F466837

General Info

Members Datasets Scaffolds Average Seq Length
589 247 1178 303

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100014407|Ga0070669_1000144072
Length 351
Sequence VSRKAVSPAPPRDDLAAELGRRRGALAPLFDPGCLVADSERKVSVRRLILYLGLTFSLAALAFSFGSWTAQRAIARQLASNDARVAELRDDMARAILEFRQAETAATPSGTNGRVPEVVPAGSADPGLVEEIKRQLQSEMGLLPVRLLRERRESFVELNAYDASGKSSYGTAGYLGNGYFVTVKHAVVALDDPDGREGHKITAIKLRIKGRDVPARVVDAGDADVEVHAGDWAIVKVSQKIDLPPLRVNPRFSYDFADPIFRLGNDYSKGIILSTGYVGQRTSNGLVTCLTDGHPGVSGGGVLDQDGDLVGIPIGRMQGDYRFSFILPVRGEMFRKVPGLTVAEAKLASAE

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
224 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 3.9
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 13.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100014407 3300005353 Bacteria 5628
2 JGI24751J29686_10017571 3300002459 Bacteria 1478
3 Ga0058862_10242868 3300004803 Bacteria 1527
4 Ga0065704_10084518 3300005289 Unclassified 3326
5 Ga0065712_10073694 3300005290 Unclassified 4307
6 Ga0065712_10077304 3300005290 Bacteria 3517
7 Ga0065712_10085337 3300005290 Bacteria 2699
8 Ga0065712_10108477 3300005290 Bacteria 1874
9 Ga0065712_10133356 3300005290 Bacteria 1524
10 Ga0065715_10000556 3300005293 Bacteria 14414
11 Ga0065707_10006083 3300005295 Unclassified 4099
12 Ga0065707_10011223 3300005295 Bacteria 2003
13 Ga0070658_10077022 3300005327 Unclassified 2736
14 Ga0070676_10313551 3300005328 Unclassified 1067
15 Ga0070683_100002122 3300005329 Bacteria 15653
16 Ga0070683_100041151 3300005329 Bacteria 4249
17 Ga0070690_100105731 3300005330 Bacteria 1871
18 Ga0070670_100015394 3300005331 Bacteria 6568
19 Ga0070670_100049983 3300005331 Bacteria 3594
20 Ga0070670_100079230 3300005331 Bacteria 2823
21 Ga0070670_100106629 3300005331 Unclassified 2414
22 Ga0070670_100107744 3300005331 Bacteria 2401
23 Ga0068869_100164560 3300005334 Bacteria 1729
24 Ga0068869_100229413 3300005334 Unclassified 1475
25 Ga0070666_10088745 3300005335 Bacteria 2122
26 Ga0070666_10105896 3300005335 Bacteria 1942
27 Ga0070666_10199372 3300005335 Bacteria 1408
28 Ga0070680_100098513 3300005336 Unclassified 2425
29 Ga0070682_100162171 3300005337 Unclassified 1545
30 Ga0068868_100079012 3300005338 Bacteria 2635
31 Ga0068868_100088666 3300005338 Bacteria 2490
32 Ga0068868_100114423 3300005338 Bacteria 2195
33 Ga0068868_100241167 3300005338 Bacteria 1519
34 Ga0070660_100032149 3300005339 Unclassified 3947
35 Ga0070660_100281760 3300005339 Bacteria 1360
36 Ga0070689_100080739 3300005340 Bacteria 2552
37 Ga0070691_10059770 3300005341 Bacteria 1832
38 Ga0070661_100064070 3300005344 Bacteria 2701
39 Ga0070668_100081222 3300005347 Bacteria 2541
40 Ga0070668_100106113 3300005347 Bacteria 2232
41 Ga0070669_100008767 3300005353 Bacteria 7215
42 Ga0070669_100210861 3300005353 Bacteria 1532
43 Ga0070669_100371401 3300005353 Unclassified 1165
44 Ga0070675_100195713 3300005354 Bacteria 1753
45 Ga0070675_100215274 3300005354 Bacteria 1671
46 Ga0070675_100252492 3300005354 Bacteria 1544
47 Ga0070671_100008882 3300005355 Bacteria 8063
48 Ga0070671_100058757 3300005355 Bacteria 3200
49 Ga0070674_100006284 3300005356 Bacteria 6917
50 Ga0070674_100039703 3300005356 Bacteria 3180
51 Ga0070674_100137960 3300005356 Unclassified 1827
52 Ga0070673_100010797 3300005364 Bacteria 6201
53 Ga0070673_100063926 3300005364 Unclassified 2930
54 Ga0070673_100073969 3300005364 Unclassified 2744
55 Ga0070673_100220157 3300005364 Unclassified 1642
56 Ga0070673_100247303 3300005364 Bacteria 1553
57 Ga0070688_100134414 3300005365 Bacteria 1673
58 Ga0070659_100054461 3300005366 Bacteria 3151
59 Ga0070703_10028317 3300005406 Bacteria 1674
60 Ga0070701_10011202 3300005438 Bacteria 3999
61 Ga0070701_10031764 3300005438 Bacteria 2622
62 Ga0070705_100000125 3300005440 Bacteria 44753
63 Ga0070705_100017140 3300005440 Bacteria 3777
64 Ga0070705_100082361 3300005440 Bacteria 1980
65 Ga0070705_100136532 3300005440 Bacteria 1607
66 Ga0070700_100006437 3300005441 Bacteria 6283
67 Ga0070694_100004415 3300005444 Bacteria 8457
68 Ga0070694_100026294 3300005444 Bacteria 3771
69 Ga0070694_100111656 3300005444 Bacteria 1948
70 Ga0070663_100083777 3300005455 Bacteria 2349
71 Ga0070663_100298303 3300005455 Bacteria 1289
72 Ga0070678_100237314 3300005456 Bacteria 1523
73 Ga0070662_100042667 3300005457 Unclassified 3241
74 Ga0070662_100158461 3300005457 Bacteria 1769
75 Ga0070681_10024800 3300005458 Bacteria 6033
76 Ga0070681_10045715 3300005458 Bacteria 4379
77 Ga0070681_10059124 3300005458 Bacteria 3812
78 Ga0070681_10165636 3300005458 Bacteria 2133
79 Ga0068867_100006977 3300005459 Bacteria 7984
80 Ga0068867_100018591 3300005459 Bacteria 4941
81 Ga0068867_100235709 3300005459 Bacteria 1481
82 Ga0068867_100302734 3300005459 Bacteria 1318
83 Ga0068867_100310923 3300005459 Bacteria 1302
84 Ga0070706_100227099 3300005467 Bacteria 1743
85 Ga0070706_100433969 3300005467 Unclassified 1223
86 Ga0070707_100121695 3300005468 Bacteria 2534
87 Ga0070707_100138853 3300005468 Bacteria 2365
88 Ga0070707_100194474 3300005468 Bacteria 1978
89 Ga0070707_100196955 3300005468 Bacteria 1964
90 Ga0070707_100347949 3300005468 Bacteria 1440
91 Ga0070698_100000242 3300005471 Bacteria 54440
92 Ga0070698_100055179 3300005471 Bacteria 4031
93 Ga0070698_100099955 3300005471 Bacteria 2874
94 Ga0070698_100499005 3300005471 Bacteria 1155
95 Ga0070698_100606377 3300005471 Unclassified 1035
96 Ga0070699_100000778 3300005518 Bacteria 29468
97 Ga0070699_100081479 3300005518 Bacteria 2821
98 Ga0070699_100126149 3300005518 Bacteria 2253
99 Ga0070699_100146384 3300005518 Bacteria 2087
100 Ga0070679_100050343 3300005530 Unclassified 4150
101 Ga0070679_100064285 3300005530 Bacteria 3657
102 Ga0070679_100123549 3300005530 Unclassified 2572
103 Ga0070684_100000667 3300005535 Bacteria 23730
104 Ga0070684_100213975 3300005535 Bacteria 1757
105 Ga0070697_100024822 3300005536 Bacteria 4773
106 Ga0070672_100049868 3300005543 Bacteria 3259
107 Ga0070672_100204740 3300005543 Bacteria 1651
108 Ga0070686_100056212 3300005544 Bacteria 2523
109 Ga0070695_100033540 3300005545 Bacteria 3213
110 Ga0070695_100042058 3300005545 Bacteria 2899
111 Ga0070695_100069409 3300005545 Bacteria 2303
112 Ga0070696_100005181 3300005546 Bacteria 8713
113 Ga0070696_100024825 3300005546 Bacteria 4073
114 Ga0070696_100026966 3300005546 Bacteria 3912
115 Ga0070696_100163980 3300005546 Bacteria 1639
116 Ga0070665_100001839 3300005548 Bacteria 24104
117 Ga0070665_100015599 3300005548 Bacteria 7632
118 Ga0070665_100073214 3300005548 Bacteria 3433
119 Ga0070704_100000070 3300005549 Bacteria 33970
120 Ga0070704_100040787 3300005549 Bacteria 3199
121 Ga0070704_100072680 3300005549 Bacteria 2503
122 Ga0070704_100112469 3300005549 Bacteria 2075
123 Ga0070704_100124611 3300005549 Bacteria 1986
124 Ga0070704_100209651 3300005549 Bacteria 1578
125 Ga0068855_100054115 3300005563 Unclassified 4718
126 Ga0068855_100394375 3300005563 Bacteria 1518
127 Ga0070664_100003674 3300005564 Bacteria 12364
128 Ga0070664_100130918 3300005564 Bacteria 2203
129 Ga0070664_100216359 3300005564 Bacteria 1713
130 Ga0070664_100268875 3300005564 Bacteria 1535
131 Ga0068857_100020914 3300005577 Bacteria 5756
132 Ga0068856_100071029 3300005614 Bacteria 3446
133 Ga0068852_100295397 3300005616 Bacteria 1566
134 Ga0068859_100001412 3300005617 Bacteria 24351
135 Ga0068859_100015750 3300005617 Bacteria 7597
136 Ga0068859_100492219 3300005617 Bacteria 1321
137 Ga0068864_100006306 3300005618 Bacteria 9731
138 Ga0068864_100038316 3300005618 Bacteria 4094
139 Ga0068864_100101702 3300005618 Bacteria 2549
140 Ga0068866_10089160 3300005718 Bacteria 1676
141 Ga0068861_100107433 3300005719 Bacteria 2231
142 Ga0068861_100185676 3300005719 Bacteria 1734
143 Ga0068861_100296374 3300005719 Bacteria 1399
144 Ga0068870_10088348 3300005840 Bacteria 1728
145 Ga0068863_100102905 3300005841 Bacteria 2716
146 Ga0068858_100006552 3300005842 Bacteria 11323
147 Ga0068858_100081555 3300005842 Bacteria 3006
148 Ga0068858_100288256 3300005842 Unclassified 1564
149 Ga0068862_100033768 3300005844 Bacteria 4327
150 Ga0068862_100179652 3300005844 Bacteria 1898
151 Ga0068862_100223153 3300005844 Bacteria 1707
152 Ga0081539_10054412 3300005985 Bacteria 2234
153 Ga0081539_10059970 3300005985 Bacteria 2091
154 Ga0075365_10055710 3300006038 Bacteria 2626
155 Ga0075432_10080738 3300006058 Bacteria 1179
156 Ga0075367_10014592 3300006178 Bacteria 4254
157 Ga0075366_10028854 3300006195 Bacteria 3258
158 Ga0097621_100051140 3300006237 Bacteria 3362
159 Ga0097621_100058936 3300006237 Bacteria 3142
160 Ga0075370_10061647 3300006353 Bacteria 2136
161 Ga0068871_100115412 3300006358 Bacteria 2263
162 Ga0068871_100144988 3300006358 Bacteria 2021
163 Ga0068871_100200609 3300006358 Bacteria 1722
164 Ga0075428_100001118 3300006844 Bacteria 28611
165 Ga0075428_100005366 3300006844 Bacteria 14247
166 Ga0075428_100006836 3300006844 Bacteria 12683
167 Ga0075428_100009583 3300006844 Bacteria 10756
168 Ga0075428_100365287 3300006844 Bacteria 1548
169 Ga0075428_100438143 3300006844 Bacteria 1400
170 Ga0075428_100495415 3300006844 Bacteria 1307
171 Ga0075428_100573864 3300006844 Bacteria 1205
172 Ga0075430_100003268 3300006846 Bacteria 13589
173 Ga0075430_100003499 3300006846 Bacteria 13148
174 Ga0075430_100224071 3300006846 Bacteria 1560
175 Ga0075431_100001573 3300006847 Bacteria 21212
176 Ga0075431_100004721 3300006847 Bacteria 13386
177 Ga0075431_100026296 3300006847 Bacteria 5970
178 Ga0075433_10017086 3300006852 Bacteria 6000
179 Ga0075433_10273020 3300006852 Bacteria 1498
180 Ga0075433_10292060 3300006852 Unclassified 1444
181 Ga0075433_10297379 3300006852 Bacteria 1429
182 Ga0075434_100014860 3300006871 Bacteria 7447
183 Ga0075434_100020842 3300006871 Bacteria 6365
184 Ga0075434_100157176 3300006871 Unclassified 2293
185 Ga0075434_100270691 3300006871 Bacteria 1718
186 Ga0075434_100399225 3300006871 Unclassified 1396
187 Ga0075429_100001841 3300006880 Bacteria 17560
188 Ga0075429_100004486 3300006880 Bacteria 12007
189 Ga0075429_100013618 3300006880 Bacteria 7055
190 Ga0075429_100202410 3300006880 Bacteria 1740
191 Ga0075436_100019148 3300006914 Bacteria 4689
192 Ga0075436_100038041 3300006914 Bacteria 3321
193 Ga0075436_100142176 3300006914 Bacteria 1687
194 Ga0075436_100186439 3300006914 Bacteria 1467
195 Ga0097620_100001412 3300006931 Bacteria 24351
196 Ga0097620_100015750 3300006931 Bacteria 7597
197 Ga0097620_100492232 3300006931 Bacteria 1321
198 Ga0075435_100003309 3300007076 Bacteria 10927
199 Ga0075435_100008119 3300007076 Bacteria 7517
200 Ga0075435_100014963 3300007076 Bacteria 5819
201 Ga0075435_100032960 3300007076 Bacteria 4094
202 Ga0075435_100080617 3300007076 Bacteria 2673
203 Ga0075435_100115113 3300007076 Bacteria 2239
204 Ga0105240_10018497 3300009093 Bacteria 9353
205 Ga0105240_10563808 3300009093 Bacteria 1258
206 Ga0111539_10024044 3300009094 Bacteria 7483
207 Ga0111539_10031900 3300009094 Bacteria 6400
208 Ga0111539_10042419 3300009094 Bacteria 5463
209 Ga0111539_10249953 3300009094 Bacteria 2065
210 Ga0111539_10372499 3300009094 Bacteria 1662
211 Ga0105245_10109897 3300009098 Unclassified 2562
212 Ga0105245_10177006 3300009098 Bacteria 2035
213 Ga0105245_10626836 3300009098 Unclassified 1104
214 Ga0105247_10010260 3300009101 Bacteria 5671
215 Ga0105247_10035986 3300009101 Unclassified 3019
216 Ga0114129_10001599 3300009147 Bacteria 30786
217 Ga0114129_10001632 3300009147 Bacteria 30462
218 Ga0114129_10003225 3300009147 Bacteria 22877
219 Ga0114129_10005941 3300009147 Bacteria 17277
220 Ga0114129_10010159 3300009147 Bacteria 13422
221 Ga0114129_10027475 3300009147 Bacteria 8055
222 Ga0114129_10098341 3300009147 Bacteria 4050
223 Ga0114129_10253173 3300009147 Unclassified 2363
224 Ga0114129_10386891 3300009147 Bacteria 1846
225 Ga0114129_10535009 3300009147 Bacteria 1526
226 Ga0114129_10640291 3300009147 Bacteria 1373
227 Ga0114129_10680791 3300009147 Bacteria 1324
228 Ga0105243_10533700 3300009148 Bacteria 1118
229 Ga0105241_10052360 3300009174 Bacteria 3116
230 Ga0105242_10014533 3300009176 Bacteria 6099
231 Ga0105242_10023427 3300009176 Bacteria 4865
232 Ga0105242_10026863 3300009176 Bacteria 4565
233 Ga0105242_10039699 3300009176 Bacteria 3789
234 Ga0105248_10050624 3300009177 Bacteria 4659
235 Ga0105248_10095369 3300009177 Bacteria 3350
236 Ga0105248_10190736 3300009177 Unclassified 2309
237 Ga0105248_10224405 3300009177 Unclassified 2115
238 Ga0105248_10442194 3300009177 Bacteria 1465
239 Ga0105248_10465562 3300009177 Unclassified 1425
240 Ga0105237_10214828 3300009545 Bacteria 1923
241 Ga0105238_10581033 3300009551 Bacteria 1127
242 Ga0105249_10008602 3300009553 Bacteria 8896
243 Ga0105249_10111825 3300009553 Bacteria 2582
244 Ga0105249_10161103 3300009553 Bacteria 2168
245 Ga0105249_10201714 3300009553 Bacteria 1947
246 Ga0105249_10431654 3300009553 Unclassified 1353
247 Ga0105249_10551331 3300009553 Unclassified 1203
248 Ga0105246_10292664 3300011119 Bacteria 1311
249 Ga0105246_10302409 3300011119 Unclassified 1292
250 Ga0157374_10030076 3300013296 Bacteria 4928
251 Ga0157378_10160295 3300013297 Bacteria 2103
252 Ga0157378_10349058 3300013297 Bacteria 1445
253 Ga0163162_10145987 3300013306 Bacteria 2482
254 Ga0163162_10486781 3300013306 Bacteria 1365
255 Ga0157372_10305728 3300013307 Bacteria 1850
256 Ga0157375_10121167 3300013308 Bacteria 2725
257 Ga0157375_10230026 3300013308 Bacteria 2013
258 Ga0157375_10423034 3300013308 Bacteria 1498
259 Ga0157375_10773876 3300013308 Bacteria 1110
260 Ga0163163_10011651 3300014325 Bacteria 7988
261 Ga0163163_10073168 3300014325 Bacteria 3417
262 Ga0163163_10236122 3300014325 Unclassified 1878
263 Ga0163163_10440768 3300014325 Bacteria 1362
264 Ga0157380_10068349 3300014326 Bacteria 2863
265 Ga0157380_10100989 3300014326 Bacteria 2403
266 Ga0157380_10120965 3300014326 Bacteria 2218
267 Ga0157380_10496280 3300014326 Bacteria 1184
268 Ga0157377_10087478 3300014745 Bacteria 1834
269 Ga0157377_10251090 3300014745 Unclassified 1146
270 Ga0157379_10016768 3300014968 Bacteria 6447
271 Ga0157379_10027008 3300014968 Bacteria 5109
272 Ga0157376_10018196 3300014969 Bacteria 5379
273 Ga0157376_10051429 3300014969 Bacteria 3423
274 Ga0157376_10054858 3300014969 Bacteria 3324
275 Ga0157376_10090715 3300014969 Bacteria 2645
276 Ga0157376_10254847 3300014969 Bacteria 1641
277 Ga0157376_10549708 3300014969 Unclassified 1142
278 Ga0207697_10000882 3300025315 Bacteria 16983
279 Ga0207653_10053164 3300025885 Archaea 1352
280 Ga0207710_10033879 3300025900 Bacteria 2241
281 Ga0207710_10039758 3300025900 Bacteria 2082
282 Ga0207688_10010811 3300025901 Bacteria 4967
283 Ga0207688_10248055 3300025901 Bacteria 1078
284 Ga0207680_10045484 3300025903 Bacteria 2588
285 Ga0207680_10192548 3300025903 Unclassified 1385
286 Ga0207647_10109833 3300025904 Bacteria 1631
287 Ga0207699_10083699 3300025906 Bacteria 1985
288 Ga0207645_10042396 3300025907 Bacteria 2911
289 Ga0207643_10030716 3300025908 Bacteria 2992
290 Ga0207705_10092201 3300025909 Unclassified 2219
291 Ga0207707_10134859 3300025912 Bacteria 2158
292 Ga0207695_10140630 3300025913 Bacteria 2363
293 Ga0207671_10293590 3300025914 Bacteria 1284
294 Ga0207660_10141439 3300025917 Bacteria 1840
295 Ga0207662_10048008 3300025918 Bacteria 2529
296 Ga0207657_10016007 3300025919 Bacteria 7241
297 Ga0207657_10244003 3300025919 Bacteria 1433
298 Ga0207649_10015384 3300025920 Bacteria 4299
299 Ga0207652_10065726 3300025921 Bacteria 3141
300 Ga0207652_10326529 3300025921 Bacteria 1385
301 Ga0207646_10155362 3300025922 Bacteria 2063
302 Ga0207646_10168459 3300025922 Bacteria 1978
303 Ga0207646_10173610 3300025922 Unclassified 1946
304 Ga0207646_10301327 3300025922 Bacteria 1448
305 Ga0207681_10034589 3300025923 Bacteria 3323
306 Ga0207681_10089767 3300025923 Unclassified 2192
307 Ga0207681_10114806 3300025923 Unclassified 1965
308 Ga0207650_10021374 3300025925 Bacteria 4572
309 Ga0207650_10048688 3300025925 Bacteria 3127
310 Ga0207650_10049227 3300025925 Bacteria 3111
311 Ga0207650_10110783 3300025925 Bacteria 2125
312 Ga0207650_10122309 3300025925 Bacteria 2028
313 Ga0207650_10130620 3300025925 Bacteria 1965
314 Ga0207659_10007903 3300025926 Bacteria 6576
315 Ga0207659_10137205 3300025926 Unclassified 1895
316 Ga0207659_10178176 3300025926 Bacteria 1682
317 Ga0207687_10175300 3300025927 Bacteria 1657
318 Ga0207690_10410567 3300025932 Bacteria 1081
319 Ga0207706_10019338 3300025933 Bacteria 6125
320 Ga0207706_10058818 3300025933 Bacteria 3385
321 Ga0207686_10006041 3300025934 Bacteria 6501
322 Ga0207686_10063203 3300025934 Bacteria 2353
323 Ga0207686_10099017 3300025934 Bacteria 1943
324 Ga0207670_10018124 3300025936 Bacteria 4271
325 Ga0207670_10186463 3300025936 Bacteria 1566
326 Ga0207669_10028255 3300025937 Bacteria 3084
327 Ga0207669_10420304 3300025937 Unclassified 1052
328 Ga0207691_10025789 3300025940 Bacteria 5516
329 Ga0207691_10060272 3300025940 Bacteria 3448
330 Ga0207691_10067188 3300025940 Bacteria 3242
331 Ga0207691_10093128 3300025940 Bacteria 2698
332 Ga0207691_10171284 3300025940 Unclassified 1901
333 Ga0207691_10217354 3300025940 Bacteria 1658
334 Ga0207711_10058094 3300025941 Bacteria 3327
335 Ga0207711_10174990 3300025941 Unclassified 1949
336 Ga0207711_10206499 3300025941 Bacteria 1794
337 Ga0207689_10101305 3300025942 Bacteria 2366
338 Ga0207689_10154737 3300025942 Bacteria 1890
339 Ga0207661_10003548 3300025944 Bacteria 10840
340 Ga0207679_10001740 3300025945 Bacteria 13555
341 Ga0207679_10023165 3300025945 Bacteria 4241
342 Ga0207679_10127089 3300025945 Bacteria 2039
343 Ga0207679_10133519 3300025945 Bacteria 1995
344 Ga0207679_10183612 3300025945 Bacteria 1732
345 Ga0207679_10193243 3300025945 Bacteria 1694
346 Ga0207679_10320118 3300025945 Bacteria 1343
347 Ga0207667_10255479 3300025949 Unclassified 1792
348 Ga0207667_10469464 3300025949 Bacteria 1278
349 Ga0207651_10016255 3300025960 Bacteria 4354
350 Ga0207651_10034215 3300025960 Unclassified 3288
351 Ga0207651_10057504 3300025960 Bacteria 2682
352 Ga0207651_10110466 3300025960 Unclassified 2062
353 Ga0207712_10015340 3300025961 Bacteria 4940
354 Ga0207712_10165686 3300025961 Bacteria 1722
355 Ga0207668_10030522 3300025972 Bacteria 3543
356 Ga0207668_10034432 3300025972 Bacteria 3364
357 Ga0207677_10118174 3300026023 Bacteria 1989
358 Ga0207677_10373616 3300026023 Bacteria 1201
359 Ga0207703_10071726 3300026035 Bacteria 2861
360 Ga0207703_10170334 3300026035 Unclassified 1915
361 Ga0207703_10265104 3300026035 Unclassified 1554
362 Ga0207703_10292698 3300026035 Bacteria 1482
363 Ga0207678_10022216 3300026067 Bacteria 5559
364 Ga0207708_10003079 3300026075 Bacteria 12276
365 Ga0207708_10011019 3300026075 Bacteria 6723
366 Ga0207708_10048107 3300026075 Bacteria 3246
367 Ga0207708_10096923 3300026075 Bacteria 2279
368 Ga0207702_10087575 3300026078 Bacteria 2719
369 Ga0207702_10378334 3300026078 Bacteria 1361
370 Ga0207641_10058971 3300026088 Bacteria 3268
371 Ga0207641_10179071 3300026088 Bacteria 1940
372 Ga0207648_10001011 3300026089 Bacteria 31668
373 Ga0207648_10048862 3300026089 Bacteria 3703
374 Ga0207648_10159917 3300026089 Bacteria 1989
375 Ga0207648_10212219 3300026089 Bacteria 1719
376 Ga0207648_10400707 3300026089 Bacteria 1243
377 Ga0207676_10014310 3300026095 Bacteria 5706
378 Ga0207674_10010755 3300026116 Bacteria 10326
379 Ga0207674_10011945 3300026116 Bacteria 9735
380 Ga0207675_100008575 3300026118 Bacteria 9616
381 Ga0207675_100031553 3300026118 Bacteria 4935
382 Ga0207675_100106322 3300026118 Bacteria 2646
383 Ga0207675_100110514 3300026118 Bacteria 2593
384 Ga0207675_100224887 3300026118 Bacteria 1809
385 Ga0207675_100269535 3300026118 Bacteria 1652
386 Ga0207675_100391318 3300026118 Bacteria 1368
387 Ga0207683_10012647 3300026121 Bacteria 7199
388 Ga0207683_10119670 3300026121 Bacteria 2363
389 Ga0210002_1017476 3300027617 Bacteria 1141
390 Ga0207428_10003684 3300027907 Bacteria 14736
391 Ga0207428_10003797 3300027907 Bacteria 14491
392 Ga0207428_10110531 3300027907 Bacteria 2116
393 Ga0268266_10013430 3300028379 Bacteria 7053
394 Ga0268265_10003984 3300028380 Bacteria 10401
395 Ga0268265_10023826 3300028380 Bacteria 4320
396 Ga0268265_10059207 3300028380 Bacteria 2929
397 Ga0268265_10194294 3300028380 Bacteria 1755
398 Ga0268265_10227069 3300028380 Bacteria 1638
399 Ga0268265_10466688 3300028380 Unclassified 1182
400 Ga0268264_10055667 3300028381 Bacteria 3306
401 Ga0268264_10279850 3300028381 Bacteria 1562
402 Ga0307408_100009304 3300031548 Bacteria 6478
403 Ga0307408_100013515 3300031548 Bacteria 5418
404 Ga0307408_100142722 3300031548 Bacteria 1881
405 Ga0307405_10185895 3300031731 Bacteria 1496
406 Ga0307405_10357257 3300031731 Bacteria 1129
407 Ga0307413_10210013 3300031824 Bacteria 1413
408 Ga0307406_10011762 3300031901 Bacteria 4970
409 Ga0307407_10166177 3300031903 Bacteria 1449
410 Ga0307407_10304164 3300031903 Unclassified 1113
411 Ga0307412_10224390 3300031911 Bacteria 1442
412 Ga0307409_100028970 3300031995 Bacteria 3955
413 Ga0307409_100362039 3300031995 Bacteria 1372
414 Ga0307416_100009776 3300032002 Bacteria 6303
415 Ga0307416_100023327 3300032002 Bacteria 4489
416 Ga0307416_100059818 3300032002 Bacteria 3098
417 Ga0307414_10687625 3300032004 Bacteria 925
418 Ga0307411_10026991 3300032005 Bacteria 3467
419 Ga0307411_10128118 3300032005 Unclassified 1850
420 Ga0307411_10131475 3300032005 Unclassified 1830
421 Ga0307411_10182163 3300032005 Bacteria 1595
422 Ga0307415_100063778 3300032126 Bacteria 2561
423 Ga0373934_0193901 3300035086 Unclassified 836
424 Ga0373939_0030384 3300035114 Bacteria 1554
425 Ga0373955_0133581 3300035172 Bacteria 1450
426 Ga0373935_0275207 3300035692 Bacteria 1184
427 Ga0373947_0009595 3300035725 Bacteria 5554
428 Ga0373937_0011601 3300036401 Bacteria 7739
429 Ga0373937_0246963 3300036401 Bacteria 1682
430 Ga0373925_0098182 3300037068 Bacteria 2248
431 Ga0373925_0179789 3300037068 Unclassified 1674
432 Ga0373925_0643851 3300037068 Unclassified 873
433 Ga0395905_0643627 3300037471 Unclassified 962
434 Ga0439455_0047224 3300042012 Unclassified 1117
435 Ga0439460_0013893 3300042461 Unclassified 2111
436 Ga0451577_0059852 3300042876 Bacteria 3395
437 Ga0451577_0125199 3300042876 Bacteria 2303
438 Ga0451577_0309019 3300042876 Bacteria 1433
439 Ga0451576_0005762 3300045051 Bacteria 15423
440 Ga0451576_0019965 3300045051 Bacteria 7303
441 Ga0451576_0023822 3300045051 Bacteria 6624
442 Ga0451576_0079898 3300045051 Bacteria 3403
443 Ga0466967_0108975 3300045976 Bacteria 2542
444 Ga0495629_0211023 3300046459 Bacteria 1341
445 Ga0495580_0101385 3300046472 Unclassified 2002
446 Ga0495639_0108992 3300046475 Unclassified 1313
447 Ga0495584_0020295 3300046491 Bacteria 3377
448 Ga0495594_0030909 3300046499 Bacteria 2901
449 Ga0495663_0064152 3300046525 Bacteria 1159
450 Ga0495642_0007585 3300046528 Bacteria 4157
451 Ga0495621_0044412 3300046539 Bacteria 1571
452 Ga0495656_0157053 3300046615 Bacteria 1103
453 Ga0495659_0002913 3300046664 Bacteria 5496
454 Ga0495659_0012524 3300046664 Bacteria 2749
455 Ga0495659_0085841 3300046664 Bacteria 1201
456 Ga0495588_0013672 3300046674 Unclassified 3870
457 Ga0495647_0022995 3300046681 Bacteria 2257
458 Ga0495669_0057725 3300046684 Bacteria 1751
459 Ga0495669_0113098 3300046684 Bacteria 1269
460 Ga0495636_0008949 3300047318 Bacteria 3943
461 Ga0495677_0059861 3300047445 Bacteria 1411
462 Ga0495684_0199116 3300047471 Bacteria 1477
463 Ga0496102_0127589 3300048905 Bacteria 2379
464 Ga0496102_0692756 3300048905 Bacteria 942
465 Ga0496103_0298881 3300048906 Bacteria 1036
466 Ga0496104_0003484 3300048907 Bacteria 13574
467 Ga0496104_0019850 3300048907 Bacteria 6156
468 Ga0496106_0046022 3300048909 Bacteria 3279
469 Ga0496108_0052223 3300048911 Bacteria 3424
470 Ga0496108_0142260 3300048911 Bacteria 2067
471 Ga0496109_0076925 3300048912 Bacteria 3070
472 Ga0496109_0194339 3300048912 Bacteria 1907
473 Ga0496109_0465045 3300048912 Unclassified 1194
474 Ga0496110_0015426 3300048913 Bacteria 6358
475 Ga0496110_0032766 3300048913 Bacteria 4492
476 Ga0496110_0083285 3300048913 Bacteria 2853
477 Ga0496110_0260058 3300048913 Bacteria 1580
478 Ga0496110_0414324 3300048913 Bacteria 1228
479 Ga0496111_0003512 3300048914 Bacteria 9701
480 Ga0496112_0000420 3300048915 Bacteria 27956
481 Ga0496112_0049252 3300048915 Bacteria 4130
482 Ga0496112_0062431 3300048915 Bacteria 3675
483 Ga0496113_0039893 3300048916 Bacteria 3458
484 Ga0496114_0381866 3300048917 Bacteria 1247
485 Ga0496115_0299605 3300048918 Unclassified 1317
486 Ga0501031_0269298 3300049568 Unclassified 1106
487 Ga0501036_0089611 3300049572 Bacteria 2599
488 Ga0501039_0099602 3300049575 Bacteria 2268
489 Ga0501039_0123210 3300049575 Bacteria 2032
490 Ga0501040_0028342 3300049576 Bacteria 3775
491 Ga0501040_0081331 3300049576 Bacteria 2245
492 Ga0501041_0034939 3300049577 Bacteria 3045
493 Ga0501041_0138368 3300049577 Unclassified 1518
494 Ga0501042_0300399 3300049578 Unclassified 1160
495 Ga0501067_0068837 3300049583 Bacteria 1960
496 Ga0501070_0173675 3300049586 Bacteria 1775
497 Ga0501071_0014848 3300049587 Bacteria 5335
498 Ga0501072_0039906 3300049588 Bacteria 3686
499 Ga0501072_0043859 3300049588 Bacteria 3516
500 Ga0501072_0142377 3300049588 Bacteria 1912
501 Ga0501074_0054736 3300049590 Unclassified 2877
502 Ga0501075_0006859 3300049591 Bacteria 7865
503 Ga0501075_0009203 3300049591 Bacteria 6906
504 Ga0501075_0097019 3300049591 Bacteria 2237
505 Ga0501075_0313443 3300049591 Bacteria 1195
506 Ga0501076_0024020 3300049592 Bacteria 4707
507 Ga0501076_0049529 3300049592 Bacteria 3323
508 Ga0501076_0152434 3300049592 Bacteria 1880
509 Ga0501076_0197764 3300049592 Bacteria 1641
510 Ga0501233_018165 3300049668 Bacteria 1476
511 Ga0501235_029941 3300049669 Bacteria 1226
512 Ga0501259_008804 3300049688 Bacteria 1631
513 Ga0501079_0110596 3300049741 Bacteria 2135
514 Ga0501079_0112029 3300049741 Bacteria 2120
515 Ga0501079_0131832 3300049741 Bacteria 1945
516 Ga0501079_0161186 3300049741 Bacteria 1749
517 Ga0501079_0278438 3300049741 Unclassified 1308
518 Ga0501080_0385213 3300049742 Bacteria 1263
519 Ga0501081_0020522 3300049743 Bacteria 4403
520 Ga0501081_0068381 3300049743 Bacteria 2473
521 Ga0501081_0146418 3300049743 Bacteria 1695
522 Ga0501081_0174180 3300049743 Bacteria 1554
523 Ga0501035_0073837 3300049822 Bacteria 3018
524 Ga0501035_0265285 3300049822 Bacteria 1455
525 Ga0501044_0164931 3300049823 Bacteria 2190
526 Ga0501045_0019971 3300049824 Bacteria 4782
527 Ga0501045_0041605 3300049824 Bacteria 3343
528 nmdc:mga0yw44_66468_c1 3300050492 Bacteria 2225
529 nmdc:mga05p37_115325_c1 3300050507 Bacteria 3302
530 nmdc:mga05p37_15084_c1 3300050507 Bacteria 6968
531 nmdc:mga05p37_155715_c1 3300050507 Bacteria 2793
532 nmdc:mga05p37_196444_c1 3300050507 Bacteria 2446
533 nmdc:mga05p37_1985_c1 3300050507 Bacteria 19185
534 nmdc:mga05p37_2339_c1 3300050507 Bacteria 22050
535 nmdc:mga05p37_235878_c1 3300050507 Bacteria 2202
536 nmdc:mga05p37_282507_c1 3300050507 Unclassified 1979
537 nmdc:mga05p37_318820_c1 3300050507 Unclassified 1840
538 nmdc:mga05p37_3981_c1 3300050507 Bacteria 17289
539 nmdc:mga05p37_65755_c1 3300050507 Bacteria 4461
540 nmdc:mga05p37_73092_c1 3300050507 Bacteria 4220
541 nmdc:mga09592_50525_c1 3300050508 Unclassified 3507
542 nmdc:mga09592_5421_c1 3300050508 Bacteria 10369
543 nmdc:mga09592_6096_c1 3300050508 Bacteria 9822
544 nmdc:mga09592_6181_c1 3300050508 Bacteria 9746
545 nmdc:mga0qj67_286849_c1 3300050509 Bacteria 1334
546 nmdc:mga0qj67_41213_c1 3300050509 Bacteria 3631
547 nmdc:mga0qj67_8360_c1 3300050509 Bacteria 7673
548 nmdc:mga06r32_204_c1 3300050510 Bacteria 47691
549 nmdc:mga06r32_29490_c1 3300050510 Bacteria 5143
550 nmdc:mga06r32_333204_c1 3300050510 Bacteria 1502
551 nmdc:mga06r32_477442_c1 3300050510 Unclassified 1225
552 nmdc:mga06r32_522429_c1 3300050510 Bacteria 1163
553 nmdc:mga06r32_614346_c1 3300050510 Bacteria 1057
554 nmdc:mga06r32_6756_c1 3300050510 Bacteria 10312
555 nmdc:mga08y16_17408_c1 3300050511 Bacteria 7567
556 nmdc:mga08y16_17998_c1 3300050511 Bacteria 7442
557 nmdc:mga08y16_279927_c1 3300050511 Bacteria 1721
558 nmdc:mga08y16_34555_c1 3300050511 Bacteria 5310
559 nmdc:mga08y16_49018_c1 3300050511 Bacteria 4420
560 nmdc:mga0n895_173674_c1 3300050512 Bacteria 2186
561 nmdc:mga0n895_19079_c1 3300050512 Bacteria 6366
562 nmdc:mga0n895_331251_c1 3300050512 Bacteria 1543
563 nmdc:mga0n895_440297_c1 3300050512 Bacteria 1317
564 nmdc:mga0n895_71500_c1 3300050512 Bacteria 3440
565 nmdc:mga0rr50_18120_c1 3300050513 Bacteria 4721
566 nmdc:mga0rr50_18596_c1 3300050513 Bacteria 4672
567 nmdc:mga0rr50_207982_c1 3300050513 Bacteria 1611
568 nmdc:mga0rr50_40537_c1 3300050513 Bacteria 3387
569 nmdc:mga0rr50_6054_c1 3300050513 Bacteria 7310
570 nmdc:mga08x19_130616_c1 3300050514 Bacteria 1689
571 nmdc:mga08x19_35278_c1 3300050514 Bacteria 3164
572 nmdc:mga08x19_5727_c1 3300050514 Bacteria 7345
573 nmdc:mga08x19_65846_c1 3300050514 Bacteria 2354
574 nmdc:mga0a205_137994_c1 3300050515 Bacteria 2339
575 nmdc:mga0a205_250279_c1 3300050515 Bacteria 1652
576 nmdc:mga0a205_93310_c1 3300050515 Bacteria 2908
577 Ga0501084_0075333 3300054114 Bacteria 2827
578 Ga0501084_0118461 3300054114 Bacteria 2226
579 Ga0501084_0335981 3300054114 Bacteria 1276
580 Ga0590071_000200 3300059421 Bacteria 17495
581 Ga0590071_034450 3300059421 Unclassified 1212
582 Ga0590074_002880 3300059423 Bacteria 2835
583 Ga0590075_000043 3300059424 Bacteria 33018
584 Ga0590075_003805 3300059424 Bacteria 3577
585 Ga0590077_000271 3300059426 Bacteria 14710
586 Ga0590077_010368 3300059426 Bacteria 1916
587 Ga0530510_0002812 3300061734 Bacteria 11972
588 Ga0530510_0176650 3300061734 Bacteria 1583
589 Ga0530510_0216500 3300061734 Unclassified 1423
590 Ga0070669_100014407
591 JGI24751J29686_10017571
592 Ga0058862_10242868
593 Ga0065704_10084518
594 Ga0065712_10073694
595 Ga0065712_10077304
596 Ga0065712_10085337
597 Ga0065712_10108477
598 Ga0065712_10133356
599 Ga0065715_10000556
600 Ga0065707_10006083
601 Ga0065707_10011223
602 Ga0070658_10077022
603 Ga0070676_10313551
604 Ga0070683_100002122
605 Ga0070683_100041151
606 Ga0070690_100105731
607 Ga0070670_100015394
608 Ga0070670_100049983
609 Ga0070670_100079230
610 Ga0070670_100106629
611 Ga0070670_100107744
612 Ga0068869_100164560
613 Ga0068869_100229413
614 Ga0070666_10088745
615 Ga0070666_10105896
616 Ga0070666_10199372
617 Ga0070680_100098513
618 Ga0070682_100162171
619 Ga0068868_100079012
620 Ga0068868_100088666
621 Ga0068868_100114423
622 Ga0068868_100241167
623 Ga0070660_100032149
624 Ga0070660_100281760
625 Ga0070689_100080739
626 Ga0070691_10059770
627 Ga0070661_100064070
628 Ga0070668_100081222
629 Ga0070668_100106113
630 Ga0070669_100008767
631 Ga0070669_100210861
632 Ga0070669_100371401
633 Ga0070675_100195713
634 Ga0070675_100215274
635 Ga0070675_100252492
636 Ga0070671_100008882
637 Ga0070671_100058757
638 Ga0070674_100006284
639 Ga0070674_100039703
640 Ga0070674_100137960
641 Ga0070673_100010797
642 Ga0070673_100063926
643 Ga0070673_100073969
644 Ga0070673_100220157
645 Ga0070673_100247303
646 Ga0070688_100134414
647 Ga0070659_100054461
648 Ga0070703_10028317
649 Ga0070701_10011202
650 Ga0070701_10031764
651 Ga0070705_100000125
652 Ga0070705_100017140
653 Ga0070705_100082361
654 Ga0070705_100136532
655 Ga0070700_100006437
656 Ga0070694_100004415
657 Ga0070694_100026294
658 Ga0070694_100111656
659 Ga0070663_100083777
660 Ga0070663_100298303
661 Ga0070678_100237314
662 Ga0070662_100042667
663 Ga0070662_100158461
664 Ga0070681_10024800
665 Ga0070681_10045715
666 Ga0070681_10059124
667 Ga0070681_10165636
668 Ga0068867_100006977
669 Ga0068867_100018591
670 Ga0068867_100235709
671 Ga0068867_100302734
672 Ga0068867_100310923
673 Ga0070706_100227099
674 Ga0070706_100433969
675 Ga0070707_100121695
676 Ga0070707_100138853
677 Ga0070707_100194474
678 Ga0070707_100196955
679 Ga0070707_100347949
680 Ga0070698_100000242
681 Ga0070698_100055179
682 Ga0070698_100099955
683 Ga0070698_100499005
684 Ga0070698_100606377
685 Ga0070699_100000778
686 Ga0070699_100081479
687 Ga0070699_100126149
688 Ga0070699_100146384
689 Ga0070679_100050343
690 Ga0070679_100064285
691 Ga0070679_100123549
692 Ga0070684_100000667
693 Ga0070684_100213975
694 Ga0070697_100024822
695 Ga0070672_100049868
696 Ga0070672_100204740
697 Ga0070686_100056212
698 Ga0070695_100033540
699 Ga0070695_100042058
700 Ga0070695_100069409
701 Ga0070696_100005181
702 Ga0070696_100024825
703 Ga0070696_100026966
704 Ga0070696_100163980
705 Ga0070665_100001839
706 Ga0070665_100015599
707 Ga0070665_100073214
708 Ga0070704_100000070
709 Ga0070704_100040787
710 Ga0070704_100072680
711 Ga0070704_100112469
712 Ga0070704_100124611
713 Ga0070704_100209651
714 Ga0068855_100054115
715 Ga0068855_100394375
716 Ga0070664_100003674
717 Ga0070664_100130918
718 Ga0070664_100216359
719 Ga0070664_100268875
720 Ga0068857_100020914
721 Ga0068856_100071029
722 Ga0068852_100295397
723 Ga0068859_100001412
724 Ga0068859_100015750
725 Ga0068859_100492219
726 Ga0068864_100006306
727 Ga0068864_100038316
728 Ga0068864_100101702
729 Ga0068866_10089160
730 Ga0068861_100107433
731 Ga0068861_100185676
732 Ga0068861_100296374
733 Ga0068870_10088348
734 Ga0068863_100102905
735 Ga0068858_100006552
736 Ga0068858_100081555
737 Ga0068858_100288256
738 Ga0068862_100033768
739 Ga0068862_100179652
740 Ga0068862_100223153
741 Ga0081539_10054412
742 Ga0081539_10059970
743 Ga0075365_10055710
744 Ga0075432_10080738
745 Ga0075367_10014592
746 Ga0075366_10028854
747 Ga0097621_100051140
748 Ga0097621_100058936
749 Ga0075370_10061647
750 Ga0068871_100115412
751 Ga0068871_100144988
752 Ga0068871_100200609
753 Ga0075428_100001118
754 Ga0075428_100005366
755 Ga0075428_100006836
756 Ga0075428_100009583
757 Ga0075428_100365287
758 Ga0075428_100438143
759 Ga0075428_100495415
760 Ga0075428_100573864
761 Ga0075430_100003268
762 Ga0075430_100003499
763 Ga0075430_100224071
764 Ga0075431_100001573
765 Ga0075431_100004721
766 Ga0075431_100026296
767 Ga0075433_10017086
768 Ga0075433_10273020
769 Ga0075433_10292060
770 Ga0075433_10297379
771 Ga0075434_100014860
772 Ga0075434_100020842
773 Ga0075434_100157176
774 Ga0075434_100270691
775 Ga0075434_100399225
776 Ga0075429_100001841
777 Ga0075429_100004486
778 Ga0075429_100013618
779 Ga0075429_100202410
780 Ga0075436_100019148
781 Ga0075436_100038041
782 Ga0075436_100142176
783 Ga0075436_100186439
784 Ga0097620_100001412
785 Ga0097620_100015750
786 Ga0097620_100492232
787 Ga0075435_100003309
788 Ga0075435_100008119
789 Ga0075435_100014963
790 Ga0075435_100032960
791 Ga0075435_100080617
792 Ga0075435_100115113
793 Ga0105240_10018497
794 Ga0105240_10563808
795 Ga0111539_10024044
796 Ga0111539_10031900
797 Ga0111539_10042419
798 Ga0111539_10249953
799 Ga0111539_10372499
800 Ga0105245_10109897
801 Ga0105245_10177006
802 Ga0105245_10626836
803 Ga0105247_10010260
804 Ga0105247_10035986
805 Ga0114129_10001599
806 Ga0114129_10001632
807 Ga0114129_10003225
808 Ga0114129_10005941
809 Ga0114129_10010159
810 Ga0114129_10027475
811 Ga0114129_10098341
812 Ga0114129_10253173
813 Ga0114129_10386891
814 Ga0114129_10535009
815 Ga0114129_10640291
816 Ga0114129_10680791
817 Ga0105243_10533700
818 Ga0105241_10052360
819 Ga0105242_10014533
820 Ga0105242_10023427
821 Ga0105242_10026863
822 Ga0105242_10039699
823 Ga0105248_10050624
824 Ga0105248_10095369
825 Ga0105248_10190736
826 Ga0105248_10224405
827 Ga0105248_10442194
828 Ga0105248_10465562
829 Ga0105237_10214828
830 Ga0105238_10581033
831 Ga0105249_10008602
832 Ga0105249_10111825
833 Ga0105249_10161103
834 Ga0105249_10201714
835 Ga0105249_10431654
836 Ga0105249_10551331
837 Ga0105246_10292664
838 Ga0105246_10302409
839 Ga0157374_10030076
840 Ga0157378_10160295
841 Ga0157378_10349058
842 Ga0163162_10145987
843 Ga0163162_10486781
844 Ga0157372_10305728
845 Ga0157375_10121167
846 Ga0157375_10230026
847 Ga0157375_10423034
848 Ga0157375_10773876
849 Ga0163163_10011651
850 Ga0163163_10073168
851 Ga0163163_10236122
852 Ga0163163_10440768
853 Ga0157380_10068349
854 Ga0157380_10100989
855 Ga0157380_10120965
856 Ga0157380_10496280
857 Ga0157377_10087478
858 Ga0157377_10251090
859 Ga0157379_10016768
860 Ga0157379_10027008
861 Ga0157376_10018196
862 Ga0157376_10051429
863 Ga0157376_10054858
864 Ga0157376_10090715
865 Ga0157376_10254847
866 Ga0157376_10549708
867 Ga0207697_10000882
868 Ga0207653_10053164
869 Ga0207710_10033879
870 Ga0207710_10039758
871 Ga0207688_10010811
872 Ga0207688_10248055
873 Ga0207680_10045484
874 Ga0207680_10192548
875 Ga0207647_10109833
876 Ga0207699_10083699
877 Ga0207645_10042396
878 Ga0207643_10030716
879 Ga0207705_10092201
880 Ga0207707_10134859
881 Ga0207695_10140630
882 Ga0207671_10293590
883 Ga0207660_10141439
884 Ga0207662_10048008
885 Ga0207657_10016007
886 Ga0207657_10244003
887 Ga0207649_10015384
888 Ga0207652_10065726
889 Ga0207652_10326529
890 Ga0207646_10155362
891 Ga0207646_10168459
892 Ga0207646_10173610
893 Ga0207646_10301327
894 Ga0207681_10034589
895 Ga0207681_10089767
896 Ga0207681_10114806
897 Ga0207650_10021374
898 Ga0207650_10048688
899 Ga0207650_10049227
900 Ga0207650_10110783
901 Ga0207650_10122309
902 Ga0207650_10130620
903 Ga0207659_10007903
904 Ga0207659_10137205
905 Ga0207659_10178176
906 Ga0207687_10175300
907 Ga0207690_10410567
908 Ga0207706_10019338
909 Ga0207706_10058818
910 Ga0207686_10006041
911 Ga0207686_10063203
912 Ga0207686_10099017
913 Ga0207670_10018124
914 Ga0207670_10186463
915 Ga0207669_10028255
916 Ga0207669_10420304
917 Ga0207691_10025789
918 Ga0207691_10060272
919 Ga0207691_10067188
920 Ga0207691_10093128
921 Ga0207691_10171284
922 Ga0207691_10217354
923 Ga0207711_10058094
924 Ga0207711_10174990
925 Ga0207711_10206499
926 Ga0207689_10101305
927 Ga0207689_10154737
928 Ga0207661_10003548
929 Ga0207679_10001740
930 Ga0207679_10023165
931 Ga0207679_10127089
932 Ga0207679_10133519
933 Ga0207679_10183612
934 Ga0207679_10193243
935 Ga0207679_10320118
936 Ga0207667_10255479
937 Ga0207667_10469464
938 Ga0207651_10016255
939 Ga0207651_10034215
940 Ga0207651_10057504
941 Ga0207651_10110466
942 Ga0207712_10015340
943 Ga0207712_10165686
944 Ga0207668_10030522
945 Ga0207668_10034432
946 Ga0207677_10118174
947 Ga0207677_10373616
948 Ga0207703_10071726
949 Ga0207703_10170334
950 Ga0207703_10265104
951 Ga0207703_10292698
952 Ga0207678_10022216
953 Ga0207708_10003079
954 Ga0207708_10011019
955 Ga0207708_10048107
956 Ga0207708_10096923
957 Ga0207702_10087575
958 Ga0207702_10378334
959 Ga0207641_10058971
960 Ga0207641_10179071
961 Ga0207648_10001011
962 Ga0207648_10048862
963 Ga0207648_10159917
964 Ga0207648_10212219
965 Ga0207648_10400707
966 Ga0207676_10014310
967 Ga0207674_10010755
968 Ga0207674_10011945
969 Ga0207675_100008575
970 Ga0207675_100031553
971 Ga0207675_100106322
972 Ga0207675_100110514
973 Ga0207675_100224887
974 Ga0207675_100269535
975 Ga0207675_100391318
976 Ga0207683_10012647
977 Ga0207683_10119670
978 Ga0210002_1017476
979 Ga0207428_10003684
980 Ga0207428_10003797
981 Ga0207428_10110531
982 Ga0268266_10013430
983 Ga0268265_10003984
984 Ga0268265_10023826
985 Ga0268265_10059207
986 Ga0268265_10194294
987 Ga0268265_10227069
988 Ga0268265_10466688
989 Ga0268264_10055667
990 Ga0268264_10279850
991 Ga0307408_100009304
992 Ga0307408_100013515
993 Ga0307408_100142722
994 Ga0307405_10185895
995 Ga0307405_10357257
996 Ga0307413_10210013
997 Ga0307406_10011762
998 Ga0307407_10166177
999 Ga0307407_10304164
1000 Ga0307412_10224390
1001 Ga0307409_100028970
1002 Ga0307409_100362039
1003 Ga0307416_100009776
1004 Ga0307416_100023327
1005 Ga0307416_100059818
1006 Ga0307414_10687625
1007 Ga0307411_10026991
1008 Ga0307411_10128118
1009 Ga0307411_10131475
1010 Ga0307411_10182163
1011 Ga0307415_100063778
1012 Ga0373934_0193901
1013 Ga0373939_0030384
1014 Ga0373955_0133581
1015 Ga0373935_0275207
1016 Ga0373947_0009595
1017 Ga0373937_0011601
1018 Ga0373937_0246963
1019 Ga0373925_0098182
1020 Ga0373925_0179789
1021 Ga0373925_0643851
1022 Ga0395905_0643627
1023 Ga0439455_0047224
1024 Ga0439460_0013893
1025 Ga0451577_0059852
1026 Ga0451577_0125199
1027 Ga0451577_0309019
1028 Ga0451576_0005762
1029 Ga0451576_0019965
1030 Ga0451576_0023822
1031 Ga0451576_0079898
1032 Ga0466967_0108975
1033 Ga0495629_0211023
1034 Ga0495580_0101385
1035 Ga0495639_0108992
1036 Ga0495584_0020295
1037 Ga0495594_0030909
1038 Ga0495663_0064152
1039 Ga0495642_0007585
1040 Ga0495621_0044412
1041 Ga0495656_0157053
1042 Ga0495659_0002913
1043 Ga0495659_0012524
1044 Ga0495659_0085841
1045 Ga0495588_0013672
1046 Ga0495647_0022995
1047 Ga0495669_0057725
1048 Ga0495669_0113098
1049 Ga0495636_0008949
1050 Ga0495677_0059861
1051 Ga0495684_0199116
1052 Ga0496102_0127589
1053 Ga0496102_0692756
1054 Ga0496103_0298881
1055 Ga0496104_0003484
1056 Ga0496104_0019850
1057 Ga0496106_0046022
1058 Ga0496108_0052223
1059 Ga0496108_0142260
1060 Ga0496109_0076925
1061 Ga0496109_0194339
1062 Ga0496109_0465045
1063 Ga0496110_0015426
1064 Ga0496110_0032766
1065 Ga0496110_0083285
1066 Ga0496110_0260058
1067 Ga0496110_0414324
1068 Ga0496111_0003512
1069 Ga0496112_0000420
1070 Ga0496112_0049252
1071 Ga0496112_0062431
1072 Ga0496113_0039893
1073 Ga0496114_0381866
1074 Ga0496115_0299605
1075 Ga0501031_0269298
1076 Ga0501036_0089611
1077 Ga0501039_0099602
1078 Ga0501039_0123210
1079 Ga0501040_0028342
1080 Ga0501040_0081331
1081 Ga0501041_0034939
1082 Ga0501041_0138368
1083 Ga0501042_0300399
1084 Ga0501067_0068837
1085 Ga0501070_0173675
1086 Ga0501071_0014848
1087 Ga0501072_0039906
1088 Ga0501072_0043859
1089 Ga0501072_0142377
1090 Ga0501074_0054736
1091 Ga0501075_0006859
1092 Ga0501075_0009203
1093 Ga0501075_0097019
1094 Ga0501075_0313443
1095 Ga0501076_0024020
1096 Ga0501076_0049529
1097 Ga0501076_0152434
1098 Ga0501076_0197764
1099 Ga0501233_018165
1100 Ga0501235_029941
1101 Ga0501259_008804
1102 Ga0501079_0110596
1103 Ga0501079_0112029
1104 Ga0501079_0131832
1105 Ga0501079_0161186
1106 Ga0501079_0278438
1107 Ga0501080_0385213
1108 Ga0501081_0020522
1109 Ga0501081_0068381
1110 Ga0501081_0146418
1111 Ga0501081_0174180
1112 Ga0501035_0073837
1113 Ga0501035_0265285
1114 Ga0501044_0164931
1115 Ga0501045_0019971
1116 Ga0501045_0041605
1117 nmdc:mga0yw44_66468_c1
1118 nmdc:mga05p37_115325_c1
1119 nmdc:mga05p37_15084_c1
1120 nmdc:mga05p37_155715_c1
1121 nmdc:mga05p37_196444_c1
1122 nmdc:mga05p37_1985_c1
1123 nmdc:mga05p37_2339_c1
1124 nmdc:mga05p37_235878_c1
1125 nmdc:mga05p37_282507_c1
1126 nmdc:mga05p37_318820_c1
1127 nmdc:mga05p37_3981_c1
1128 nmdc:mga05p37_65755_c1
1129 nmdc:mga05p37_73092_c1
1130 nmdc:mga09592_50525_c1
1131 nmdc:mga09592_5421_c1
1132 nmdc:mga09592_6096_c1
1133 nmdc:mga09592_6181_c1
1134 nmdc:mga0qj67_286849_c1
1135 nmdc:mga0qj67_41213_c1
1136 nmdc:mga0qj67_8360_c1
1137 nmdc:mga06r32_204_c1
1138 nmdc:mga06r32_29490_c1
1139 nmdc:mga06r32_333204_c1
1140 nmdc:mga06r32_477442_c1
1141 nmdc:mga06r32_522429_c1
1142 nmdc:mga06r32_614346_c1
1143 nmdc:mga06r32_6756_c1
1144 nmdc:mga08y16_17408_c1
1145 nmdc:mga08y16_17998_c1
1146 nmdc:mga08y16_279927_c1
1147 nmdc:mga08y16_34555_c1
1148 nmdc:mga08y16_49018_c1
1149 nmdc:mga0n895_173674_c1
1150 nmdc:mga0n895_19079_c1
1151 nmdc:mga0n895_331251_c1
1152 nmdc:mga0n895_440297_c1
1153 nmdc:mga0n895_71500_c1
1154 nmdc:mga0rr50_18120_c1
1155 nmdc:mga0rr50_18596_c1
1156 nmdc:mga0rr50_207982_c1
1157 nmdc:mga0rr50_40537_c1
1158 nmdc:mga0rr50_6054_c1
1159 nmdc:mga08x19_130616_c1
1160 nmdc:mga08x19_35278_c1
1161 nmdc:mga08x19_5727_c1
1162 nmdc:mga08x19_65846_c1
1163 nmdc:mga0a205_137994_c1
1164 nmdc:mga0a205_250279_c1
1165 nmdc:mga0a205_93310_c1
1166 Ga0501084_0075333
1167 Ga0501084_0118461
1168 Ga0501084_0335981
1169 Ga0590071_000200
1170 Ga0590071_034450
1171 Ga0590074_002880
1172 Ga0590075_000043
1173 Ga0590075_003805
1174 Ga0590077_000271
1175 Ga0590077_010368
1176 Ga0530510_0002812
1177 Ga0530510_0176650
1178 Ga0530510_0216500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13365

Trypsin_2

Trypsin-like peptidase domain

170

312

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pv5-assembly1.cif.gz_D structure of legionella fallonii degq (n189g/p190g variant) 0.8614 100 282
3pv5-assembly1.cif.gz_B structure of legionella fallonii degq (n189g/p190g variant) 0.8576 99 282
4yo1-assembly1.cif.gz_A structure of legionella pneumophila degq (delta pdz2 variant) 0.8572 99 282
5jd8-assembly1.cif.gz_A crystal structure of the serine endoprotease from yersinia pestis 0.8481 101 282
2w5e-assembly1.cif.gz_F structural and biochemical analysis of human pathogenic astrovirus serine protease at 2.0 angstrom resolution 0.8474 106 286
ID Description Score Start End Superfamily
3stjA01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8391 98 192 2.40.10.10
2r3uC02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.836 202 282 2.40.10.10
3mh7A02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.829 207 282 2.40.10.10
3lt3B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8156 98 200 2.40.10.10
3mh4B02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8152 207 283 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A3N5ZY34-F1-model_v4 Serine protease 0.9536 95 293 GO:0006508
GO:0008233
AF-A0A1Q7ANI9-F1-model_v4 Serine protease 0.9504 161 293
AF-A0A3D3QSD1-F1-model_v4 deleted 0.8718 105 282
AF-A0A4Q2A3K9-F1-model_v4 SLH domain-containing protein 0.8701 96 282 GO:0004252
GO:0006508
AF-A0A7K3MBN7-F1-model_v4 Trypsin-like serine protease 0.8661 99 282 GO:0004252
GO:0006508
GO:0016020

Map