
| 1011 | Ga0495599_0000196 | |||
| 1012 | Ga0495599_0028185 | |||
| 1013 | Ga0495599_0036200 | |||
| 1014 | Ga0495599_0324555 | |||
| 1015 | Ga0495623_0000045 | |||
| 1016 | Ga0495623_0022977 | |||
| 1017 | Ga0495646_0000489 | |||
| 1018 | Ga0495646_0106108 | |||
| 1019 | Ga0495658_0166199 | |||
| 1020 | Ga0495613_0005875 | |||
| 1021 | Ga0495613_0262914 | |||
| 1022 | Ga0495624_0035503 | |||
| 1023 | Ga0495589_0026133 | |||
| 1024 | Ga0495589_0109028 | |||
| 1025 | Ga0495600_0014173 | |||
| 1026 | Ga0495600_0170458 | |||
| 1027 | Ga0495581_0199398 | |||
| 1028 | Ga0495604_0000221 | |||
| 1029 | Ga0495604_0029270 | |||
| 1030 | Ga0495604_0492228 | |||
| 1031 | Ga0495674_0098948 | |||
| 1032 | Ga0495674_0140418 | |||
| 1033 | Ga0495674_0153138 | |||
| 1034 | Ga0495674_0198050 | |||
| 1035 | Ga0495676_0047688 | |||
| 1036 | Ga0495680_0006615 | |||
| 1037 | Ga0495680_0031451 | |||
| 1038 | Ga0495680_0081409 | |||
| 1039 | Ga0495680_0110533 | |||
| 1040 | Ga0495680_0185852 | |||
| 1041 | Ga0495675_0000301 | |||
| 1042 | Ga0495684_0003566 | |||
| 1043 | Ga0495684_0069065 | |||
| 1044 | Ga0495602_0000515 | |||
| 1045 | Ga0495602_0122357 | |||
| 1046 | Ga0495614_0002862 | |||
| 1047 | Ga0496100_0006416 | |||
| 1048 | Ga0496100_0025081 | |||
| 1049 | Ga0496100_0303552 | |||
| 1050 | Ga0496101_0006449 | |||
| 1051 | Ga0496102_0020359 | |||
| 1052 | Ga0496102_0036207 | |||
| 1053 | Ga0496102_0051477 | |||
| 1054 | Ga0496103_0012623 | |||
| 1055 | Ga0496103_0031239 | |||
| 1056 | Ga0496103_0131982 | |||
| 1057 | Ga0496104_0011272 | |||
| 1058 | Ga0496104_0013441 | |||
| 1059 | Ga0496104_0353416 | |||
| 1060 | Ga0496105_0008808 | |||
| 1061 | Ga0496105_0019849 | |||
| 1062 | Ga0496105_0073144 | |||
| 1063 | Ga0496105_0143635 | |||
| 1064 | Ga0496105_0151924 | |||
| 1065 | Ga0496105_0347970 | |||
| 1066 | Ga0496106_0066164 | |||
| 1067 | Ga0496106_0191662 | |||
| 1068 | Ga0496106_0192652 | |||
| 1069 | Ga0496108_0027598 | |||
| 1070 | Ga0496108_0072695 | |||
| 1071 | Ga0496108_0126970 | |||
| 1072 | Ga0496108_0191634 | |||
| 1073 | Ga0496108_0382580 | |||
| 1074 | Ga0496109_0003943 | |||
| 1075 | Ga0496109_0018128 | |||
| 1076 | Ga0496109_0043794 | |||
| 1077 | Ga0496109_0102352 | |||
| 1078 | Ga0496109_0163682 | |||
| 1079 | Ga0496109_0256996 | |||
| 1080 | Ga0496109_0281688 | |||
| 1081 | Ga0496109_0291095 | |||
| 1082 | Ga0496109_0321686 | |||
| 1083 | Ga0496109_0498388 | |||
| 1084 | Ga0496110_0003644 | |||
| 1085 | Ga0496110_0030595 | |||
| 1086 | Ga0496110_0060364 | |||
| 1087 | Ga0496110_0313219 | |||
| 1088 | Ga0496111_0006372 | |||
| 1089 | Ga0496111_0032136 | |||
| 1090 | Ga0496111_0090430 | |||
| 1091 | Ga0496111_0187727 | |||
| 1092 | Ga0496112_0009540 | |||
| 1093 | Ga0496112_0034969 | |||
| 1094 | Ga0496112_0132126 | |||
| 1095 | Ga0496112_0657391 | |||
| 1096 | Ga0496113_0014117 | |||
| 1097 | Ga0496113_0056964 | |||
| 1098 | Ga0496113_0064547 | |||
| 1099 | Ga0496113_0068754 | |||
| 1100 | Ga0496113_0203534 | |||
| 1101 | Ga0496114_0069425 | |||
| 1102 | Ga0496114_0204961 | |||
| 1103 | Ga0496114_0243444 | |||
| 1104 | Ga0496114_0253645 | |||
| 1105 | Ga0496115_0004119 | |||
| 1106 | Ga0496115_0009199 | |||
| 1107 | Ga0496115_0178350 | |||
| 1108 | Ga0496115_0474913 | |||
| 1109 | Ga0496126_0229107 | |||
| 1110 | Ga0501031_0076311 | |||
| 1111 | Ga0501031_0228616 | |||
| 1112 | Ga0501033_0454977 | |||
| 1113 | Ga0501036_0008839 | |||
| 1114 | Ga0501036_0403103 | |||
| 1115 | Ga0501039_0081823 | |||
| 1116 | Ga0501040_0008080 | |||
| 1117 | Ga0501041_0025193 | |||
| 1118 | Ga0501042_0007646 | |||
| 1119 | Ga0501042_0048798 | |||
| 1120 | Ga0501042_0191444 | |||
| 1121 | Ga0501046_0071449 | |||
| 1122 | Ga0501048_0265665 | |||
| 1123 | Ga0501068_0076808 | |||
| 1124 | Ga0501069_0162470 | |||
| 1125 | Ga0501071_0003413 | |||
| 1126 | Ga0501071_0117235 | |||
| 1127 | Ga0501071_0490991 | |||
| 1128 | Ga0501072_0183023 | |||
| 1129 | Ga0501074_0405162 | |||
| 1130 | Ga0501075_0128541 | |||
| 1131 | Ga0501075_0448082 | |||
| 1132 | Ga0501076_0027524 | |||
| 1133 | Ga0501077_0029788 | |||
| 1134 | Ga0501079_0008087 | |||
| 1135 | Ga0501079_0070516 | |||
| 1136 | Ga0501079_0088419 | |||
| 1137 | Ga0501081_0043878 | |||
| 1138 | Ga0501035_0072296 | |||
| 1139 | Ga0501035_0403306 | |||
| 1140 | Ga0501045_0014561 | |||
| 1141 | Ga0501045_0193935 | |||
| 1142 | nmdc:mga00v17_203765_c1 | |||
| 1143 | nmdc:mga0yw44_388988_c1 | |||
| 1144 | nmdc:mga0n895_15422_c1 | |||
| 1145 | nmdc:mga0rr50_139061_c1 | |||
| 1146 | nmdc:mga08x19_65888_c1 | |||
| 1147 | Ga0495601_0011380 | |||
| 1148 | Ga0495601_0023210 | |||
| 1149 | Ga0495601_0091859 | |||
| 1150 | Ga0495601_0453318 | |||
| 1151 | Ga0495612_0045168 | |||
| 1152 | Ga0495612_0082517 | |||
| 1153 | Ga0495612_0157565 | |||
| 1154 | Ga0495655_0073302 | |||
| 1155 | Ga0495595_0039409 | |||
| 1156 | Ga0495595_0127264 | |||
| 1157 | Ga0495619_0014836 | |||
| 1158 | Ga0495619_0030023 | |||
| 1159 | Ga0495619_0060635 | |||
| 1160 | Ga0495619_0233113 | |||
| 1161 | Ga0501084_0103478 | |||
| 1162 | Ga0501082_0081914 | |||
| 1163 | Ga0501082_0110666 | |||
| 1164 | Ga0501082_0259023 | |||
| 1165 | Ga0466962_0002059 | |||
| 1166 | Ga0466962_0032746 | |||
| 1167 | Ga0466962_0038099 | |||
| 1168 | Ga0466962_0093981 | |||
| 1169 | Ga0530510_0149957 | |||
| 1170 | Ga0530510_0183469 | |||
| 1171 | 2881852912 | |||
| 1172 | 2888352444 | |||
| 1173 | 2906358070 | |||
| 1174 | 2922134957 | |||
| 1175 | 2922191021 | |||
| 1176 | 2967998982 | |||
| 1177 | 2977976066 | |||
| 1178 | 2979747973 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9237 | 1 | 237 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9195 | 7 | 234 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9174 | 5 | 225 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9163 | 1 | 237 |
| 3d31-assembly1.cif.gz_A | modbc from methanosarcina acetivorans | 0.9119 | 7 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9475 | 7 | 70 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9469 | 2 | 238 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9391 | 2 | 238 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.936 | 5 | 70 | 3.40.50.300 |
| af_P77257_8_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9348 | 5 | 236 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A254THI3-F1-model_v4 | ABC transporter ATP-binding protein | 0.9796 | 7 | 225 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A6F8YCS9-F1-model_v4 | High-affinity branched-chain amino acid transport ATP-binding protein | 0.9709 | 4 | 220 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A1F7LUM7-F1-model_v4 | ABC transporter domain-containing protein | 0.9706 | 6 | 225 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A1Q7D5U6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9678 | 4 | 233 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A4Q2L748-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9608 | 1 | 237 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |