F466805
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 588 | 327 | 1176 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300046665|Ga0495661_0208468|Ga0495661_0208468_343_942 |
| Length | 199 |
| Sequence | LRGAGLSNAGSVKQERHMKAIDTAIPDVKIIEPAVFADDRGFFLESFNQAKFEAAIGRSAAFVQDNHSRSGKGVLRGLHYQLPPHAQAKLVRVVVGEVYDVAVDIRRSSPTFGQWVGVLLSEENKRQLWIPEGFAHGFLTLSDRVEFLYKTTNYYAPTSDRGIRWDDPKIAIDWKTVGALTLSAKDERQPLLADAELFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 168 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 175 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 182 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 186 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 190 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 191 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 261 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 262 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 263 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 267 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 268 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 269 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 277 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 278 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 281 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 282 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 285 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 286 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 287 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 288 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 294 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 295 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 296 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 297 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 298 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 299 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 300 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 301 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 302 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 303 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 304 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 305 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 306 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 307 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 308 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 309 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 310 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 311 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 312 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 313 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 314 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 315 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 316 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 317 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 318 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 319 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 320 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 321 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 322 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 323 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 324 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 325 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 326 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 327 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.71 |
| Metatranscriptomes | 0.17 |
| Isolates | 6.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.46 |
| Nodule | 2.55 |
| Rhizoplane | 2.38 |
| Rhizosphere | 81.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495661_0208468 | 3300046665 | Bacteria | 1019 |
| 2 | MBSR1b_contig_3521707 | 2162886012 | Bacteria | 952 |
| 3 | JGI24740J21852_10000280 | 3300001979 | Bacteria | 21665 |
| 4 | JGI25155J39150_1000199 | 3300002704 | Bacteria | 25175 |
| 5 | JGI25156J39149_1000449 | 3300002705 | Bacteria | 25175 |
| 6 | JGI25162J39368_1000275 | 3300002737 | Bacteria | 49524 |
| 7 | JGI25154J39366_1000369 | 3300002738 | Bacteria | 25163 |
| 8 | JGI25157J39369_1000477 | 3300002741 | Bacteria | 25175 |
| 9 | JGI25159J45721_1001650 | 3300002987 | Bacteria | 9073 |
| 10 | JGI25165J46597_1000624 | 3300003214 | Bacteria | 29664 |
| 11 | JGI25165J46597_1004634 | 3300003214 | Bacteria | 2882 |
| 12 | rootL2_10122418 | 3300003322 | Bacteria | 2640 |
| 13 | rootL2_10132744 | 3300003322 | Bacteria | 1661 |
| 14 | rootL2_10194887 | 3300003322 | Bacteria | 1313 |
| 15 | JGI25160J50197_1000109 | 3300003354 | Bacteria | 77318 |
| 16 | JGI25161J50226_1000011 | 3300003374 | Bacteria | 210140 |
| 17 | Ga0055539_1010720 | 3300003752 | Bacteria | 1134 |
| 18 | Ga0055543_1000071 | 3300004625 | Bacteria | 91797 |
| 19 | Ga0058860_12097694 | 3300004801 | Bacteria | 3353 |
| 20 | Ga0065165_1000135 | 3300005262 | Bacteria | 127785 |
| 21 | Ga0065712_10150888 | 3300005290 | Bacteria | 1371 |
| 22 | Ga0065715_10208708 | 3300005293 | Bacteria | 1324 |
| 23 | Ga0070658_10104644 | 3300005327 | Bacteria | 2341 |
| 24 | Ga0070676_10072444 | 3300005328 | Bacteria | 2071 |
| 25 | Ga0070683_100103511 | 3300005329 | Bacteria | 2683 |
| 26 | Ga0070683_100139643 | 3300005329 | Bacteria | 2295 |
| 27 | Ga0070683_100169646 | 3300005329 | Bacteria | 2071 |
| 28 | Ga0070683_100259380 | 3300005329 | Bacteria | 1653 |
| 29 | Ga0070690_100363023 | 3300005330 | Bacteria | 1054 |
| 30 | Ga0070670_100035186 | 3300005331 | Bacteria | 4312 |
| 31 | Ga0070680_100032774 | 3300005336 | Bacteria | 4183 |
| 32 | Ga0070680_100187596 | 3300005336 | Bacteria | 1742 |
| 33 | Ga0070682_100393202 | 3300005337 | Bacteria | 1046 |
| 34 | Ga0068868_100001617 | 3300005338 | Bacteria | 15375 |
| 35 | Ga0068868_100056641 | 3300005338 | Bacteria | 3096 |
| 36 | Ga0068868_100064484 | 3300005338 | Bacteria | 2908 |
| 37 | Ga0070660_100357378 | 3300005339 | Bacteria | 1203 |
| 38 | Ga0070661_100115874 | 3300005344 | Bacteria | 2004 |
| 39 | Ga0070675_100102169 | 3300005354 | Bacteria | 2415 |
| 40 | Ga0070675_100472046 | 3300005354 | Bacteria | 1127 |
| 41 | Ga0070671_100574714 | 3300005355 | Bacteria | 973 |
| 42 | Ga0070667_100047266 | 3300005367 | Bacteria | 3621 |
| 43 | Ga0070709_10174113 | 3300005434 | Bacteria | 1506 |
| 44 | Ga0070714_100022363 | 3300005435 | Bacteria | 5185 |
| 45 | Ga0070714_100267671 | 3300005435 | Bacteria | 1584 |
| 46 | Ga0070714_100277493 | 3300005435 | Bacteria | 1556 |
| 47 | Ga0070714_100387846 | 3300005435 | Bacteria | 1318 |
| 48 | Ga0070713_100001380 | 3300005436 | Bacteria | 15537 |
| 49 | Ga0070713_100081658 | 3300005436 | Unclassified | 2759 |
| 50 | Ga0070713_100142969 | 3300005436 | Bacteria | 2121 |
| 51 | Ga0070713_100460186 | 3300005436 | Bacteria | 1196 |
| 52 | Ga0070713_100731308 | 3300005436 | Bacteria | 946 |
| 53 | Ga0070713_100733705 | 3300005436 | Bacteria | 944 |
| 54 | Ga0070713_101004748 | 3300005436 | Unclassified | 805 |
| 55 | Ga0070710_10250136 | 3300005437 | Bacteria | 1139 |
| 56 | Ga0070711_100138112 | 3300005439 | Unclassified | 1824 |
| 57 | Ga0070711_100266180 | 3300005439 | Bacteria | 1351 |
| 58 | Ga0070711_101002163 | 3300005439 | Bacteria | 717 |
| 59 | Ga0070705_100191847 | 3300005440 | Bacteria | 1393 |
| 60 | Ga0070694_100275393 | 3300005444 | Bacteria | 1281 |
| 61 | Ga0070663_101371466 | 3300005455 | Bacteria | 625 |
| 62 | Ga0070681_10000034 | 3300005458 | Bacteria | 98600 |
| 63 | Ga0070681_10008371 | 3300005458 | Bacteria | 10132 |
| 64 | Ga0070681_10074241 | 3300005458 | Bacteria | 3362 |
| 65 | Ga0070681_10091625 | 3300005458 | Bacteria | 2990 |
| 66 | Ga0070681_10334840 | 3300005458 | Bacteria | 1423 |
| 67 | Ga0068867_100003633 | 3300005459 | Bacteria | 10854 |
| 68 | Ga0068867_100165320 | 3300005459 | Bacteria | 1748 |
| 69 | Ga0070707_100313490 | 3300005468 | Bacteria | 1524 |
| 70 | Ga0070679_100000270 | 3300005530 | Bacteria | 43437 |
| 71 | Ga0070679_100015329 | 3300005530 | Bacteria | 7364 |
| 72 | Ga0070679_100060787 | 3300005530 | Bacteria | 3765 |
| 73 | Ga0070679_100615610 | 3300005530 | Bacteria | 1029 |
| 74 | Ga0070684_100032961 | 3300005535 | Bacteria | 4420 |
| 75 | Ga0070684_100040300 | 3300005535 | Bacteria | 4021 |
| 76 | Ga0070684_100303531 | 3300005535 | Bacteria | 1465 |
| 77 | Ga0070684_100427903 | 3300005535 | Bacteria | 1222 |
| 78 | Ga0068853_100032352 | 3300005539 | Bacteria | 4430 |
| 79 | Ga0068853_100105856 | 3300005539 | Bacteria | 2492 |
| 80 | Ga0068853_100386849 | 3300005539 | Bacteria | 1307 |
| 81 | Ga0070696_100432591 | 3300005546 | Bacteria | 1035 |
| 82 | Ga0070693_100084672 | 3300005547 | Bacteria | 1898 |
| 83 | Ga0070693_100529536 | 3300005547 | Unclassified | 840 |
| 84 | Ga0070665_100010723 | 3300005548 | Bacteria | 9277 |
| 85 | Ga0068855_100000414 | 3300005563 | Bacteria | 52978 |
| 86 | Ga0068855_100001570 | 3300005563 | Bacteria | 28673 |
| 87 | Ga0068855_100002685 | 3300005563 | Bacteria | 21936 |
| 88 | Ga0068855_100013420 | 3300005563 | Bacteria | 9879 |
| 89 | Ga0068855_100031858 | 3300005563 | Bacteria | 6294 |
| 90 | Ga0068855_100032767 | 3300005563 | Bacteria | 6204 |
| 91 | Ga0068855_100062785 | 3300005563 | Bacteria | 4336 |
| 92 | Ga0068855_100082865 | 3300005563 | Bacteria | 3717 |
| 93 | Ga0068855_100195488 | 3300005563 | Bacteria | 2279 |
| 94 | Ga0068855_100406398 | 3300005563 | Bacteria | 1491 |
| 95 | Ga0068855_101228270 | 3300005563 | Unclassified | 778 |
| 96 | Ga0070664_100012196 | 3300005564 | Bacteria | 6984 |
| 97 | Ga0070664_100080878 | 3300005564 | Bacteria | 2799 |
| 98 | Ga0070664_100125614 | 3300005564 | Bacteria | 2250 |
| 99 | Ga0070664_100402892 | 3300005564 | Unclassified | 1251 |
| 100 | Ga0068857_100001766 | 3300005577 | Bacteria | 17387 |
| 101 | Ga0068857_100002576 | 3300005577 | Bacteria | 14854 |
| 102 | Ga0068857_100823531 | 3300005577 | Bacteria | 887 |
| 103 | Ga0068854_100019459 | 3300005578 | Bacteria | 4576 |
| 104 | Ga0068854_100021020 | 3300005578 | Bacteria | 4424 |
| 105 | Ga0068854_100111488 | 3300005578 | Bacteria | 2064 |
| 106 | Ga0068856_100000494 | 3300005614 | Bacteria | 43641 |
| 107 | Ga0068856_100000541 | 3300005614 | Bacteria | 41709 |
| 108 | Ga0068856_100000571 | 3300005614 | Bacteria | 40367 |
| 109 | Ga0068856_100006335 | 3300005614 | Bacteria | 11608 |
| 110 | Ga0068856_100078287 | 3300005614 | Bacteria | 3278 |
| 111 | Ga0068856_100344938 | 3300005614 | Bacteria | 1508 |
| 112 | Ga0070702_100170233 | 3300005615 | Bacteria | 1416 |
| 113 | Ga0070702_100263103 | 3300005615 | Bacteria | 1175 |
| 114 | Ga0068852_100014521 | 3300005616 | Bacteria | 6068 |
| 115 | Ga0068852_100036527 | 3300005616 | Bacteria | 4112 |
| 116 | Ga0068852_100092954 | 3300005616 | Bacteria | 2702 |
| 117 | Ga0068852_100711051 | 3300005616 | Bacteria | 1015 |
| 118 | Ga0068852_100983899 | 3300005616 | Unclassified | 862 |
| 119 | Ga0068859_100010624 | 3300005617 | Bacteria | 9264 |
| 120 | Ga0068864_100005671 | 3300005618 | Bacteria | 10228 |
| 121 | Ga0068864_100142843 | 3300005618 | Bacteria | 2161 |
| 122 | Ga0068866_10132539 | 3300005718 | Bacteria | 1419 |
| 123 | Ga0068851_10038270 | 3300005834 | Bacteria | 2405 |
| 124 | Ga0068851_10118004 | 3300005834 | Bacteria | 1423 |
| 125 | Ga0068863_100008914 | 3300005841 | Bacteria | 9794 |
| 126 | Ga0068858_100001544 | 3300005842 | Bacteria | 23649 |
| 127 | Ga0068858_100045946 | 3300005842 | Bacteria | 4049 |
| 128 | Ga0068858_100059316 | 3300005842 | Bacteria | 3537 |
| 129 | Ga0068860_100022636 | 3300005843 | Bacteria | 6076 |
| 130 | Ga0068860_100187394 | 3300005843 | Bacteria | 2001 |
| 131 | Ga0068860_100205836 | 3300005843 | Bacteria | 1908 |
| 132 | Ga0068862_100089901 | 3300005844 | Bacteria | 2673 |
| 133 | Ga0070717_10008734 | 3300006028 | Bacteria | 7581 |
| 134 | Ga0070717_10030352 | 3300006028 | Bacteria | 4342 |
| 135 | Ga0070717_10166232 | 3300006028 | Bacteria | 1916 |
| 136 | Ga0070717_11248483 | 3300006028 | Unclassified | 676 |
| 137 | Ga0075432_10003368 | 3300006058 | Bacteria | 5404 |
| 138 | Ga0070716_100140030 | 3300006173 | Bacteria | 1541 |
| 139 | Ga0070712_100007726 | 3300006175 | Bacteria | 6727 |
| 140 | Ga0075366_10024188 | 3300006195 | Bacteria | 3543 |
| 141 | Ga0097621_100000014 | 3300006237 | Bacteria | 100839 |
| 142 | Ga0097621_100000229 | 3300006237 | Bacteria | 37450 |
| 143 | Ga0097621_100024710 | 3300006237 | Bacteria | 4695 |
| 144 | Ga0097621_100118061 | 3300006237 | Bacteria | 2248 |
| 145 | Ga0068871_100000071 | 3300006358 | Bacteria | 57255 |
| 146 | Ga0068871_100001973 | 3300006358 | Bacteria | 13910 |
| 147 | Ga0068871_100015157 | 3300006358 | Bacteria | 5762 |
| 148 | Ga0068871_100854283 | 3300006358 | Bacteria | 841 |
| 149 | Ga0068871_101206033 | 3300006358 | Unclassified | 710 |
| 150 | Ga0075428_100038053 | 3300006844 | Bacteria | 5295 |
| 151 | Ga0075434_101349996 | 3300006871 | Unclassified | 723 |
| 152 | Ga0068865_100035373 | 3300006881 | Bacteria | 3358 |
| 153 | Ga0068865_100112346 | 3300006881 | Bacteria | 2012 |
| 154 | Ga0097620_100010623 | 3300006931 | Bacteria | 9264 |
| 155 | Ga0105240_10000314 | 3300009093 | Bacteria | 93043 |
| 156 | Ga0105240_10007208 | 3300009093 | Bacteria | 16192 |
| 157 | Ga0105240_10020425 | 3300009093 | Bacteria | 8834 |
| 158 | Ga0105240_10108702 | 3300009093 | Bacteria | 3359 |
| 159 | Ga0105240_10127027 | 3300009093 | Bacteria | 3063 |
| 160 | Ga0105240_10229568 | 3300009093 | Bacteria | 2158 |
| 161 | Ga0105240_10255301 | 3300009093 | Bacteria | 2025 |
| 162 | Ga0105240_10694957 | 3300009093 | Unclassified | 1111 |
| 163 | Ga0105245_10416679 | 3300009098 | Bacteria | 1345 |
| 164 | Ga0105247_10276618 | 3300009101 | Bacteria | 1157 |
| 165 | Ga0105243_10000677 | 3300009148 | Bacteria | 33243 |
| 166 | Ga0105241_10039542 | 3300009174 | Bacteria | 3558 |
| 167 | Ga0105241_10084449 | 3300009174 | Bacteria | 2493 |
| 168 | Ga0105241_10243638 | 3300009174 | Bacteria | 1521 |
| 169 | Ga0105242_10160156 | 3300009176 | Bacteria | 1969 |
| 170 | Ga0105248_10047329 | 3300009177 | Bacteria | 4823 |
| 171 | Ga0105248_10441343 | 3300009177 | Bacteria | 1466 |
| 172 | Ga0105237_10024440 | 3300009545 | Bacteria | 6180 |
| 173 | Ga0105237_10081608 | 3300009545 | Bacteria | 3225 |
| 174 | Ga0105237_10112015 | 3300009545 | Bacteria | 2721 |
| 175 | Ga0105237_10280289 | 3300009545 | Unclassified | 1669 |
| 176 | Ga0105237_10530278 | 3300009545 | Bacteria | 1184 |
| 177 | Ga0105238_10000099 | 3300009551 | Bacteria | 97818 |
| 178 | Ga0105238_10050797 | 3300009551 | Bacteria | 4173 |
| 179 | Ga0105238_10115524 | 3300009551 | Bacteria | 2663 |
| 180 | Ga0105238_10168855 | 3300009551 | Bacteria | 2164 |
| 181 | Ga0105249_10302237 | 3300009553 | Bacteria | 1605 |
| 182 | Ga0105239_10050797 | 3300010375 | Bacteria | 4546 |
| 183 | Ga0105239_10222194 | 3300010375 | Bacteria | 2118 |
| 184 | Ga0105239_10436583 | 3300010375 | Bacteria | 1484 |
| 185 | Ga0105246_10104781 | 3300011119 | Bacteria | 2066 |
| 186 | Ga0157373_10005586 | 3300013100 | Bacteria | 9429 |
| 187 | Ga0157373_10334048 | 3300013100 | Bacteria | 1079 |
| 188 | Ga0157371_10003695 | 3300013102 | Bacteria | 13739 |
| 189 | Ga0157371_10071956 | 3300013102 | Bacteria | 2448 |
| 190 | Ga0157371_10098349 | 3300013102 | Bacteria | 2075 |
| 191 | Ga0157371_10196375 | 3300013102 | Bacteria | 1446 |
| 192 | Ga0157370_10000938 | 3300013104 | Bacteria | 37043 |
| 193 | Ga0157370_10004401 | 3300013104 | Bacteria | 16161 |
| 194 | Ga0157370_10106492 | 3300013104 | Bacteria | 2624 |
| 195 | Ga0157370_10154190 | 3300013104 | Bacteria | 2137 |
| 196 | Ga0157370_10433628 | 3300013104 | Bacteria | 1208 |
| 197 | Ga0157369_10000042 | 3300013105 | Bacteria | 181784 |
| 198 | Ga0157369_10022583 | 3300013105 | Bacteria | 7018 |
| 199 | Ga0157369_10052608 | 3300013105 | Bacteria | 4406 |
| 200 | Ga0157369_10058915 | 3300013105 | Bacteria | 4142 |
| 201 | Ga0157369_10200076 | 3300013105 | Bacteria | 2097 |
| 202 | Ga0157369_10220182 | 3300013105 | Bacteria | 1987 |
| 203 | Ga0157369_10273724 | 3300013105 | Bacteria | 1759 |
| 204 | Ga0157369_10404660 | 3300013105 | Bacteria | 1416 |
| 205 | Ga0157374_10001647 | 3300013296 | Bacteria | 18695 |
| 206 | Ga0157374_10002559 | 3300013296 | Bacteria | 15345 |
| 207 | Ga0157374_10076293 | 3300013296 | Bacteria | 3169 |
| 208 | Ga0157378_10000733 | 3300013297 | Bacteria | 30679 |
| 209 | Ga0157378_10003197 | 3300013297 | Bacteria | 14554 |
| 210 | Ga0157378_10005107 | 3300013297 | Bacteria | 11523 |
| 211 | Ga0157378_11199864 | 3300013297 | Unclassified | 798 |
| 212 | Ga0163162_10212663 | 3300013306 | Bacteria | 2064 |
| 213 | Ga0157372_10000287 | 3300013307 | Bacteria | 56080 |
| 214 | Ga0157372_10002160 | 3300013307 | Bacteria | 21394 |
| 215 | Ga0157372_10003621 | 3300013307 | Bacteria | 16626 |
| 216 | Ga0157372_10292773 | 3300013307 | Bacteria | 1893 |
| 217 | Ga0157372_10297793 | 3300013307 | Unclassified | 1876 |
| 218 | Ga0157372_10309558 | 3300013307 | Bacteria | 1838 |
| 219 | Ga0157372_10555202 | 3300013307 | Bacteria | 1339 |
| 220 | Ga0157372_10613763 | 3300013307 | Bacteria | 1268 |
| 221 | Ga0157375_10433592 | 3300013308 | Bacteria | 1480 |
| 222 | Ga0157375_10683004 | 3300013308 | Bacteria | 1181 |
| 223 | Ga0182008_10004198 | 3300014497 | Bacteria | 8472 |
| 224 | Ga0157376_10009682 | 3300014969 | Bacteria | 7012 |
| 225 | Ga0157376_10063366 | 3300014969 | Bacteria | 3114 |
| 226 | Ga0182007_10029950 | 3300015262 | Bacteria | 1862 |
| 227 | Ga0213872_10004354 | 3300021361 | Bacteria | 7541 |
| 228 | Ga0209435_100133 | 3300025206 | Bacteria | 25498 |
| 229 | Ga0209437_100239 | 3300025233 | Bacteria | 89942 |
| 230 | Ga0209437_104877 | 3300025233 | Bacteria | 2328 |
| 231 | Ga0209646_1000404 | 3300025246 | Bacteria | 25498 |
| 232 | Ga0209026_1000558 | 3300025250 | Bacteria | 25498 |
| 233 | Ga0209677_101140 | 3300025253 | Bacteria | 12420 |
| 234 | Ga0209148_1014143 | 3300025254 | Bacteria | 1416 |
| 235 | Ga0209759_1000800 | 3300025256 | Bacteria | 25498 |
| 236 | Ga0209759_1013700 | 3300025256 | Bacteria | 2179 |
| 237 | Ga0209233_1000245 | 3300025261 | Bacteria | 89961 |
| 238 | Ga0209233_1000582 | 3300025261 | Bacteria | 19324 |
| 239 | Ga0209130_1000058 | 3300025284 | Bacteria | 210250 |
| 240 | Ga0209675_1001866 | 3300025291 | Bacteria | 11408 |
| 241 | Ga0209025_1003741 | 3300025294 | Bacteria | 13949 |
| 242 | Ga0207426_1000131 | 3300025302 | Bacteria | 210250 |
| 243 | Ga0207656_10015098 | 3300025321 | Bacteria | 2985 |
| 244 | Ga0207692_10087493 | 3300025898 | Bacteria | 1681 |
| 245 | Ga0207642_10092748 | 3300025899 | Bacteria | 1496 |
| 246 | Ga0207699_10725715 | 3300025906 | Unclassified | 728 |
| 247 | Ga0207705_10002731 | 3300025909 | Bacteria | 13525 |
| 248 | Ga0207654_10004303 | 3300025911 | Bacteria | 7177 |
| 249 | Ga0207654_10247540 | 3300025911 | Bacteria | 1193 |
| 250 | Ga0207707_10000891 | 3300025912 | Bacteria | 29182 |
| 251 | Ga0207707_10004428 | 3300025912 | Bacteria | 12377 |
| 252 | Ga0207707_10064886 | 3300025912 | Bacteria | 3179 |
| 253 | Ga0207707_10112028 | 3300025912 | Bacteria | 2385 |
| 254 | Ga0207707_10414851 | 3300025912 | Bacteria | 1155 |
| 255 | Ga0207707_10427755 | 3300025912 | Bacteria | 1134 |
| 256 | Ga0207695_10008941 | 3300025913 | Bacteria | 12469 |
| 257 | Ga0207695_10064306 | 3300025913 | Bacteria | 3778 |
| 258 | Ga0207695_10138480 | 3300025913 | Bacteria | 2385 |
| 259 | Ga0207695_10181150 | 3300025913 | Bacteria | 2027 |
| 260 | Ga0207695_10593387 | 3300025913 | Bacteria | 989 |
| 261 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 262 | Ga0207671_10020313 | 3300025914 | Bacteria | 5059 |
| 263 | Ga0207671_10271874 | 3300025914 | Bacteria | 1335 |
| 264 | Ga0207693_10009175 | 3300025915 | Bacteria | 8077 |
| 265 | Ga0207663_10544253 | 3300025916 | Bacteria | 907 |
| 266 | Ga0207660_10188874 | 3300025917 | Bacteria | 1603 |
| 267 | Ga0207660_10197762 | 3300025917 | Bacteria | 1569 |
| 268 | Ga0207660_11230599 | 3300025917 | Unclassified | 609 |
| 269 | Ga0207662_10046887 | 3300025918 | Bacteria | 2558 |
| 270 | Ga0207657_10034345 | 3300025919 | Bacteria | 4562 |
| 271 | Ga0207652_10001281 | 3300025921 | Bacteria | 22398 |
| 272 | Ga0207652_10407638 | 3300025921 | Bacteria | 1226 |
| 273 | Ga0207652_10433998 | 3300025921 | Bacteria | 1184 |
| 274 | Ga0207652_10529734 | 3300025921 | Bacteria | 1060 |
| 275 | Ga0207646_10196736 | 3300025922 | Bacteria | 1820 |
| 276 | Ga0207694_10000936 | 3300025924 | Bacteria | 25749 |
| 277 | Ga0207694_10164942 | 3300025924 | Bacteria | 1791 |
| 278 | Ga0207694_10204552 | 3300025924 | Bacteria | 1607 |
| 279 | Ga0207694_10955566 | 3300025924 | Unclassified | 725 |
| 280 | Ga0207650_10157907 | 3300025925 | Bacteria | 1795 |
| 281 | Ga0207659_10377960 | 3300025926 | Bacteria | 1181 |
| 282 | Ga0207700_10006223 | 3300025928 | Bacteria | 7198 |
| 283 | Ga0207700_10327702 | 3300025928 | Bacteria | 1328 |
| 284 | Ga0207700_10337237 | 3300025928 | Unclassified | 1310 |
| 285 | Ga0207700_10759029 | 3300025928 | Unclassified | 867 |
| 286 | Ga0207700_10767494 | 3300025928 | Bacteria | 862 |
| 287 | Ga0207700_10853692 | 3300025928 | Bacteria | 815 |
| 288 | Ga0207664_10014836 | 3300025929 | Bacteria | 5641 |
| 289 | Ga0207664_10075701 | 3300025929 | Bacteria | 2722 |
| 290 | Ga0207664_10213953 | 3300025929 | Bacteria | 1669 |
| 291 | Ga0207664_10825590 | 3300025929 | Unclassified | 833 |
| 292 | Ga0207644_10658016 | 3300025931 | Bacteria | 872 |
| 293 | Ga0207704_10032986 | 3300025938 | Bacteria | 2939 |
| 294 | Ga0207704_10084820 | 3300025938 | Bacteria | 2060 |
| 295 | Ga0207711_10033626 | 3300025941 | Bacteria | 4340 |
| 296 | Ga0207711_10356144 | 3300025941 | Bacteria | 1355 |
| 297 | Ga0207661_10215499 | 3300025944 | Bacteria | 1694 |
| 298 | Ga0207661_10220421 | 3300025944 | Bacteria | 1676 |
| 299 | Ga0207661_10267304 | 3300025944 | Bacteria | 1525 |
| 300 | Ga0207679_10010148 | 3300025945 | Bacteria | 6058 |
| 301 | Ga0207679_10245978 | 3300025945 | Bacteria | 1518 |
| 302 | Ga0207679_10508882 | 3300025945 | Bacteria | 1075 |
| 303 | Ga0207667_10000535 | 3300025949 | Bacteria | 50094 |
| 304 | Ga0207667_10000827 | 3300025949 | Bacteria | 39994 |
| 305 | Ga0207667_10014466 | 3300025949 | Bacteria | 8995 |
| 306 | Ga0207667_10033571 | 3300025949 | Bacteria | 5516 |
| 307 | Ga0207667_10158509 | 3300025949 | Bacteria | 2329 |
| 308 | Ga0207667_10243647 | 3300025949 | Bacteria | 1840 |
| 309 | Ga0207667_10259941 | 3300025949 | Bacteria | 1775 |
| 310 | Ga0207667_10338893 | 3300025949 | Bacteria | 1535 |
| 311 | Ga0207667_10879657 | 3300025949 | Bacteria | 889 |
| 312 | Ga0207640_10010790 | 3300025981 | Bacteria | 5155 |
| 313 | Ga0207640_10016685 | 3300025981 | Bacteria | 4279 |
| 314 | Ga0207658_10073691 | 3300025986 | Bacteria | 2592 |
| 315 | Ga0207677_10001123 | 3300026023 | Bacteria | 14586 |
| 316 | Ga0207677_10022394 | 3300026023 | Bacteria | 3883 |
| 317 | Ga0207703_10025002 | 3300026035 | Bacteria | 4697 |
| 318 | Ga0207703_10038124 | 3300026035 | Bacteria | 3833 |
| 319 | Ga0207703_10060165 | 3300026035 | Bacteria | 3105 |
| 320 | Ga0207703_10886193 | 3300026035 | Bacteria | 854 |
| 321 | Ga0207639_10038833 | 3300026041 | Bacteria | 3544 |
| 322 | Ga0207639_10110005 | 3300026041 | Bacteria | 2244 |
| 323 | Ga0207702_10000612 | 3300026078 | Bacteria | 39396 |
| 324 | Ga0207702_10001271 | 3300026078 | Bacteria | 25346 |
| 325 | Ga0207702_10004408 | 3300026078 | Bacteria | 12538 |
| 326 | Ga0207702_10023945 | 3300026078 | Bacteria | 5066 |
| 327 | Ga0207702_10045795 | 3300026078 | Bacteria | 3680 |
| 328 | Ga0207702_10058829 | 3300026078 | Bacteria | 3272 |
| 329 | Ga0207702_10438692 | 3300026078 | Bacteria | 1265 |
| 330 | Ga0207702_10504512 | 3300026078 | Bacteria | 1180 |
| 331 | Ga0207641_10006495 | 3300026088 | Bacteria | 9847 |
| 332 | Ga0207648_10042635 | 3300026089 | Bacteria | 3983 |
| 333 | Ga0207676_10004570 | 3300026095 | Bacteria | 9803 |
| 334 | Ga0207676_10118718 | 3300026095 | Bacteria | 2226 |
| 335 | Ga0207676_11152468 | 3300026095 | Unclassified | 767 |
| 336 | Ga0207674_10001299 | 3300026116 | Bacteria | 32627 |
| 337 | Ga0207674_10020233 | 3300026116 | Bacteria | 7196 |
| 338 | Ga0207674_10815259 | 3300026116 | Bacteria | 900 |
| 339 | Ga0207698_10300575 | 3300026142 | Bacteria | 1494 |
| 340 | Ga0207698_10895976 | 3300026142 | Bacteria | 894 |
| 341 | Ga0209371_1002879 | 3300027312 | Bacteria | 9047 |
| 342 | Ga0207428_10079659 | 3300027907 | Bacteria | 2560 |
| 343 | Ga0268266_10052344 | 3300028379 | Bacteria | 3506 |
| 344 | Ga0268265_10427468 | 3300028380 | Bacteria | 1231 |
| 345 | Ga0268264_10087875 | 3300028381 | Bacteria | 2674 |
| 346 | Ga0268264_10312180 | 3300028381 | Bacteria | 1484 |
| 347 | Ga0265338_10001961 | 3300028800 | Bacteria | 32082 |
| 348 | Ga0268256_1001906 | 3300030500 | Bacteria | 11502 |
| 349 | Ga0265330_10022063 | 3300031235 | Bacteria | 2901 |
| 350 | Ga0265332_10049802 | 3300031238 | Bacteria | 1801 |
| 351 | Ga0265325_10263359 | 3300031241 | Unclassified | 777 |
| 352 | Ga0265340_10028184 | 3300031247 | Bacteria | 2827 |
| 353 | Ga0265331_10015374 | 3300031250 | Bacteria | 4042 |
| 354 | Ga0307408_100038650 | 3300031548 | Bacteria | 3368 |
| 355 | Ga0265313_10132616 | 3300031595 | Bacteria | 1078 |
| 356 | Ga0316575_10013800 | 3300031665 | Bacteria | 3022 |
| 357 | Ga0265314_10010556 | 3300031711 | Bacteria | 7691 |
| 358 | Ga0316576_10168943 | 3300031727 | Bacteria | 1650 |
| 359 | Ga0316578_10026595 | 3300031728 | Bacteria | 3264 |
| 360 | Ga0307410_11019592 | 3300031852 | Bacteria | 714 |
| 361 | Ga0307406_10069770 | 3300031901 | Bacteria | 2299 |
| 362 | Ga0307412_10181649 | 3300031911 | Bacteria | 1583 |
| 363 | Ga0307409_100048464 | 3300031995 | Bacteria | 3233 |
| 364 | Ga0307409_100710425 | 3300031995 | Bacteria | 1005 |
| 365 | Ga0307415_100053362 | 3300032126 | Bacteria | 2754 |
| 366 | Ga0316583_10000699 | 3300032133 | Bacteria | 10359 |
| 367 | Ga0316583_10056980 | 3300032133 | Bacteria | 1373 |
| 368 | Ga0373929_0029415 | 3300035085 | Unclassified | 1166 |
| 369 | Ga0373954_0039189 | 3300035118 | Bacteria | 2206 |
| 370 | Ga0316574_0021299 | 3300035398 | Bacteria | 3848 |
| 371 | Ga0316574_0058616 | 3300035398 | Bacteria | 2412 |
| 372 | Ga0316574_0102889 | 3300035398 | Bacteria | 1828 |
| 373 | Ga0373927_0113961 | 3300035695 | Bacteria | 1762 |
| 374 | Ga0373933_0092442 | 3300035724 | Bacteria | 1868 |
| 375 | Ga0373933_0143078 | 3300035724 | Unclassified | 1511 |
| 376 | Ga0373937_0020699 | 3300036401 | Bacteria | 5900 |
| 377 | Ga0373937_0567725 | 3300036401 | Bacteria | 1078 |
| 378 | Ga0316582_0017146 | 3300036647 | Bacteria | 4182 |
| 379 | Ga0316582_0154309 | 3300036647 | Bacteria | 1553 |
| 380 | Ga0316582_0244901 | 3300036647 | Bacteria | 1228 |
| 381 | Ga0316582_0808205 | 3300036647 | Unclassified | 642 |
| 382 | Ga0316584_0176138 | 3300036712 | Bacteria | 1584 |
| 383 | Ga0395898_0396652 | 3300037466 | Bacteria | 1316 |
| 384 | Ga0395905_0803931 | 3300037471 | Bacteria | 843 |
| 385 | Ga0400490_09529 | 3300038726 | Bacteria | 2291 |
| 386 | Ga0400488_27669 | 3300038741 | Bacteria | 1199 |
| 387 | Ga0436361_0434733 | 3300039447 | Bacteria | 12240 |
| 388 | Ga0451800_0247031 | 3300041459 | Bacteria | 1176 |
| 389 | Ga0451837_1386528 | 3300041494 | Bacteria | 1412 |
| 390 | Ga0450888_005046 | 3300042126 | Bacteria | 1397 |
| 391 | Ga0450893_0059963 | 3300042532 | Bacteria | 725 |
| 392 | Ga0451577_0073039 | 3300042876 | Bacteria | 3061 |
| 393 | Ga0466972_0008941 | 3300044658 | Bacteria | 5024 |
| 394 | Ga0453683_0151561 | 3300044673 | Bacteria | 1465 |
| 395 | Ga0466965_0145020 | 3300044683 | Bacteria | 1238 |
| 396 | Ga0466966_0433732 | 3300044684 | Bacteria | 790 |
| 397 | Ga0466961_0361612 | 3300044693 | Bacteria | 883 |
| 398 | Ga0466963_0010310 | 3300044694 | Bacteria | 5655 |
| 399 | Ga0466963_0245237 | 3300044694 | Bacteria | 1257 |
| 400 | Ga0466964_0358889 | 3300044706 | Bacteria | 751 |
| 401 | Ga0453684_0000035 | 3300044712 | Bacteria | 725956 |
| 402 | Ga0453684_0306335 | 3300044712 | Bacteria | 1804 |
| 403 | Ga0466968_0000953 | 3300044735 | Bacteria | 10180 |
| 404 | Ga0466968_0017516 | 3300044735 | Bacteria | 2865 |
| 405 | Ga0466957_0583555 | 3300044842 | Bacteria | 781 |
| 406 | Ga0466959_0151284 | 3300045049 | Bacteria | 1636 |
| 407 | Ga0451576_0018547 | 3300045051 | Bacteria | 7623 |
| 408 | Ga0451576_0056135 | 3300045051 | Bacteria | 4119 |
| 409 | Ga0466967_0272689 | 3300045976 | Bacteria | 1621 |
| 410 | Ga0466967_0333466 | 3300045976 | Bacteria | 1465 |
| 411 | Ga0466967_0591471 | 3300045976 | Bacteria | 1095 |
| 412 | Ga0466967_1704594 | 3300045976 | Unclassified | 628 |
| 413 | Ga0495617_016505 | 3300046452 | Bacteria | 2497 |
| 414 | Ga0495627_035332 | 3300046453 | Bacteria | 1558 |
| 415 | Ga0495591_006237 | 3300046458 | Bacteria | 5315 |
| 416 | Ga0495638_0001060 | 3300046460 | Bacteria | 26926 |
| 417 | Ga0495650_0000422 | 3300046471 | Bacteria | 68974 |
| 418 | Ga0495650_0018892 | 3300046471 | Bacteria | 3412 |
| 419 | Ga0495580_0054844 | 3300046472 | Bacteria | 2810 |
| 420 | Ga0495605_0003418 | 3300046474 | Bacteria | 9453 |
| 421 | Ga0495584_0002408 | 3300046491 | Bacteria | 10627 |
| 422 | Ga0495585_0011306 | 3300046492 | Bacteria | 5285 |
| 423 | Ga0495596_0000558 | 3300046500 | Bacteria | 23286 |
| 424 | Ga0495607_0000415 | 3300046501 | Bacteria | 43319 |
| 425 | Ga0495607_0006935 | 3300046501 | Bacteria | 7898 |
| 426 | Ga0495607_0029490 | 3300046501 | Bacteria | 3375 |
| 427 | Ga0495607_0040004 | 3300046501 | Bacteria | 2794 |
| 428 | Ga0495583_0008060 | 3300046506 | Bacteria | 6497 |
| 429 | Ga0495583_0057862 | 3300046506 | Bacteria | 1742 |
| 430 | Ga0495606_0000083 | 3300046507 | Bacteria | 159263 |
| 431 | Ga0495606_0012181 | 3300046507 | Bacteria | 6930 |
| 432 | Ga0495606_0089542 | 3300046507 | Bacteria | 1895 |
| 433 | Ga0495610_0027147 | 3300046512 | Bacteria | 3048 |
| 434 | Ga0495610_0044615 | 3300046512 | Bacteria | 2200 |
| 435 | Ga0495616_0018498 | 3300046513 | Bacteria | 3823 |
| 436 | Ga0495616_0118019 | 3300046513 | Bacteria | 1227 |
| 437 | Ga0495630_0264338 | 3300046517 | Bacteria | 1314 |
| 438 | Ga0495631_0028633 | 3300046518 | Bacteria | 2540 |
| 439 | Ga0495632_0013739 | 3300046519 | Bacteria | 4607 |
| 440 | Ga0495632_0016743 | 3300046519 | Bacteria | 4066 |
| 441 | Ga0495632_0053420 | 3300046519 | Bacteria | 1984 |
| 442 | Ga0495637_0000045 | 3300046520 | Bacteria | 108215 |
| 443 | Ga0495637_0004935 | 3300046520 | Bacteria | 6872 |
| 444 | Ga0495643_0005307 | 3300046522 | Bacteria | 8742 |
| 445 | Ga0495643_0010834 | 3300046522 | Bacteria | 5588 |
| 446 | Ga0495643_0015362 | 3300046522 | Bacteria | 4526 |
| 447 | Ga0495644_0000297 | 3300046523 | Bacteria | 23030 |
| 448 | Ga0495648_0001520 | 3300046524 | Bacteria | 22663 |
| 449 | Ga0495648_0002366 | 3300046524 | Bacteria | 17530 |
| 450 | Ga0495648_0034410 | 3300046524 | Bacteria | 3297 |
| 451 | Ga0495663_0000474 | 3300046525 | Bacteria | 14696 |
| 452 | Ga0495654_0008863 | 3300046530 | Bacteria | 5531 |
| 453 | Ga0495654_0074595 | 3300046530 | Bacteria | 1601 |
| 454 | Ga0495665_0241619 | 3300046531 | Bacteria | 931 |
| 455 | Ga0495609_0000703 | 3300046538 | Bacteria | 25775 |
| 456 | Ga0495622_0001407 | 3300046557 | Bacteria | 12184 |
| 457 | Ga0495622_0002387 | 3300046557 | Bacteria | 9135 |
| 458 | Ga0495668_0209797 | 3300046616 | Bacteria | 1066 |
| 459 | Ga0495611_0002172 | 3300046648 | Bacteria | 9148 |
| 460 | Ga0495611_0157307 | 3300046648 | Bacteria | 1061 |
| 461 | Ga0495625_0000061 | 3300046660 | Bacteria | 179140 |
| 462 | Ga0495625_0028667 | 3300046660 | Bacteria | 4173 |
| 463 | Ga0495625_0155537 | 3300046660 | Bacteria | 1534 |
| 464 | Ga0495661_0000060 | 3300046665 | Bacteria | 131162 |
| 465 | Ga0495661_0045156 | 3300046665 | Bacteria | 2696 |
| 466 | Ga0495588_0001359 | 3300046674 | Bacteria | 10441 |
| 467 | Ga0495623_0030255 | 3300046679 | Bacteria | 3483 |
| 468 | Ga0495671_0072896 | 3300046692 | Bacteria | 1685 |
| 469 | Ga0495671_0076061 | 3300046692 | Bacteria | 1646 |
| 470 | Ga0495649_0000899 | 3300046694 | Bacteria | 23619 |
| 471 | Ga0495649_0003785 | 3300046694 | Bacteria | 10034 |
| 472 | Ga0495649_0023331 | 3300046694 | Bacteria | 3458 |
| 473 | Ga0495649_0517056 | 3300046694 | Bacteria | 593 |
| 474 | Ga0495660_0033150 | 3300046810 | Bacteria | 2897 |
| 475 | Ga0495660_0099794 | 3300046810 | Bacteria | 1496 |
| 476 | Ga0495672_0104458 | 3300047320 | Bacteria | 1530 |
| 477 | Ga0495676_0000011 | 3300047321 | Bacteria | 242612 |
| 478 | Ga0495683_0152207 | 3300047323 | Bacteria | 1076 |
| 479 | Ga0495687_001221 | 3300047443 | Bacteria | 24552 |
| 480 | Ga0495687_022857 | 3300047443 | Bacteria | 2995 |
| 481 | Ga0495679_006532 | 3300047446 | Bacteria | 4997 |
| 482 | Ga0495679_060467 | 3300047446 | Bacteria | 1112 |
| 483 | Ga0495673_0212317 | 3300047469 | Bacteria | 719 |
| 484 | Ga0495681_0002843 | 3300047470 | Bacteria | 12223 |
| 485 | Ga0495681_0030801 | 3300047470 | Bacteria | 2726 |
| 486 | Ga0495686_0008777 | 3300047472 | Bacteria | 7366 |
| 487 | Ga0495593_0275407 | 3300047673 | Unclassified | 842 |
| 488 | Ga0495602_0157026 | 3300048088 | Bacteria | 1780 |
| 489 | Ga0495602_0619535 | 3300048088 | Unclassified | 742 |
| 490 | Ga0496100_0012135 | 3300048903 | Bacteria | 4928 |
| 491 | Ga0496101_0023409 | 3300048904 | Bacteria | 4267 |
| 492 | Ga0496102_0012765 | 3300048905 | Bacteria | 7273 |
| 493 | Ga0496103_0003161 | 3300048906 | Bacteria | 10121 |
| 494 | Ga0496106_0267179 | 3300048909 | Bacteria | 1369 |
| 495 | Ga0496110_0004752 | 3300048913 | Bacteria | 10579 |
| 496 | Ga0496111_0478031 | 3300048914 | Bacteria | 918 |
| 497 | Ga0496112_0008815 | 3300048915 | Bacteria | 9054 |
| 498 | Ga0496112_0010903 | 3300048915 | Bacteria | 8275 |
| 499 | Ga0496113_0010278 | 3300048916 | Bacteria | 6184 |
| 500 | Ga0496113_0821393 | 3300048916 | Bacteria | 738 |
| 501 | Ga0496116_0012712 | 3300048919 | Bacteria | 6848 |
| 502 | Ga0496117_0005406 | 3300048920 | Bacteria | 13438 |
| 503 | Ga0496117_0055258 | 3300048920 | Bacteria | 2775 |
| 504 | Ga0496118_0006076 | 3300048921 | Bacteria | 13438 |
| 505 | Ga0496119_0015122 | 3300048922 | Bacteria | 5973 |
| 506 | Ga0496119_0126518 | 3300048922 | Bacteria | 1397 |
| 507 | Ga0496119_0195651 | 3300048922 | Bacteria | 1050 |
| 508 | Ga0496120_0010975 | 3300048923 | Bacteria | 6262 |
| 509 | Ga0496120_0082949 | 3300048923 | Bacteria | 1731 |
| 510 | Ga0496121_0009446 | 3300048924 | Bacteria | 11207 |
| 511 | Ga0496121_0146296 | 3300048924 | Bacteria | 1745 |
| 512 | Ga0496122_0032510 | 3300048925 | Bacteria | 4312 |
| 513 | Ga0496123_0040023 | 3300048926 | Bacteria | 3272 |
| 514 | Ga0496123_0079218 | 3300048926 | Bacteria | 2009 |
| 515 | Ga0496124_0000005 | 3300048927 | Bacteria | 922323 |
| 516 | Ga0496124_0019193 | 3300048927 | Bacteria | 6375 |
| 517 | Ga0496124_0066286 | 3300048927 | Bacteria | 3007 |
| 518 | Ga0496124_0306473 | 3300048927 | Bacteria | 1144 |
| 519 | Ga0496125_0005807 | 3300048928 | Bacteria | 13554 |
| 520 | Ga0496125_0278282 | 3300048928 | Bacteria | 1038 |
| 521 | Ga0496126_0061225 | 3300048929 | Bacteria | 3381 |
| 522 | Ga0496126_0135385 | 3300048929 | Bacteria | 2125 |
| 523 | Ga0495678_000778 | 3300049459 | Bacteria | 28590 |
| 524 | Ga0495678_002192 | 3300049459 | Bacteria | 13690 |
| 525 | Ga0495678_136895 | 3300049459 | Bacteria | 805 |
| 526 | Ga0495682_0000385 | 3300049460 | Bacteria | 31974 |
| 527 | Ga0495682_0005015 | 3300049460 | Bacteria | 5564 |
| 528 | Ga0495682_0150709 | 3300049460 | Bacteria | 829 |
| 529 | Ga0501072_0560468 | 3300049588 | Bacteria | 902 |
| 530 | Ga0501073_0109409 | 3300049589 | Bacteria | 1917 |
| 531 | Ga0501077_0083899 | 3300049593 | Bacteria | 2019 |
| 532 | nmdc:mga03n38_604046_c1 | 3300050490 | Bacteria | 625 |
| 533 | nmdc:mga0k408_72462_c2 | 3300050493 | Bacteria | 964 |
| 534 | Ga0495612_0085981 | 3300053078 | Bacteria | 1326 |
| 535 | Ga0500643_000008 | 3300053087 | Bacteria | 457931 |
| 536 | Ga0500643_000147 | 3300053087 | Bacteria | 71589 |
| 537 | Ga0500641_0060052 | 3300053096 | Bacteria | 1582 |
| 538 | Ga0500608_042088 | 3300053122 | Bacteria | 2192 |
| 539 | Ga0500618_001095 | 3300053125 | Bacteria | 13306 |
| 540 | Ga0500564_011025 | 3300053138 | Bacteria | 3977 |
| 541 | Ga0500568_0001957 | 3300053139 | Bacteria | 12613 |
| 542 | Ga0500568_0015272 | 3300053139 | Bacteria | 3441 |
| 543 | Ga0500573_0012418 | 3300053140 | Bacteria | 4783 |
| 544 | Ga0500574_000021 | 3300053141 | Bacteria | 27781 |
| 545 | Ga0500616_0000070 | 3300053153 | Bacteria | 232610 |
| 546 | Ga0500627_0191702 | 3300053158 | Bacteria | 918 |
| 547 | Ga0500638_000044 | 3300053162 | Bacteria | 29743 |
| 548 | Ga0500636_0001029 | 3300053177 | Bacteria | 14947 |
| 549 | Ga0500636_0021864 | 3300053177 | Bacteria | 3786 |
| 550 | Ga0500636_0042982 | 3300053177 | Bacteria | 2670 |
| 551 | Ga0501084_0042305 | 3300054114 | Bacteria | 3811 |
| 552 | Ga0590071_000668 | 3300059421 | Bacteria | 9714 |
| 553 | 2511181812 | 2510917028 | Bacteria | 6185411 |
| 554 | 2524458707 | 2524023209 | Bacteria | 6679728 |
| 555 | 2585205938 | 2582581294 | Bacteria | 6626667 |
| 556 | 2585279703 | 2582581308 | Bacteria | 7413247 |
| 557 | 2585327539 | 2582581315 | Bacteria | 7318924 |
| 558 | 2585335793 | 2582581316 | Bacteria | 7774528 |
| 559 | 2585537205 | 2585427527 | Bacteria | 7273426 |
| 560 | 2585551159 | 2585427530 | Bacteria | 7383882 |
| 561 | 2585897107 | 2585427608 | Bacteria | 6544331 |
| 562 | 2585909029 | 2585427609 | Bacteria | 6667127 |
| 563 | 2587984443 | 2585428125 | Bacteria | 6662905 |
| 564 | 2601627379 | 2600255283 | Bacteria | 6061572 |
| 565 | 2616306492 | 2615840626 | Bacteria | 7921970 |
| 566 | 2616551403 | 2615840698 | Bacteria | 7319877 |
| 567 | 2616551809 | 2615840698 | Bacteria | 7319877 |
| 568 | 2671117136 | 2667528174 | Bacteria | 6435400 |
| 569 | 2738691881 | 2738541271 | Bacteria | 5657310 |
| 570 | 2738882512 | 2738541307 | Bacteria | 8606193 |
| 571 | 2739263368 | 2738543016 | Bacteria | 5657564 |
| 572 | 2778178019 | 2775507266 | Bacteria | 7392367 |
| 573 | 2819638590 | 2818991453 | Bacteria | 7181617 |
| 574 | 2838034246 | 2838029111 | Bacteria | 6603031 |
| 575 | 2839990296 | 2839989709 | Bacteria | 3773432 |
| 576 | 2842300030 | 2842298080 | Bacteria | 6123127 |
| 577 | 2842358941 | 2842357229 | Bacteria | 6485165 |
| 578 | 2842480992 | 2842475841 | Bacteria | 6603183 |
| 579 | 2842486371 | 2842482326 | Bacteria | 7212537 |
| 580 | 2842507603 | 2842502639 | Bacteria | 6604161 |
| 581 | 2842511456 | 2842509118 | Bacteria | 6850950 |
| 582 | 2919411347 | 2919408235 | Bacteria | 6149349 |
| 583 | 2998344793 | 2998344455 | Bacteria | 4222996 |
| 584 | 8005264627 | 8005258706 | Bacteria | 6184835 |
| 585 | 8005317879 | 8005314921 | Bacteria | 7072929 |
| 586 | 8005487300 | 8005484373 | Bacteria | 6297373 |
| 587 | 8005647227 | 8005645114 | Bacteria | 6950293 |
| 588 | 8057581883 | 8057575449 | Bacteria | 7367519 |
| 589 | Ga0495661_0208468 | |||
| 590 | MBSR1b_contig_3521707 | |||
| 591 | JGI24740J21852_10000280 | |||
| 592 | JGI25155J39150_1000199 | |||
| 593 | JGI25156J39149_1000449 | |||
| 594 | JGI25162J39368_1000275 | |||
| 595 | JGI25154J39366_1000369 | |||
| 596 | JGI25157J39369_1000477 | |||
| 597 | JGI25159J45721_1001650 | |||
| 598 | JGI25165J46597_1000624 | |||
| 599 | JGI25165J46597_1004634 | |||
| 600 | rootL2_10122418 | |||
| 601 | rootL2_10132744 | |||
| 602 | rootL2_10194887 | |||
| 603 | JGI25160J50197_1000109 | |||
| 604 | JGI25161J50226_1000011 | |||
| 605 | Ga0055539_1010720 | |||
| 606 | Ga0055543_1000071 | |||
| 607 | Ga0058860_12097694 | |||
| 608 | Ga0065165_1000135 | |||
| 609 | Ga0065712_10150888 | |||
| 610 | Ga0065715_10208708 | |||
| 611 | Ga0070658_10104644 | |||
| 612 | Ga0070676_10072444 | |||
| 613 | Ga0070683_100103511 | |||
| 614 | Ga0070683_100139643 | |||
| 615 | Ga0070683_100169646 | |||
| 616 | Ga0070683_100259380 | |||
| 617 | Ga0070690_100363023 | |||
| 618 | Ga0070670_100035186 | |||
| 619 | Ga0070680_100032774 | |||
| 620 | Ga0070680_100187596 | |||
| 621 | Ga0070682_100393202 | |||
| 622 | Ga0068868_100001617 | |||
| 623 | Ga0068868_100056641 | |||
| 624 | Ga0068868_100064484 | |||
| 625 | Ga0070660_100357378 | |||
| 626 | Ga0070661_100115874 | |||
| 627 | Ga0070675_100102169 | |||
| 628 | Ga0070675_100472046 | |||
| 629 | Ga0070671_100574714 | |||
| 630 | Ga0070667_100047266 | |||
| 631 | Ga0070709_10174113 | |||
| 632 | Ga0070714_100022363 | |||
| 633 | Ga0070714_100267671 | |||
| 634 | Ga0070714_100277493 | |||
| 635 | Ga0070714_100387846 | |||
| 636 | Ga0070713_100001380 | |||
| 637 | Ga0070713_100081658 | |||
| 638 | Ga0070713_100142969 | |||
| 639 | Ga0070713_100460186 | |||
| 640 | Ga0070713_100731308 | |||
| 641 | Ga0070713_100733705 | |||
| 642 | Ga0070713_101004748 | |||
| 643 | Ga0070710_10250136 | |||
| 644 | Ga0070711_100138112 | |||
| 645 | Ga0070711_100266180 | |||
| 646 | Ga0070711_101002163 | |||
| 647 | Ga0070705_100191847 | |||
| 648 | Ga0070694_100275393 | |||
| 649 | Ga0070663_101371466 | |||
| 650 | Ga0070681_10000034 | |||
| 651 | Ga0070681_10008371 | |||
| 652 | Ga0070681_10074241 | |||
| 653 | Ga0070681_10091625 | |||
| 654 | Ga0070681_10334840 | |||
| 655 | Ga0068867_100003633 | |||
| 656 | Ga0068867_100165320 | |||
| 657 | Ga0070707_100313490 | |||
| 658 | Ga0070679_100000270 | |||
| 659 | Ga0070679_100015329 | |||
| 660 | Ga0070679_100060787 | |||
| 661 | Ga0070679_100615610 | |||
| 662 | Ga0070684_100032961 | |||
| 663 | Ga0070684_100040300 | |||
| 664 | Ga0070684_100303531 | |||
| 665 | Ga0070684_100427903 | |||
| 666 | Ga0068853_100032352 | |||
| 667 | Ga0068853_100105856 | |||
| 668 | Ga0068853_100386849 | |||
| 669 | Ga0070696_100432591 | |||
| 670 | Ga0070693_100084672 | |||
| 671 | Ga0070693_100529536 | |||
| 672 | Ga0070665_100010723 | |||
| 673 | Ga0068855_100000414 | |||
| 674 | Ga0068855_100001570 | |||
| 675 | Ga0068855_100002685 | |||
| 676 | Ga0068855_100013420 | |||
| 677 | Ga0068855_100031858 | |||
| 678 | Ga0068855_100032767 | |||
| 679 | Ga0068855_100062785 | |||
| 680 | Ga0068855_100082865 | |||
| 681 | Ga0068855_100195488 | |||
| 682 | Ga0068855_100406398 | |||
| 683 | Ga0068855_101228270 | |||
| 684 | Ga0070664_100012196 | |||
| 685 | Ga0070664_100080878 | |||
| 686 | Ga0070664_100125614 | |||
| 687 | Ga0070664_100402892 | |||
| 688 | Ga0068857_100001766 | |||
| 689 | Ga0068857_100002576 | |||
| 690 | Ga0068857_100823531 | |||
| 691 | Ga0068854_100019459 | |||
| 692 | Ga0068854_100021020 | |||
| 693 | Ga0068854_100111488 | |||
| 694 | Ga0068856_100000494 | |||
| 695 | Ga0068856_100000541 | |||
| 696 | Ga0068856_100000571 | |||
| 697 | Ga0068856_100006335 | |||
| 698 | Ga0068856_100078287 | |||
| 699 | Ga0068856_100344938 | |||
| 700 | Ga0070702_100170233 | |||
| 701 | Ga0070702_100263103 | |||
| 702 | Ga0068852_100014521 | |||
| 703 | Ga0068852_100036527 | |||
| 704 | Ga0068852_100092954 | |||
| 705 | Ga0068852_100711051 | |||
| 706 | Ga0068852_100983899 | |||
| 707 | Ga0068859_100010624 | |||
| 708 | Ga0068864_100005671 | |||
| 709 | Ga0068864_100142843 | |||
| 710 | Ga0068866_10132539 | |||
| 711 | Ga0068851_10038270 | |||
| 712 | Ga0068851_10118004 | |||
| 713 | Ga0068863_100008914 | |||
| 714 | Ga0068858_100001544 | |||
| 715 | Ga0068858_100045946 | |||
| 716 | Ga0068858_100059316 | |||
| 717 | Ga0068860_100022636 | |||
| 718 | Ga0068860_100187394 | |||
| 719 | Ga0068860_100205836 | |||
| 720 | Ga0068862_100089901 | |||
| 721 | Ga0070717_10008734 | |||
| 722 | Ga0070717_10030352 | |||
| 723 | Ga0070717_10166232 | |||
| 724 | Ga0070717_11248483 | |||
| 725 | Ga0075432_10003368 | |||
| 726 | Ga0070716_100140030 | |||
| 727 | Ga0070712_100007726 | |||
| 728 | Ga0075366_10024188 | |||
| 729 | Ga0097621_100000014 | |||
| 730 | Ga0097621_100000229 | |||
| 731 | Ga0097621_100024710 | |||
| 732 | Ga0097621_100118061 | |||
| 733 | Ga0068871_100000071 | |||
| 734 | Ga0068871_100001973 | |||
| 735 | Ga0068871_100015157 | |||
| 736 | Ga0068871_100854283 | |||
| 737 | Ga0068871_101206033 | |||
| 738 | Ga0075428_100038053 | |||
| 739 | Ga0075434_101349996 | |||
| 740 | Ga0068865_100035373 | |||
| 741 | Ga0068865_100112346 | |||
| 742 | Ga0097620_100010623 | |||
| 743 | Ga0105240_10000314 | |||
| 744 | Ga0105240_10007208 | |||
| 745 | Ga0105240_10020425 | |||
| 746 | Ga0105240_10108702 | |||
| 747 | Ga0105240_10127027 | |||
| 748 | Ga0105240_10229568 | |||
| 749 | Ga0105240_10255301 | |||
| 750 | Ga0105240_10694957 | |||
| 751 | Ga0105245_10416679 | |||
| 752 | Ga0105247_10276618 | |||
| 753 | Ga0105243_10000677 | |||
| 754 | Ga0105241_10039542 | |||
| 755 | Ga0105241_10084449 | |||
| 756 | Ga0105241_10243638 | |||
| 757 | Ga0105242_10160156 | |||
| 758 | Ga0105248_10047329 | |||
| 759 | Ga0105248_10441343 | |||
| 760 | Ga0105237_10024440 | |||
| 761 | Ga0105237_10081608 | |||
| 762 | Ga0105237_10112015 | |||
| 763 | Ga0105237_10280289 | |||
| 764 | Ga0105237_10530278 | |||
| 765 | Ga0105238_10000099 | |||
| 766 | Ga0105238_10050797 | |||
| 767 | Ga0105238_10115524 | |||
| 768 | Ga0105238_10168855 | |||
| 769 | Ga0105249_10302237 | |||
| 770 | Ga0105239_10050797 | |||
| 771 | Ga0105239_10222194 | |||
| 772 | Ga0105239_10436583 | |||
| 773 | Ga0105246_10104781 | |||
| 774 | Ga0157373_10005586 | |||
| 775 | Ga0157373_10334048 | |||
| 776 | Ga0157371_10003695 | |||
| 777 | Ga0157371_10071956 | |||
| 778 | Ga0157371_10098349 | |||
| 779 | Ga0157371_10196375 | |||
| 780 | Ga0157370_10000938 | |||
| 781 | Ga0157370_10004401 | |||
| 782 | Ga0157370_10106492 | |||
| 783 | Ga0157370_10154190 | |||
| 784 | Ga0157370_10433628 | |||
| 785 | Ga0157369_10000042 | |||
| 786 | Ga0157369_10022583 | |||
| 787 | Ga0157369_10052608 | |||
| 788 | Ga0157369_10058915 | |||
| 789 | Ga0157369_10200076 | |||
| 790 | Ga0157369_10220182 | |||
| 791 | Ga0157369_10273724 | |||
| 792 | Ga0157369_10404660 | |||
| 793 | Ga0157374_10001647 | |||
| 794 | Ga0157374_10002559 | |||
| 795 | Ga0157374_10076293 | |||
| 796 | Ga0157378_10000733 | |||
| 797 | Ga0157378_10003197 | |||
| 798 | Ga0157378_10005107 | |||
| 799 | Ga0157378_11199864 | |||
| 800 | Ga0163162_10212663 | |||
| 801 | Ga0157372_10000287 | |||
| 802 | Ga0157372_10002160 | |||
| 803 | Ga0157372_10003621 | |||
| 804 | Ga0157372_10292773 | |||
| 805 | Ga0157372_10297793 | |||
| 806 | Ga0157372_10309558 | |||
| 807 | Ga0157372_10555202 | |||
| 808 | Ga0157372_10613763 | |||
| 809 | Ga0157375_10433592 | |||
| 810 | Ga0157375_10683004 | |||
| 811 | Ga0182008_10004198 | |||
| 812 | Ga0157376_10009682 | |||
| 813 | Ga0157376_10063366 | |||
| 814 | Ga0182007_10029950 | |||
| 815 | Ga0213872_10004354 | |||
| 816 | Ga0209435_100133 | |||
| 817 | Ga0209437_100239 | |||
| 818 | Ga0209437_104877 | |||
| 819 | Ga0209646_1000404 | |||
| 820 | Ga0209026_1000558 | |||
| 821 | Ga0209677_101140 | |||
| 822 | Ga0209148_1014143 | |||
| 823 | Ga0209759_1000800 | |||
| 824 | Ga0209759_1013700 | |||
| 825 | Ga0209233_1000245 | |||
| 826 | Ga0209233_1000582 | |||
| 827 | Ga0209130_1000058 | |||
| 828 | Ga0209675_1001866 | |||
| 829 | Ga0209025_1003741 | |||
| 830 | Ga0207426_1000131 | |||
| 831 | Ga0207656_10015098 | |||
| 832 | Ga0207692_10087493 | |||
| 833 | Ga0207642_10092748 | |||
| 834 | Ga0207699_10725715 | |||
| 835 | Ga0207705_10002731 | |||
| 836 | Ga0207654_10004303 | |||
| 837 | Ga0207654_10247540 | |||
| 838 | Ga0207707_10000891 | |||
| 839 | Ga0207707_10004428 | |||
| 840 | Ga0207707_10064886 | |||
| 841 | Ga0207707_10112028 | |||
| 842 | Ga0207707_10414851 | |||
| 843 | Ga0207707_10427755 | |||
| 844 | Ga0207695_10008941 | |||
| 845 | Ga0207695_10064306 | |||
| 846 | Ga0207695_10138480 | |||
| 847 | Ga0207695_10181150 | |||
| 848 | Ga0207695_10593387 | |||
| 849 | Ga0207671_10000043 | |||
| 850 | Ga0207671_10020313 | |||
| 851 | Ga0207671_10271874 | |||
| 852 | Ga0207693_10009175 | |||
| 853 | Ga0207663_10544253 | |||
| 854 | Ga0207660_10188874 | |||
| 855 | Ga0207660_10197762 | |||
| 856 | Ga0207660_11230599 | |||
| 857 | Ga0207662_10046887 | |||
| 858 | Ga0207657_10034345 | |||
| 859 | Ga0207652_10001281 | |||
| 860 | Ga0207652_10407638 | |||
| 861 | Ga0207652_10433998 | |||
| 862 | Ga0207652_10529734 | |||
| 863 | Ga0207646_10196736 | |||
| 864 | Ga0207694_10000936 | |||
| 865 | Ga0207694_10164942 | |||
| 866 | Ga0207694_10204552 | |||
| 867 | Ga0207694_10955566 | |||
| 868 | Ga0207650_10157907 | |||
| 869 | Ga0207659_10377960 | |||
| 870 | Ga0207700_10006223 | |||
| 871 | Ga0207700_10327702 | |||
| 872 | Ga0207700_10337237 | |||
| 873 | Ga0207700_10759029 | |||
| 874 | Ga0207700_10767494 | |||
| 875 | Ga0207700_10853692 | |||
| 876 | Ga0207664_10014836 | |||
| 877 | Ga0207664_10075701 | |||
| 878 | Ga0207664_10213953 | |||
| 879 | Ga0207664_10825590 | |||
| 880 | Ga0207644_10658016 | |||
| 881 | Ga0207704_10032986 | |||
| 882 | Ga0207704_10084820 | |||
| 883 | Ga0207711_10033626 | |||
| 884 | Ga0207711_10356144 | |||
| 885 | Ga0207661_10215499 | |||
| 886 | Ga0207661_10220421 | |||
| 887 | Ga0207661_10267304 | |||
| 888 | Ga0207679_10010148 | |||
| 889 | Ga0207679_10245978 | |||
| 890 | Ga0207679_10508882 | |||
| 891 | Ga0207667_10000535 | |||
| 892 | Ga0207667_10000827 | |||
| 893 | Ga0207667_10014466 | |||
| 894 | Ga0207667_10033571 | |||
| 895 | Ga0207667_10158509 | |||
| 896 | Ga0207667_10243647 | |||
| 897 | Ga0207667_10259941 | |||
| 898 | Ga0207667_10338893 | |||
| 899 | Ga0207667_10879657 | |||
| 900 | Ga0207640_10010790 | |||
| 901 | Ga0207640_10016685 | |||
| 902 | Ga0207658_10073691 | |||
| 903 | Ga0207677_10001123 | |||
| 904 | Ga0207677_10022394 | |||
| 905 | Ga0207703_10025002 | |||
| 906 | Ga0207703_10038124 | |||
| 907 | Ga0207703_10060165 | |||
| 908 | Ga0207703_10886193 | |||
| 909 | Ga0207639_10038833 | |||
| 910 | Ga0207639_10110005 | |||
| 911 | Ga0207702_10000612 | |||
| 912 | Ga0207702_10001271 | |||
| 913 | Ga0207702_10004408 | |||
| 914 | Ga0207702_10023945 | |||
| 915 | Ga0207702_10045795 | |||
| 916 | Ga0207702_10058829 | |||
| 917 | Ga0207702_10438692 | |||
| 918 | Ga0207702_10504512 | |||
| 919 | Ga0207641_10006495 | |||
| 920 | Ga0207648_10042635 | |||
| 921 | Ga0207676_10004570 | |||
| 922 | Ga0207676_10118718 | |||
| 923 | Ga0207676_11152468 | |||
| 924 | Ga0207674_10001299 | |||
| 925 | Ga0207674_10020233 | |||
| 926 | Ga0207674_10815259 | |||
| 927 | Ga0207698_10300575 | |||
| 928 | Ga0207698_10895976 | |||
| 929 | Ga0209371_1002879 | |||
| 930 | Ga0207428_10079659 | |||
| 931 | Ga0268266_10052344 | |||
| 932 | Ga0268265_10427468 | |||
| 933 | Ga0268264_10087875 | |||
| 934 | Ga0268264_10312180 | |||
| 935 | Ga0265338_10001961 | |||
| 936 | Ga0268256_1001906 | |||
| 937 | Ga0265330_10022063 | |||
| 938 | Ga0265332_10049802 | |||
| 939 | Ga0265325_10263359 | |||
| 940 | Ga0265340_10028184 | |||
| 941 | Ga0265331_10015374 | |||
| 942 | Ga0307408_100038650 | |||
| 943 | Ga0265313_10132616 | |||
| 944 | Ga0316575_10013800 | |||
| 945 | Ga0265314_10010556 | |||
| 946 | Ga0316576_10168943 | |||
| 947 | Ga0316578_10026595 | |||
| 948 | Ga0307410_11019592 | |||
| 949 | Ga0307406_10069770 | |||
| 950 | Ga0307412_10181649 | |||
| 951 | Ga0307409_100048464 | |||
| 952 | Ga0307409_100710425 | |||
| 953 | Ga0307415_100053362 | |||
| 954 | Ga0316583_10000699 | |||
| 955 | Ga0316583_10056980 | |||
| 956 | Ga0373929_0029415 | |||
| 957 | Ga0373954_0039189 | |||
| 958 | Ga0316574_0021299 | |||
| 959 | Ga0316574_0058616 | |||
| 960 | Ga0316574_0102889 | |||
| 961 | Ga0373927_0113961 | |||
| 962 | Ga0373933_0092442 | |||
| 963 | Ga0373933_0143078 | |||
| 964 | Ga0373937_0020699 | |||
| 965 | Ga0373937_0567725 | |||
| 966 | Ga0316582_0017146 | |||
| 967 | Ga0316582_0154309 | |||
| 968 | Ga0316582_0244901 | |||
| 969 | Ga0316582_0808205 | |||
| 970 | Ga0316584_0176138 | |||
| 971 | Ga0395898_0396652 | |||
| 972 | Ga0395905_0803931 | |||
| 973 | Ga0400490_09529 | |||
| 974 | Ga0400488_27669 | |||
| 975 | Ga0436361_0434733 | |||
| 976 | Ga0451800_0247031 | |||
| 977 | Ga0451837_1386528 | |||
| 978 | Ga0450888_005046 | |||
| 979 | Ga0450893_0059963 | |||
| 980 | Ga0451577_0073039 | |||
| 981 | Ga0466972_0008941 | |||
| 982 | Ga0453683_0151561 | |||
| 983 | Ga0466965_0145020 | |||
| 984 | Ga0466966_0433732 | |||
| 985 | Ga0466961_0361612 | |||
| 986 | Ga0466963_0010310 | |||
| 987 | Ga0466963_0245237 | |||
| 988 | Ga0466964_0358889 | |||
| 989 | Ga0453684_0000035 | |||
| 990 | Ga0453684_0306335 | |||
| 991 | Ga0466968_0000953 | |||
| 992 | Ga0466968_0017516 | |||
| 993 | Ga0466957_0583555 | |||
| 994 | Ga0466959_0151284 | |||
| 995 | Ga0451576_0018547 | |||
| 996 | Ga0451576_0056135 | |||
| 997 | Ga0466967_0272689 | |||
| 998 | Ga0466967_0333466 | |||
| 999 | Ga0466967_0591471 | |||
| 1000 | Ga0466967_1704594 | |||
| 1001 | Ga0495617_016505 | |||
| 1002 | Ga0495627_035332 | |||
| 1003 | Ga0495591_006237 | |||
| 1004 | Ga0495638_0001060 | |||
| 1005 | Ga0495650_0000422 | |||
| 1006 | Ga0495650_0018892 | |||
| 1007 | Ga0495580_0054844 | |||
| 1008 | Ga0495605_0003418 | |||
| 1009 | Ga0495584_0002408 | |||
| 1010 | Ga0495585_0011306 | |||
| 1011 | Ga0495596_0000558 | |||
| 1012 | Ga0495607_0000415 | |||
| 1013 | Ga0495607_0006935 | |||
| 1014 | Ga0495607_0029490 | |||
| 1015 | Ga0495607_0040004 | |||
| 1016 | Ga0495583_0008060 | |||
| 1017 | Ga0495583_0057862 | |||
| 1018 | Ga0495606_0000083 | |||
| 1019 | Ga0495606_0012181 | |||
| 1020 | Ga0495606_0089542 | |||
| 1021 | Ga0495610_0027147 | |||
| 1022 | Ga0495610_0044615 | |||
| 1023 | Ga0495616_0018498 | |||
| 1024 | Ga0495616_0118019 | |||
| 1025 | Ga0495630_0264338 | |||
| 1026 | Ga0495631_0028633 | |||
| 1027 | Ga0495632_0013739 | |||
| 1028 | Ga0495632_0016743 | |||
| 1029 | Ga0495632_0053420 | |||
| 1030 | Ga0495637_0000045 | |||
| 1031 | Ga0495637_0004935 | |||
| 1032 | Ga0495643_0005307 | |||
| 1033 | Ga0495643_0010834 | |||
| 1034 | Ga0495643_0015362 | |||
| 1035 | Ga0495644_0000297 | |||
| 1036 | Ga0495648_0001520 | |||
| 1037 | Ga0495648_0002366 | |||
| 1038 | Ga0495648_0034410 | |||
| 1039 | Ga0495663_0000474 | |||
| 1040 | Ga0495654_0008863 | |||
| 1041 | Ga0495654_0074595 | |||
| 1042 | Ga0495665_0241619 | |||
| 1043 | Ga0495609_0000703 | |||
| 1044 | Ga0495622_0001407 | |||
| 1045 | Ga0495622_0002387 | |||
| 1046 | Ga0495668_0209797 | |||
| 1047 | Ga0495611_0002172 | |||
| 1048 | Ga0495611_0157307 | |||
| 1049 | Ga0495625_0000061 | |||
| 1050 | Ga0495625_0028667 | |||
| 1051 | Ga0495625_0155537 | |||
| 1052 | Ga0495661_0000060 | |||
| 1053 | Ga0495661_0045156 | |||
| 1054 | Ga0495588_0001359 | |||
| 1055 | Ga0495623_0030255 | |||
| 1056 | Ga0495671_0072896 | |||
| 1057 | Ga0495671_0076061 | |||
| 1058 | Ga0495649_0000899 | |||
| 1059 | Ga0495649_0003785 | |||
| 1060 | Ga0495649_0023331 | |||
| 1061 | Ga0495649_0517056 | |||
| 1062 | Ga0495660_0033150 | |||
| 1063 | Ga0495660_0099794 | |||
| 1064 | Ga0495672_0104458 | |||
| 1065 | Ga0495676_0000011 | |||
| 1066 | Ga0495683_0152207 | |||
| 1067 | Ga0495687_001221 | |||
| 1068 | Ga0495687_022857 | |||
| 1069 | Ga0495679_006532 | |||
| 1070 | Ga0495679_060467 | |||
| 1071 | Ga0495673_0212317 | |||
| 1072 | Ga0495681_0002843 | |||
| 1073 | Ga0495681_0030801 | |||
| 1074 | Ga0495686_0008777 | |||
| 1075 | Ga0495593_0275407 | |||
| 1076 | Ga0495602_0157026 | |||
| 1077 | Ga0495602_0619535 | |||
| 1078 | Ga0496100_0012135 | |||
| 1079 | Ga0496101_0023409 | |||
| 1080 | Ga0496102_0012765 | |||
| 1081 | Ga0496103_0003161 | |||
| 1082 | Ga0496106_0267179 | |||
| 1083 | Ga0496110_0004752 | |||
| 1084 | Ga0496111_0478031 | |||
| 1085 | Ga0496112_0008815 | |||
| 1086 | Ga0496112_0010903 | |||
| 1087 | Ga0496113_0010278 | |||
| 1088 | Ga0496113_0821393 | |||
| 1089 | Ga0496116_0012712 | |||
| 1090 | Ga0496117_0005406 | |||
| 1091 | Ga0496117_0055258 | |||
| 1092 | Ga0496118_0006076 | |||
| 1093 | Ga0496119_0015122 | |||
| 1094 | Ga0496119_0126518 | |||
| 1095 | Ga0496119_0195651 | |||
| 1096 | Ga0496120_0010975 | |||
| 1097 | Ga0496120_0082949 | |||
| 1098 | Ga0496121_0009446 | |||
| 1099 | Ga0496121_0146296 | |||
| 1100 | Ga0496122_0032510 | |||
| 1101 | Ga0496123_0040023 | |||
| 1102 | Ga0496123_0079218 | |||
| 1103 | Ga0496124_0000005 | |||
| 1104 | Ga0496124_0019193 | |||
| 1105 | Ga0496124_0066286 | |||
| 1106 | Ga0496124_0306473 | |||
| 1107 | Ga0496125_0005807 | |||
| 1108 | Ga0496125_0278282 | |||
| 1109 | Ga0496126_0061225 | |||
| 1110 | Ga0496126_0135385 | |||
| 1111 | Ga0495678_000778 | |||
| 1112 | Ga0495678_002192 | |||
| 1113 | Ga0495678_136895 | |||
| 1114 | Ga0495682_0000385 | |||
| 1115 | Ga0495682_0005015 | |||
| 1116 | Ga0495682_0150709 | |||
| 1117 | Ga0501072_0560468 | |||
| 1118 | Ga0501073_0109409 | |||
| 1119 | Ga0501077_0083899 | |||
| 1120 | nmdc:mga03n38_604046_c1 | |||
| 1121 | nmdc:mga0k408_72462_c2 | |||
| 1122 | Ga0495612_0085981 | |||
| 1123 | Ga0500643_000008 | |||
| 1124 | Ga0500643_000147 | |||
| 1125 | Ga0500641_0060052 | |||
| 1126 | Ga0500608_042088 | |||
| 1127 | Ga0500618_001095 | |||
| 1128 | Ga0500564_011025 | |||
| 1129 | Ga0500568_0001957 | |||
| 1130 | Ga0500568_0015272 | |||
| 1131 | Ga0500573_0012418 | |||
| 1132 | Ga0500574_000021 | |||
| 1133 | Ga0500616_0000070 | |||
| 1134 | Ga0500627_0191702 | |||
| 1135 | Ga0500638_000044 | |||
| 1136 | Ga0500636_0001029 | |||
| 1137 | Ga0500636_0021864 | |||
| 1138 | Ga0500636_0042982 | |||
| 1139 | Ga0501084_0042305 | |||
| 1140 | Ga0590071_000668 | |||
| 1141 | 2511181812 | |||
| 1142 | 2524458707 | |||
| 1143 | 2585205938 | |||
| 1144 | 2585279703 | |||
| 1145 | 2585327539 | |||
| 1146 | 2585335793 | |||
| 1147 | 2585537205 | |||
| 1148 | 2585551159 | |||
| 1149 | 2585897107 | |||
| 1150 | 2585909029 | |||
| 1151 | 2587984443 | |||
| 1152 | 2601627379 | |||
| 1153 | 2616306492 | |||
| 1154 | 2616551403 | |||
| 1155 | 2616551809 | |||
| 1156 | 2671117136 | |||
| 1157 | 2738691881 | |||
| 1158 | 2738882512 | |||
| 1159 | 2739263368 | |||
| 1160 | 2778178019 | |||
| 1161 | 2819638590 | |||
| 1162 | 2838034246 | |||
| 1163 | 2839990296 | |||
| 1164 | 2842300030 | |||
| 1165 | 2842358941 | |||
| 1166 | 2842480992 | |||
| 1167 | 2842486371 | |||
| 1168 | 2842507603 | |||
| 1169 | 2842511456 | |||
| 1170 | 2919411347 | |||
| 1171 | 2998344793 | |||
| 1172 | 8005264627 | |||
| 1173 | 8005317879 | |||
| 1174 | 8005487300 | |||
| 1175 | 8005647227 | |||
| 1176 | 8057581883 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9751 | 2 | 171 |
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9743 | 2 | 175 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9725 | 1 | 179 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9698 | 2 | 176 |
| 6ndr-assembly1.cif.gz_B | crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose | 0.9686 | 2 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9645 | 2 | 178 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.963 | 12 | 179 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9547 | 1 | 174 | 2.60.120.10 |
| af_Q17993_17_190_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9512 | 7 | 175 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9504 | 2 | 171 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S5E6V5-F1-model_v4 | deleted | 0.9922 | 1 | 173 |
|
| AF-A0A7V8VTN2-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9911 | 1 | 163 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A1F3TT77-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9902 | 1 | 179 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A5Q2V2X4-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9892 | 1 | 174 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7V8PM70-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9891 | 1 | 176 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |