F466805

General Info

Members Datasets Scaffolds Average Seq Length
588 327 1176 181

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0208468|Ga0495661_0208468_343_942
Length 199
Sequence LRGAGLSNAGSVKQERHMKAIDTAIPDVKIIEPAVFADDRGFFLESFNQAKFEAAIGRSAAFVQDNHSRSGKGVLRGLHYQLPPHAQAKLVRVVVGEVYDVAVDIRRSSPTFGQWVGVLLSEENKRQLWIPEGFAHGFLTLSDRVEFLYKTTNYYAPTSDRGIRWDDPKIAIDWKTVGALTLSAKDERQPLLADAELFD

Samples

Sample ID Description Type Environment
1 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
175 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
186 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
189 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
190 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
281 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
282 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
283 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
284 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
289 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
294 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
295 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
296 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
297 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
298 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
299 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
300 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
301 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
302 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
303 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
304 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
305 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
306 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
307 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
308 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
309 2738541307 Variovorax sp. GV008 Isolate Unclassified
310 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
311 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
312 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
313 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
314 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
315 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
316 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
317 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
318 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
319 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
320 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
321 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
322 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
323 8005258706 Rhizobium sp. R693 Isolate Nodule
324 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
325 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
326 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
327 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.71
Metatranscriptomes 0.17
Isolates 6.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 2.55
Rhizoplane 2.38
Rhizosphere 81.12
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495661_0208468 3300046665 Bacteria 1019
2 MBSR1b_contig_3521707 2162886012 Bacteria 952
3 JGI24740J21852_10000280 3300001979 Bacteria 21665
4 JGI25155J39150_1000199 3300002704 Bacteria 25175
5 JGI25156J39149_1000449 3300002705 Bacteria 25175
6 JGI25162J39368_1000275 3300002737 Bacteria 49524
7 JGI25154J39366_1000369 3300002738 Bacteria 25163
8 JGI25157J39369_1000477 3300002741 Bacteria 25175
9 JGI25159J45721_1001650 3300002987 Bacteria 9073
10 JGI25165J46597_1000624 3300003214 Bacteria 29664
11 JGI25165J46597_1004634 3300003214 Bacteria 2882
12 rootL2_10122418 3300003322 Bacteria 2640
13 rootL2_10132744 3300003322 Bacteria 1661
14 rootL2_10194887 3300003322 Bacteria 1313
15 JGI25160J50197_1000109 3300003354 Bacteria 77318
16 JGI25161J50226_1000011 3300003374 Bacteria 210140
17 Ga0055539_1010720 3300003752 Bacteria 1134
18 Ga0055543_1000071 3300004625 Bacteria 91797
19 Ga0058860_12097694 3300004801 Bacteria 3353
20 Ga0065165_1000135 3300005262 Bacteria 127785
21 Ga0065712_10150888 3300005290 Bacteria 1371
22 Ga0065715_10208708 3300005293 Bacteria 1324
23 Ga0070658_10104644 3300005327 Bacteria 2341
24 Ga0070676_10072444 3300005328 Bacteria 2071
25 Ga0070683_100103511 3300005329 Bacteria 2683
26 Ga0070683_100139643 3300005329 Bacteria 2295
27 Ga0070683_100169646 3300005329 Bacteria 2071
28 Ga0070683_100259380 3300005329 Bacteria 1653
29 Ga0070690_100363023 3300005330 Bacteria 1054
30 Ga0070670_100035186 3300005331 Bacteria 4312
31 Ga0070680_100032774 3300005336 Bacteria 4183
32 Ga0070680_100187596 3300005336 Bacteria 1742
33 Ga0070682_100393202 3300005337 Bacteria 1046
34 Ga0068868_100001617 3300005338 Bacteria 15375
35 Ga0068868_100056641 3300005338 Bacteria 3096
36 Ga0068868_100064484 3300005338 Bacteria 2908
37 Ga0070660_100357378 3300005339 Bacteria 1203
38 Ga0070661_100115874 3300005344 Bacteria 2004
39 Ga0070675_100102169 3300005354 Bacteria 2415
40 Ga0070675_100472046 3300005354 Bacteria 1127
41 Ga0070671_100574714 3300005355 Bacteria 973
42 Ga0070667_100047266 3300005367 Bacteria 3621
43 Ga0070709_10174113 3300005434 Bacteria 1506
44 Ga0070714_100022363 3300005435 Bacteria 5185
45 Ga0070714_100267671 3300005435 Bacteria 1584
46 Ga0070714_100277493 3300005435 Bacteria 1556
47 Ga0070714_100387846 3300005435 Bacteria 1318
48 Ga0070713_100001380 3300005436 Bacteria 15537
49 Ga0070713_100081658 3300005436 Unclassified 2759
50 Ga0070713_100142969 3300005436 Bacteria 2121
51 Ga0070713_100460186 3300005436 Bacteria 1196
52 Ga0070713_100731308 3300005436 Bacteria 946
53 Ga0070713_100733705 3300005436 Bacteria 944
54 Ga0070713_101004748 3300005436 Unclassified 805
55 Ga0070710_10250136 3300005437 Bacteria 1139
56 Ga0070711_100138112 3300005439 Unclassified 1824
57 Ga0070711_100266180 3300005439 Bacteria 1351
58 Ga0070711_101002163 3300005439 Bacteria 717
59 Ga0070705_100191847 3300005440 Bacteria 1393
60 Ga0070694_100275393 3300005444 Bacteria 1281
61 Ga0070663_101371466 3300005455 Bacteria 625
62 Ga0070681_10000034 3300005458 Bacteria 98600
63 Ga0070681_10008371 3300005458 Bacteria 10132
64 Ga0070681_10074241 3300005458 Bacteria 3362
65 Ga0070681_10091625 3300005458 Bacteria 2990
66 Ga0070681_10334840 3300005458 Bacteria 1423
67 Ga0068867_100003633 3300005459 Bacteria 10854
68 Ga0068867_100165320 3300005459 Bacteria 1748
69 Ga0070707_100313490 3300005468 Bacteria 1524
70 Ga0070679_100000270 3300005530 Bacteria 43437
71 Ga0070679_100015329 3300005530 Bacteria 7364
72 Ga0070679_100060787 3300005530 Bacteria 3765
73 Ga0070679_100615610 3300005530 Bacteria 1029
74 Ga0070684_100032961 3300005535 Bacteria 4420
75 Ga0070684_100040300 3300005535 Bacteria 4021
76 Ga0070684_100303531 3300005535 Bacteria 1465
77 Ga0070684_100427903 3300005535 Bacteria 1222
78 Ga0068853_100032352 3300005539 Bacteria 4430
79 Ga0068853_100105856 3300005539 Bacteria 2492
80 Ga0068853_100386849 3300005539 Bacteria 1307
81 Ga0070696_100432591 3300005546 Bacteria 1035
82 Ga0070693_100084672 3300005547 Bacteria 1898
83 Ga0070693_100529536 3300005547 Unclassified 840
84 Ga0070665_100010723 3300005548 Bacteria 9277
85 Ga0068855_100000414 3300005563 Bacteria 52978
86 Ga0068855_100001570 3300005563 Bacteria 28673
87 Ga0068855_100002685 3300005563 Bacteria 21936
88 Ga0068855_100013420 3300005563 Bacteria 9879
89 Ga0068855_100031858 3300005563 Bacteria 6294
90 Ga0068855_100032767 3300005563 Bacteria 6204
91 Ga0068855_100062785 3300005563 Bacteria 4336
92 Ga0068855_100082865 3300005563 Bacteria 3717
93 Ga0068855_100195488 3300005563 Bacteria 2279
94 Ga0068855_100406398 3300005563 Bacteria 1491
95 Ga0068855_101228270 3300005563 Unclassified 778
96 Ga0070664_100012196 3300005564 Bacteria 6984
97 Ga0070664_100080878 3300005564 Bacteria 2799
98 Ga0070664_100125614 3300005564 Bacteria 2250
99 Ga0070664_100402892 3300005564 Unclassified 1251
100 Ga0068857_100001766 3300005577 Bacteria 17387
101 Ga0068857_100002576 3300005577 Bacteria 14854
102 Ga0068857_100823531 3300005577 Bacteria 887
103 Ga0068854_100019459 3300005578 Bacteria 4576
104 Ga0068854_100021020 3300005578 Bacteria 4424
105 Ga0068854_100111488 3300005578 Bacteria 2064
106 Ga0068856_100000494 3300005614 Bacteria 43641
107 Ga0068856_100000541 3300005614 Bacteria 41709
108 Ga0068856_100000571 3300005614 Bacteria 40367
109 Ga0068856_100006335 3300005614 Bacteria 11608
110 Ga0068856_100078287 3300005614 Bacteria 3278
111 Ga0068856_100344938 3300005614 Bacteria 1508
112 Ga0070702_100170233 3300005615 Bacteria 1416
113 Ga0070702_100263103 3300005615 Bacteria 1175
114 Ga0068852_100014521 3300005616 Bacteria 6068
115 Ga0068852_100036527 3300005616 Bacteria 4112
116 Ga0068852_100092954 3300005616 Bacteria 2702
117 Ga0068852_100711051 3300005616 Bacteria 1015
118 Ga0068852_100983899 3300005616 Unclassified 862
119 Ga0068859_100010624 3300005617 Bacteria 9264
120 Ga0068864_100005671 3300005618 Bacteria 10228
121 Ga0068864_100142843 3300005618 Bacteria 2161
122 Ga0068866_10132539 3300005718 Bacteria 1419
123 Ga0068851_10038270 3300005834 Bacteria 2405
124 Ga0068851_10118004 3300005834 Bacteria 1423
125 Ga0068863_100008914 3300005841 Bacteria 9794
126 Ga0068858_100001544 3300005842 Bacteria 23649
127 Ga0068858_100045946 3300005842 Bacteria 4049
128 Ga0068858_100059316 3300005842 Bacteria 3537
129 Ga0068860_100022636 3300005843 Bacteria 6076
130 Ga0068860_100187394 3300005843 Bacteria 2001
131 Ga0068860_100205836 3300005843 Bacteria 1908
132 Ga0068862_100089901 3300005844 Bacteria 2673
133 Ga0070717_10008734 3300006028 Bacteria 7581
134 Ga0070717_10030352 3300006028 Bacteria 4342
135 Ga0070717_10166232 3300006028 Bacteria 1916
136 Ga0070717_11248483 3300006028 Unclassified 676
137 Ga0075432_10003368 3300006058 Bacteria 5404
138 Ga0070716_100140030 3300006173 Bacteria 1541
139 Ga0070712_100007726 3300006175 Bacteria 6727
140 Ga0075366_10024188 3300006195 Bacteria 3543
141 Ga0097621_100000014 3300006237 Bacteria 100839
142 Ga0097621_100000229 3300006237 Bacteria 37450
143 Ga0097621_100024710 3300006237 Bacteria 4695
144 Ga0097621_100118061 3300006237 Bacteria 2248
145 Ga0068871_100000071 3300006358 Bacteria 57255
146 Ga0068871_100001973 3300006358 Bacteria 13910
147 Ga0068871_100015157 3300006358 Bacteria 5762
148 Ga0068871_100854283 3300006358 Bacteria 841
149 Ga0068871_101206033 3300006358 Unclassified 710
150 Ga0075428_100038053 3300006844 Bacteria 5295
151 Ga0075434_101349996 3300006871 Unclassified 723
152 Ga0068865_100035373 3300006881 Bacteria 3358
153 Ga0068865_100112346 3300006881 Bacteria 2012
154 Ga0097620_100010623 3300006931 Bacteria 9264
155 Ga0105240_10000314 3300009093 Bacteria 93043
156 Ga0105240_10007208 3300009093 Bacteria 16192
157 Ga0105240_10020425 3300009093 Bacteria 8834
158 Ga0105240_10108702 3300009093 Bacteria 3359
159 Ga0105240_10127027 3300009093 Bacteria 3063
160 Ga0105240_10229568 3300009093 Bacteria 2158
161 Ga0105240_10255301 3300009093 Bacteria 2025
162 Ga0105240_10694957 3300009093 Unclassified 1111
163 Ga0105245_10416679 3300009098 Bacteria 1345
164 Ga0105247_10276618 3300009101 Bacteria 1157
165 Ga0105243_10000677 3300009148 Bacteria 33243
166 Ga0105241_10039542 3300009174 Bacteria 3558
167 Ga0105241_10084449 3300009174 Bacteria 2493
168 Ga0105241_10243638 3300009174 Bacteria 1521
169 Ga0105242_10160156 3300009176 Bacteria 1969
170 Ga0105248_10047329 3300009177 Bacteria 4823
171 Ga0105248_10441343 3300009177 Bacteria 1466
172 Ga0105237_10024440 3300009545 Bacteria 6180
173 Ga0105237_10081608 3300009545 Bacteria 3225
174 Ga0105237_10112015 3300009545 Bacteria 2721
175 Ga0105237_10280289 3300009545 Unclassified 1669
176 Ga0105237_10530278 3300009545 Bacteria 1184
177 Ga0105238_10000099 3300009551 Bacteria 97818
178 Ga0105238_10050797 3300009551 Bacteria 4173
179 Ga0105238_10115524 3300009551 Bacteria 2663
180 Ga0105238_10168855 3300009551 Bacteria 2164
181 Ga0105249_10302237 3300009553 Bacteria 1605
182 Ga0105239_10050797 3300010375 Bacteria 4546
183 Ga0105239_10222194 3300010375 Bacteria 2118
184 Ga0105239_10436583 3300010375 Bacteria 1484
185 Ga0105246_10104781 3300011119 Bacteria 2066
186 Ga0157373_10005586 3300013100 Bacteria 9429
187 Ga0157373_10334048 3300013100 Bacteria 1079
188 Ga0157371_10003695 3300013102 Bacteria 13739
189 Ga0157371_10071956 3300013102 Bacteria 2448
190 Ga0157371_10098349 3300013102 Bacteria 2075
191 Ga0157371_10196375 3300013102 Bacteria 1446
192 Ga0157370_10000938 3300013104 Bacteria 37043
193 Ga0157370_10004401 3300013104 Bacteria 16161
194 Ga0157370_10106492 3300013104 Bacteria 2624
195 Ga0157370_10154190 3300013104 Bacteria 2137
196 Ga0157370_10433628 3300013104 Bacteria 1208
197 Ga0157369_10000042 3300013105 Bacteria 181784
198 Ga0157369_10022583 3300013105 Bacteria 7018
199 Ga0157369_10052608 3300013105 Bacteria 4406
200 Ga0157369_10058915 3300013105 Bacteria 4142
201 Ga0157369_10200076 3300013105 Bacteria 2097
202 Ga0157369_10220182 3300013105 Bacteria 1987
203 Ga0157369_10273724 3300013105 Bacteria 1759
204 Ga0157369_10404660 3300013105 Bacteria 1416
205 Ga0157374_10001647 3300013296 Bacteria 18695
206 Ga0157374_10002559 3300013296 Bacteria 15345
207 Ga0157374_10076293 3300013296 Bacteria 3169
208 Ga0157378_10000733 3300013297 Bacteria 30679
209 Ga0157378_10003197 3300013297 Bacteria 14554
210 Ga0157378_10005107 3300013297 Bacteria 11523
211 Ga0157378_11199864 3300013297 Unclassified 798
212 Ga0163162_10212663 3300013306 Bacteria 2064
213 Ga0157372_10000287 3300013307 Bacteria 56080
214 Ga0157372_10002160 3300013307 Bacteria 21394
215 Ga0157372_10003621 3300013307 Bacteria 16626
216 Ga0157372_10292773 3300013307 Bacteria 1893
217 Ga0157372_10297793 3300013307 Unclassified 1876
218 Ga0157372_10309558 3300013307 Bacteria 1838
219 Ga0157372_10555202 3300013307 Bacteria 1339
220 Ga0157372_10613763 3300013307 Bacteria 1268
221 Ga0157375_10433592 3300013308 Bacteria 1480
222 Ga0157375_10683004 3300013308 Bacteria 1181
223 Ga0182008_10004198 3300014497 Bacteria 8472
224 Ga0157376_10009682 3300014969 Bacteria 7012
225 Ga0157376_10063366 3300014969 Bacteria 3114
226 Ga0182007_10029950 3300015262 Bacteria 1862
227 Ga0213872_10004354 3300021361 Bacteria 7541
228 Ga0209435_100133 3300025206 Bacteria 25498
229 Ga0209437_100239 3300025233 Bacteria 89942
230 Ga0209437_104877 3300025233 Bacteria 2328
231 Ga0209646_1000404 3300025246 Bacteria 25498
232 Ga0209026_1000558 3300025250 Bacteria 25498
233 Ga0209677_101140 3300025253 Bacteria 12420
234 Ga0209148_1014143 3300025254 Bacteria 1416
235 Ga0209759_1000800 3300025256 Bacteria 25498
236 Ga0209759_1013700 3300025256 Bacteria 2179
237 Ga0209233_1000245 3300025261 Bacteria 89961
238 Ga0209233_1000582 3300025261 Bacteria 19324
239 Ga0209130_1000058 3300025284 Bacteria 210250
240 Ga0209675_1001866 3300025291 Bacteria 11408
241 Ga0209025_1003741 3300025294 Bacteria 13949
242 Ga0207426_1000131 3300025302 Bacteria 210250
243 Ga0207656_10015098 3300025321 Bacteria 2985
244 Ga0207692_10087493 3300025898 Bacteria 1681
245 Ga0207642_10092748 3300025899 Bacteria 1496
246 Ga0207699_10725715 3300025906 Unclassified 728
247 Ga0207705_10002731 3300025909 Bacteria 13525
248 Ga0207654_10004303 3300025911 Bacteria 7177
249 Ga0207654_10247540 3300025911 Bacteria 1193
250 Ga0207707_10000891 3300025912 Bacteria 29182
251 Ga0207707_10004428 3300025912 Bacteria 12377
252 Ga0207707_10064886 3300025912 Bacteria 3179
253 Ga0207707_10112028 3300025912 Bacteria 2385
254 Ga0207707_10414851 3300025912 Bacteria 1155
255 Ga0207707_10427755 3300025912 Bacteria 1134
256 Ga0207695_10008941 3300025913 Bacteria 12469
257 Ga0207695_10064306 3300025913 Bacteria 3778
258 Ga0207695_10138480 3300025913 Bacteria 2385
259 Ga0207695_10181150 3300025913 Bacteria 2027
260 Ga0207695_10593387 3300025913 Bacteria 989
261 Ga0207671_10000043 3300025914 Bacteria 206915
262 Ga0207671_10020313 3300025914 Bacteria 5059
263 Ga0207671_10271874 3300025914 Bacteria 1335
264 Ga0207693_10009175 3300025915 Bacteria 8077
265 Ga0207663_10544253 3300025916 Bacteria 907
266 Ga0207660_10188874 3300025917 Bacteria 1603
267 Ga0207660_10197762 3300025917 Bacteria 1569
268 Ga0207660_11230599 3300025917 Unclassified 609
269 Ga0207662_10046887 3300025918 Bacteria 2558
270 Ga0207657_10034345 3300025919 Bacteria 4562
271 Ga0207652_10001281 3300025921 Bacteria 22398
272 Ga0207652_10407638 3300025921 Bacteria 1226
273 Ga0207652_10433998 3300025921 Bacteria 1184
274 Ga0207652_10529734 3300025921 Bacteria 1060
275 Ga0207646_10196736 3300025922 Bacteria 1820
276 Ga0207694_10000936 3300025924 Bacteria 25749
277 Ga0207694_10164942 3300025924 Bacteria 1791
278 Ga0207694_10204552 3300025924 Bacteria 1607
279 Ga0207694_10955566 3300025924 Unclassified 725
280 Ga0207650_10157907 3300025925 Bacteria 1795
281 Ga0207659_10377960 3300025926 Bacteria 1181
282 Ga0207700_10006223 3300025928 Bacteria 7198
283 Ga0207700_10327702 3300025928 Bacteria 1328
284 Ga0207700_10337237 3300025928 Unclassified 1310
285 Ga0207700_10759029 3300025928 Unclassified 867
286 Ga0207700_10767494 3300025928 Bacteria 862
287 Ga0207700_10853692 3300025928 Bacteria 815
288 Ga0207664_10014836 3300025929 Bacteria 5641
289 Ga0207664_10075701 3300025929 Bacteria 2722
290 Ga0207664_10213953 3300025929 Bacteria 1669
291 Ga0207664_10825590 3300025929 Unclassified 833
292 Ga0207644_10658016 3300025931 Bacteria 872
293 Ga0207704_10032986 3300025938 Bacteria 2939
294 Ga0207704_10084820 3300025938 Bacteria 2060
295 Ga0207711_10033626 3300025941 Bacteria 4340
296 Ga0207711_10356144 3300025941 Bacteria 1355
297 Ga0207661_10215499 3300025944 Bacteria 1694
298 Ga0207661_10220421 3300025944 Bacteria 1676
299 Ga0207661_10267304 3300025944 Bacteria 1525
300 Ga0207679_10010148 3300025945 Bacteria 6058
301 Ga0207679_10245978 3300025945 Bacteria 1518
302 Ga0207679_10508882 3300025945 Bacteria 1075
303 Ga0207667_10000535 3300025949 Bacteria 50094
304 Ga0207667_10000827 3300025949 Bacteria 39994
305 Ga0207667_10014466 3300025949 Bacteria 8995
306 Ga0207667_10033571 3300025949 Bacteria 5516
307 Ga0207667_10158509 3300025949 Bacteria 2329
308 Ga0207667_10243647 3300025949 Bacteria 1840
309 Ga0207667_10259941 3300025949 Bacteria 1775
310 Ga0207667_10338893 3300025949 Bacteria 1535
311 Ga0207667_10879657 3300025949 Bacteria 889
312 Ga0207640_10010790 3300025981 Bacteria 5155
313 Ga0207640_10016685 3300025981 Bacteria 4279
314 Ga0207658_10073691 3300025986 Bacteria 2592
315 Ga0207677_10001123 3300026023 Bacteria 14586
316 Ga0207677_10022394 3300026023 Bacteria 3883
317 Ga0207703_10025002 3300026035 Bacteria 4697
318 Ga0207703_10038124 3300026035 Bacteria 3833
319 Ga0207703_10060165 3300026035 Bacteria 3105
320 Ga0207703_10886193 3300026035 Bacteria 854
321 Ga0207639_10038833 3300026041 Bacteria 3544
322 Ga0207639_10110005 3300026041 Bacteria 2244
323 Ga0207702_10000612 3300026078 Bacteria 39396
324 Ga0207702_10001271 3300026078 Bacteria 25346
325 Ga0207702_10004408 3300026078 Bacteria 12538
326 Ga0207702_10023945 3300026078 Bacteria 5066
327 Ga0207702_10045795 3300026078 Bacteria 3680
328 Ga0207702_10058829 3300026078 Bacteria 3272
329 Ga0207702_10438692 3300026078 Bacteria 1265
330 Ga0207702_10504512 3300026078 Bacteria 1180
331 Ga0207641_10006495 3300026088 Bacteria 9847
332 Ga0207648_10042635 3300026089 Bacteria 3983
333 Ga0207676_10004570 3300026095 Bacteria 9803
334 Ga0207676_10118718 3300026095 Bacteria 2226
335 Ga0207676_11152468 3300026095 Unclassified 767
336 Ga0207674_10001299 3300026116 Bacteria 32627
337 Ga0207674_10020233 3300026116 Bacteria 7196
338 Ga0207674_10815259 3300026116 Bacteria 900
339 Ga0207698_10300575 3300026142 Bacteria 1494
340 Ga0207698_10895976 3300026142 Bacteria 894
341 Ga0209371_1002879 3300027312 Bacteria 9047
342 Ga0207428_10079659 3300027907 Bacteria 2560
343 Ga0268266_10052344 3300028379 Bacteria 3506
344 Ga0268265_10427468 3300028380 Bacteria 1231
345 Ga0268264_10087875 3300028381 Bacteria 2674
346 Ga0268264_10312180 3300028381 Bacteria 1484
347 Ga0265338_10001961 3300028800 Bacteria 32082
348 Ga0268256_1001906 3300030500 Bacteria 11502
349 Ga0265330_10022063 3300031235 Bacteria 2901
350 Ga0265332_10049802 3300031238 Bacteria 1801
351 Ga0265325_10263359 3300031241 Unclassified 777
352 Ga0265340_10028184 3300031247 Bacteria 2827
353 Ga0265331_10015374 3300031250 Bacteria 4042
354 Ga0307408_100038650 3300031548 Bacteria 3368
355 Ga0265313_10132616 3300031595 Bacteria 1078
356 Ga0316575_10013800 3300031665 Bacteria 3022
357 Ga0265314_10010556 3300031711 Bacteria 7691
358 Ga0316576_10168943 3300031727 Bacteria 1650
359 Ga0316578_10026595 3300031728 Bacteria 3264
360 Ga0307410_11019592 3300031852 Bacteria 714
361 Ga0307406_10069770 3300031901 Bacteria 2299
362 Ga0307412_10181649 3300031911 Bacteria 1583
363 Ga0307409_100048464 3300031995 Bacteria 3233
364 Ga0307409_100710425 3300031995 Bacteria 1005
365 Ga0307415_100053362 3300032126 Bacteria 2754
366 Ga0316583_10000699 3300032133 Bacteria 10359
367 Ga0316583_10056980 3300032133 Bacteria 1373
368 Ga0373929_0029415 3300035085 Unclassified 1166
369 Ga0373954_0039189 3300035118 Bacteria 2206
370 Ga0316574_0021299 3300035398 Bacteria 3848
371 Ga0316574_0058616 3300035398 Bacteria 2412
372 Ga0316574_0102889 3300035398 Bacteria 1828
373 Ga0373927_0113961 3300035695 Bacteria 1762
374 Ga0373933_0092442 3300035724 Bacteria 1868
375 Ga0373933_0143078 3300035724 Unclassified 1511
376 Ga0373937_0020699 3300036401 Bacteria 5900
377 Ga0373937_0567725 3300036401 Bacteria 1078
378 Ga0316582_0017146 3300036647 Bacteria 4182
379 Ga0316582_0154309 3300036647 Bacteria 1553
380 Ga0316582_0244901 3300036647 Bacteria 1228
381 Ga0316582_0808205 3300036647 Unclassified 642
382 Ga0316584_0176138 3300036712 Bacteria 1584
383 Ga0395898_0396652 3300037466 Bacteria 1316
384 Ga0395905_0803931 3300037471 Bacteria 843
385 Ga0400490_09529 3300038726 Bacteria 2291
386 Ga0400488_27669 3300038741 Bacteria 1199
387 Ga0436361_0434733 3300039447 Bacteria 12240
388 Ga0451800_0247031 3300041459 Bacteria 1176
389 Ga0451837_1386528 3300041494 Bacteria 1412
390 Ga0450888_005046 3300042126 Bacteria 1397
391 Ga0450893_0059963 3300042532 Bacteria 725
392 Ga0451577_0073039 3300042876 Bacteria 3061
393 Ga0466972_0008941 3300044658 Bacteria 5024
394 Ga0453683_0151561 3300044673 Bacteria 1465
395 Ga0466965_0145020 3300044683 Bacteria 1238
396 Ga0466966_0433732 3300044684 Bacteria 790
397 Ga0466961_0361612 3300044693 Bacteria 883
398 Ga0466963_0010310 3300044694 Bacteria 5655
399 Ga0466963_0245237 3300044694 Bacteria 1257
400 Ga0466964_0358889 3300044706 Bacteria 751
401 Ga0453684_0000035 3300044712 Bacteria 725956
402 Ga0453684_0306335 3300044712 Bacteria 1804
403 Ga0466968_0000953 3300044735 Bacteria 10180
404 Ga0466968_0017516 3300044735 Bacteria 2865
405 Ga0466957_0583555 3300044842 Bacteria 781
406 Ga0466959_0151284 3300045049 Bacteria 1636
407 Ga0451576_0018547 3300045051 Bacteria 7623
408 Ga0451576_0056135 3300045051 Bacteria 4119
409 Ga0466967_0272689 3300045976 Bacteria 1621
410 Ga0466967_0333466 3300045976 Bacteria 1465
411 Ga0466967_0591471 3300045976 Bacteria 1095
412 Ga0466967_1704594 3300045976 Unclassified 628
413 Ga0495617_016505 3300046452 Bacteria 2497
414 Ga0495627_035332 3300046453 Bacteria 1558
415 Ga0495591_006237 3300046458 Bacteria 5315
416 Ga0495638_0001060 3300046460 Bacteria 26926
417 Ga0495650_0000422 3300046471 Bacteria 68974
418 Ga0495650_0018892 3300046471 Bacteria 3412
419 Ga0495580_0054844 3300046472 Bacteria 2810
420 Ga0495605_0003418 3300046474 Bacteria 9453
421 Ga0495584_0002408 3300046491 Bacteria 10627
422 Ga0495585_0011306 3300046492 Bacteria 5285
423 Ga0495596_0000558 3300046500 Bacteria 23286
424 Ga0495607_0000415 3300046501 Bacteria 43319
425 Ga0495607_0006935 3300046501 Bacteria 7898
426 Ga0495607_0029490 3300046501 Bacteria 3375
427 Ga0495607_0040004 3300046501 Bacteria 2794
428 Ga0495583_0008060 3300046506 Bacteria 6497
429 Ga0495583_0057862 3300046506 Bacteria 1742
430 Ga0495606_0000083 3300046507 Bacteria 159263
431 Ga0495606_0012181 3300046507 Bacteria 6930
432 Ga0495606_0089542 3300046507 Bacteria 1895
433 Ga0495610_0027147 3300046512 Bacteria 3048
434 Ga0495610_0044615 3300046512 Bacteria 2200
435 Ga0495616_0018498 3300046513 Bacteria 3823
436 Ga0495616_0118019 3300046513 Bacteria 1227
437 Ga0495630_0264338 3300046517 Bacteria 1314
438 Ga0495631_0028633 3300046518 Bacteria 2540
439 Ga0495632_0013739 3300046519 Bacteria 4607
440 Ga0495632_0016743 3300046519 Bacteria 4066
441 Ga0495632_0053420 3300046519 Bacteria 1984
442 Ga0495637_0000045 3300046520 Bacteria 108215
443 Ga0495637_0004935 3300046520 Bacteria 6872
444 Ga0495643_0005307 3300046522 Bacteria 8742
445 Ga0495643_0010834 3300046522 Bacteria 5588
446 Ga0495643_0015362 3300046522 Bacteria 4526
447 Ga0495644_0000297 3300046523 Bacteria 23030
448 Ga0495648_0001520 3300046524 Bacteria 22663
449 Ga0495648_0002366 3300046524 Bacteria 17530
450 Ga0495648_0034410 3300046524 Bacteria 3297
451 Ga0495663_0000474 3300046525 Bacteria 14696
452 Ga0495654_0008863 3300046530 Bacteria 5531
453 Ga0495654_0074595 3300046530 Bacteria 1601
454 Ga0495665_0241619 3300046531 Bacteria 931
455 Ga0495609_0000703 3300046538 Bacteria 25775
456 Ga0495622_0001407 3300046557 Bacteria 12184
457 Ga0495622_0002387 3300046557 Bacteria 9135
458 Ga0495668_0209797 3300046616 Bacteria 1066
459 Ga0495611_0002172 3300046648 Bacteria 9148
460 Ga0495611_0157307 3300046648 Bacteria 1061
461 Ga0495625_0000061 3300046660 Bacteria 179140
462 Ga0495625_0028667 3300046660 Bacteria 4173
463 Ga0495625_0155537 3300046660 Bacteria 1534
464 Ga0495661_0000060 3300046665 Bacteria 131162
465 Ga0495661_0045156 3300046665 Bacteria 2696
466 Ga0495588_0001359 3300046674 Bacteria 10441
467 Ga0495623_0030255 3300046679 Bacteria 3483
468 Ga0495671_0072896 3300046692 Bacteria 1685
469 Ga0495671_0076061 3300046692 Bacteria 1646
470 Ga0495649_0000899 3300046694 Bacteria 23619
471 Ga0495649_0003785 3300046694 Bacteria 10034
472 Ga0495649_0023331 3300046694 Bacteria 3458
473 Ga0495649_0517056 3300046694 Bacteria 593
474 Ga0495660_0033150 3300046810 Bacteria 2897
475 Ga0495660_0099794 3300046810 Bacteria 1496
476 Ga0495672_0104458 3300047320 Bacteria 1530
477 Ga0495676_0000011 3300047321 Bacteria 242612
478 Ga0495683_0152207 3300047323 Bacteria 1076
479 Ga0495687_001221 3300047443 Bacteria 24552
480 Ga0495687_022857 3300047443 Bacteria 2995
481 Ga0495679_006532 3300047446 Bacteria 4997
482 Ga0495679_060467 3300047446 Bacteria 1112
483 Ga0495673_0212317 3300047469 Bacteria 719
484 Ga0495681_0002843 3300047470 Bacteria 12223
485 Ga0495681_0030801 3300047470 Bacteria 2726
486 Ga0495686_0008777 3300047472 Bacteria 7366
487 Ga0495593_0275407 3300047673 Unclassified 842
488 Ga0495602_0157026 3300048088 Bacteria 1780
489 Ga0495602_0619535 3300048088 Unclassified 742
490 Ga0496100_0012135 3300048903 Bacteria 4928
491 Ga0496101_0023409 3300048904 Bacteria 4267
492 Ga0496102_0012765 3300048905 Bacteria 7273
493 Ga0496103_0003161 3300048906 Bacteria 10121
494 Ga0496106_0267179 3300048909 Bacteria 1369
495 Ga0496110_0004752 3300048913 Bacteria 10579
496 Ga0496111_0478031 3300048914 Bacteria 918
497 Ga0496112_0008815 3300048915 Bacteria 9054
498 Ga0496112_0010903 3300048915 Bacteria 8275
499 Ga0496113_0010278 3300048916 Bacteria 6184
500 Ga0496113_0821393 3300048916 Bacteria 738
501 Ga0496116_0012712 3300048919 Bacteria 6848
502 Ga0496117_0005406 3300048920 Bacteria 13438
503 Ga0496117_0055258 3300048920 Bacteria 2775
504 Ga0496118_0006076 3300048921 Bacteria 13438
505 Ga0496119_0015122 3300048922 Bacteria 5973
506 Ga0496119_0126518 3300048922 Bacteria 1397
507 Ga0496119_0195651 3300048922 Bacteria 1050
508 Ga0496120_0010975 3300048923 Bacteria 6262
509 Ga0496120_0082949 3300048923 Bacteria 1731
510 Ga0496121_0009446 3300048924 Bacteria 11207
511 Ga0496121_0146296 3300048924 Bacteria 1745
512 Ga0496122_0032510 3300048925 Bacteria 4312
513 Ga0496123_0040023 3300048926 Bacteria 3272
514 Ga0496123_0079218 3300048926 Bacteria 2009
515 Ga0496124_0000005 3300048927 Bacteria 922323
516 Ga0496124_0019193 3300048927 Bacteria 6375
517 Ga0496124_0066286 3300048927 Bacteria 3007
518 Ga0496124_0306473 3300048927 Bacteria 1144
519 Ga0496125_0005807 3300048928 Bacteria 13554
520 Ga0496125_0278282 3300048928 Bacteria 1038
521 Ga0496126_0061225 3300048929 Bacteria 3381
522 Ga0496126_0135385 3300048929 Bacteria 2125
523 Ga0495678_000778 3300049459 Bacteria 28590
524 Ga0495678_002192 3300049459 Bacteria 13690
525 Ga0495678_136895 3300049459 Bacteria 805
526 Ga0495682_0000385 3300049460 Bacteria 31974
527 Ga0495682_0005015 3300049460 Bacteria 5564
528 Ga0495682_0150709 3300049460 Bacteria 829
529 Ga0501072_0560468 3300049588 Bacteria 902
530 Ga0501073_0109409 3300049589 Bacteria 1917
531 Ga0501077_0083899 3300049593 Bacteria 2019
532 nmdc:mga03n38_604046_c1 3300050490 Bacteria 625
533 nmdc:mga0k408_72462_c2 3300050493 Bacteria 964
534 Ga0495612_0085981 3300053078 Bacteria 1326
535 Ga0500643_000008 3300053087 Bacteria 457931
536 Ga0500643_000147 3300053087 Bacteria 71589
537 Ga0500641_0060052 3300053096 Bacteria 1582
538 Ga0500608_042088 3300053122 Bacteria 2192
539 Ga0500618_001095 3300053125 Bacteria 13306
540 Ga0500564_011025 3300053138 Bacteria 3977
541 Ga0500568_0001957 3300053139 Bacteria 12613
542 Ga0500568_0015272 3300053139 Bacteria 3441
543 Ga0500573_0012418 3300053140 Bacteria 4783
544 Ga0500574_000021 3300053141 Bacteria 27781
545 Ga0500616_0000070 3300053153 Bacteria 232610
546 Ga0500627_0191702 3300053158 Bacteria 918
547 Ga0500638_000044 3300053162 Bacteria 29743
548 Ga0500636_0001029 3300053177 Bacteria 14947
549 Ga0500636_0021864 3300053177 Bacteria 3786
550 Ga0500636_0042982 3300053177 Bacteria 2670
551 Ga0501084_0042305 3300054114 Bacteria 3811
552 Ga0590071_000668 3300059421 Bacteria 9714
553 2511181812 2510917028 Bacteria 6185411
554 2524458707 2524023209 Bacteria 6679728
555 2585205938 2582581294 Bacteria 6626667
556 2585279703 2582581308 Bacteria 7413247
557 2585327539 2582581315 Bacteria 7318924
558 2585335793 2582581316 Bacteria 7774528
559 2585537205 2585427527 Bacteria 7273426
560 2585551159 2585427530 Bacteria 7383882
561 2585897107 2585427608 Bacteria 6544331
562 2585909029 2585427609 Bacteria 6667127
563 2587984443 2585428125 Bacteria 6662905
564 2601627379 2600255283 Bacteria 6061572
565 2616306492 2615840626 Bacteria 7921970
566 2616551403 2615840698 Bacteria 7319877
567 2616551809 2615840698 Bacteria 7319877
568 2671117136 2667528174 Bacteria 6435400
569 2738691881 2738541271 Bacteria 5657310
570 2738882512 2738541307 Bacteria 8606193
571 2739263368 2738543016 Bacteria 5657564
572 2778178019 2775507266 Bacteria 7392367
573 2819638590 2818991453 Bacteria 7181617
574 2838034246 2838029111 Bacteria 6603031
575 2839990296 2839989709 Bacteria 3773432
576 2842300030 2842298080 Bacteria 6123127
577 2842358941 2842357229 Bacteria 6485165
578 2842480992 2842475841 Bacteria 6603183
579 2842486371 2842482326 Bacteria 7212537
580 2842507603 2842502639 Bacteria 6604161
581 2842511456 2842509118 Bacteria 6850950
582 2919411347 2919408235 Bacteria 6149349
583 2998344793 2998344455 Bacteria 4222996
584 8005264627 8005258706 Bacteria 6184835
585 8005317879 8005314921 Bacteria 7072929
586 8005487300 8005484373 Bacteria 6297373
587 8005647227 8005645114 Bacteria 6950293
588 8057581883 8057575449 Bacteria 7367519
589 Ga0495661_0208468
590 MBSR1b_contig_3521707
591 JGI24740J21852_10000280
592 JGI25155J39150_1000199
593 JGI25156J39149_1000449
594 JGI25162J39368_1000275
595 JGI25154J39366_1000369
596 JGI25157J39369_1000477
597 JGI25159J45721_1001650
598 JGI25165J46597_1000624
599 JGI25165J46597_1004634
600 rootL2_10122418
601 rootL2_10132744
602 rootL2_10194887
603 JGI25160J50197_1000109
604 JGI25161J50226_1000011
605 Ga0055539_1010720
606 Ga0055543_1000071
607 Ga0058860_12097694
608 Ga0065165_1000135
609 Ga0065712_10150888
610 Ga0065715_10208708
611 Ga0070658_10104644
612 Ga0070676_10072444
613 Ga0070683_100103511
614 Ga0070683_100139643
615 Ga0070683_100169646
616 Ga0070683_100259380
617 Ga0070690_100363023
618 Ga0070670_100035186
619 Ga0070680_100032774
620 Ga0070680_100187596
621 Ga0070682_100393202
622 Ga0068868_100001617
623 Ga0068868_100056641
624 Ga0068868_100064484
625 Ga0070660_100357378
626 Ga0070661_100115874
627 Ga0070675_100102169
628 Ga0070675_100472046
629 Ga0070671_100574714
630 Ga0070667_100047266
631 Ga0070709_10174113
632 Ga0070714_100022363
633 Ga0070714_100267671
634 Ga0070714_100277493
635 Ga0070714_100387846
636 Ga0070713_100001380
637 Ga0070713_100081658
638 Ga0070713_100142969
639 Ga0070713_100460186
640 Ga0070713_100731308
641 Ga0070713_100733705
642 Ga0070713_101004748
643 Ga0070710_10250136
644 Ga0070711_100138112
645 Ga0070711_100266180
646 Ga0070711_101002163
647 Ga0070705_100191847
648 Ga0070694_100275393
649 Ga0070663_101371466
650 Ga0070681_10000034
651 Ga0070681_10008371
652 Ga0070681_10074241
653 Ga0070681_10091625
654 Ga0070681_10334840
655 Ga0068867_100003633
656 Ga0068867_100165320
657 Ga0070707_100313490
658 Ga0070679_100000270
659 Ga0070679_100015329
660 Ga0070679_100060787
661 Ga0070679_100615610
662 Ga0070684_100032961
663 Ga0070684_100040300
664 Ga0070684_100303531
665 Ga0070684_100427903
666 Ga0068853_100032352
667 Ga0068853_100105856
668 Ga0068853_100386849
669 Ga0070696_100432591
670 Ga0070693_100084672
671 Ga0070693_100529536
672 Ga0070665_100010723
673 Ga0068855_100000414
674 Ga0068855_100001570
675 Ga0068855_100002685
676 Ga0068855_100013420
677 Ga0068855_100031858
678 Ga0068855_100032767
679 Ga0068855_100062785
680 Ga0068855_100082865
681 Ga0068855_100195488
682 Ga0068855_100406398
683 Ga0068855_101228270
684 Ga0070664_100012196
685 Ga0070664_100080878
686 Ga0070664_100125614
687 Ga0070664_100402892
688 Ga0068857_100001766
689 Ga0068857_100002576
690 Ga0068857_100823531
691 Ga0068854_100019459
692 Ga0068854_100021020
693 Ga0068854_100111488
694 Ga0068856_100000494
695 Ga0068856_100000541
696 Ga0068856_100000571
697 Ga0068856_100006335
698 Ga0068856_100078287
699 Ga0068856_100344938
700 Ga0070702_100170233
701 Ga0070702_100263103
702 Ga0068852_100014521
703 Ga0068852_100036527
704 Ga0068852_100092954
705 Ga0068852_100711051
706 Ga0068852_100983899
707 Ga0068859_100010624
708 Ga0068864_100005671
709 Ga0068864_100142843
710 Ga0068866_10132539
711 Ga0068851_10038270
712 Ga0068851_10118004
713 Ga0068863_100008914
714 Ga0068858_100001544
715 Ga0068858_100045946
716 Ga0068858_100059316
717 Ga0068860_100022636
718 Ga0068860_100187394
719 Ga0068860_100205836
720 Ga0068862_100089901
721 Ga0070717_10008734
722 Ga0070717_10030352
723 Ga0070717_10166232
724 Ga0070717_11248483
725 Ga0075432_10003368
726 Ga0070716_100140030
727 Ga0070712_100007726
728 Ga0075366_10024188
729 Ga0097621_100000014
730 Ga0097621_100000229
731 Ga0097621_100024710
732 Ga0097621_100118061
733 Ga0068871_100000071
734 Ga0068871_100001973
735 Ga0068871_100015157
736 Ga0068871_100854283
737 Ga0068871_101206033
738 Ga0075428_100038053
739 Ga0075434_101349996
740 Ga0068865_100035373
741 Ga0068865_100112346
742 Ga0097620_100010623
743 Ga0105240_10000314
744 Ga0105240_10007208
745 Ga0105240_10020425
746 Ga0105240_10108702
747 Ga0105240_10127027
748 Ga0105240_10229568
749 Ga0105240_10255301
750 Ga0105240_10694957
751 Ga0105245_10416679
752 Ga0105247_10276618
753 Ga0105243_10000677
754 Ga0105241_10039542
755 Ga0105241_10084449
756 Ga0105241_10243638
757 Ga0105242_10160156
758 Ga0105248_10047329
759 Ga0105248_10441343
760 Ga0105237_10024440
761 Ga0105237_10081608
762 Ga0105237_10112015
763 Ga0105237_10280289
764 Ga0105237_10530278
765 Ga0105238_10000099
766 Ga0105238_10050797
767 Ga0105238_10115524
768 Ga0105238_10168855
769 Ga0105249_10302237
770 Ga0105239_10050797
771 Ga0105239_10222194
772 Ga0105239_10436583
773 Ga0105246_10104781
774 Ga0157373_10005586
775 Ga0157373_10334048
776 Ga0157371_10003695
777 Ga0157371_10071956
778 Ga0157371_10098349
779 Ga0157371_10196375
780 Ga0157370_10000938
781 Ga0157370_10004401
782 Ga0157370_10106492
783 Ga0157370_10154190
784 Ga0157370_10433628
785 Ga0157369_10000042
786 Ga0157369_10022583
787 Ga0157369_10052608
788 Ga0157369_10058915
789 Ga0157369_10200076
790 Ga0157369_10220182
791 Ga0157369_10273724
792 Ga0157369_10404660
793 Ga0157374_10001647
794 Ga0157374_10002559
795 Ga0157374_10076293
796 Ga0157378_10000733
797 Ga0157378_10003197
798 Ga0157378_10005107
799 Ga0157378_11199864
800 Ga0163162_10212663
801 Ga0157372_10000287
802 Ga0157372_10002160
803 Ga0157372_10003621
804 Ga0157372_10292773
805 Ga0157372_10297793
806 Ga0157372_10309558
807 Ga0157372_10555202
808 Ga0157372_10613763
809 Ga0157375_10433592
810 Ga0157375_10683004
811 Ga0182008_10004198
812 Ga0157376_10009682
813 Ga0157376_10063366
814 Ga0182007_10029950
815 Ga0213872_10004354
816 Ga0209435_100133
817 Ga0209437_100239
818 Ga0209437_104877
819 Ga0209646_1000404
820 Ga0209026_1000558
821 Ga0209677_101140
822 Ga0209148_1014143
823 Ga0209759_1000800
824 Ga0209759_1013700
825 Ga0209233_1000245
826 Ga0209233_1000582
827 Ga0209130_1000058
828 Ga0209675_1001866
829 Ga0209025_1003741
830 Ga0207426_1000131
831 Ga0207656_10015098
832 Ga0207692_10087493
833 Ga0207642_10092748
834 Ga0207699_10725715
835 Ga0207705_10002731
836 Ga0207654_10004303
837 Ga0207654_10247540
838 Ga0207707_10000891
839 Ga0207707_10004428
840 Ga0207707_10064886
841 Ga0207707_10112028
842 Ga0207707_10414851
843 Ga0207707_10427755
844 Ga0207695_10008941
845 Ga0207695_10064306
846 Ga0207695_10138480
847 Ga0207695_10181150
848 Ga0207695_10593387
849 Ga0207671_10000043
850 Ga0207671_10020313
851 Ga0207671_10271874
852 Ga0207693_10009175
853 Ga0207663_10544253
854 Ga0207660_10188874
855 Ga0207660_10197762
856 Ga0207660_11230599
857 Ga0207662_10046887
858 Ga0207657_10034345
859 Ga0207652_10001281
860 Ga0207652_10407638
861 Ga0207652_10433998
862 Ga0207652_10529734
863 Ga0207646_10196736
864 Ga0207694_10000936
865 Ga0207694_10164942
866 Ga0207694_10204552
867 Ga0207694_10955566
868 Ga0207650_10157907
869 Ga0207659_10377960
870 Ga0207700_10006223
871 Ga0207700_10327702
872 Ga0207700_10337237
873 Ga0207700_10759029
874 Ga0207700_10767494
875 Ga0207700_10853692
876 Ga0207664_10014836
877 Ga0207664_10075701
878 Ga0207664_10213953
879 Ga0207664_10825590
880 Ga0207644_10658016
881 Ga0207704_10032986
882 Ga0207704_10084820
883 Ga0207711_10033626
884 Ga0207711_10356144
885 Ga0207661_10215499
886 Ga0207661_10220421
887 Ga0207661_10267304
888 Ga0207679_10010148
889 Ga0207679_10245978
890 Ga0207679_10508882
891 Ga0207667_10000535
892 Ga0207667_10000827
893 Ga0207667_10014466
894 Ga0207667_10033571
895 Ga0207667_10158509
896 Ga0207667_10243647
897 Ga0207667_10259941
898 Ga0207667_10338893
899 Ga0207667_10879657
900 Ga0207640_10010790
901 Ga0207640_10016685
902 Ga0207658_10073691
903 Ga0207677_10001123
904 Ga0207677_10022394
905 Ga0207703_10025002
906 Ga0207703_10038124
907 Ga0207703_10060165
908 Ga0207703_10886193
909 Ga0207639_10038833
910 Ga0207639_10110005
911 Ga0207702_10000612
912 Ga0207702_10001271
913 Ga0207702_10004408
914 Ga0207702_10023945
915 Ga0207702_10045795
916 Ga0207702_10058829
917 Ga0207702_10438692
918 Ga0207702_10504512
919 Ga0207641_10006495
920 Ga0207648_10042635
921 Ga0207676_10004570
922 Ga0207676_10118718
923 Ga0207676_11152468
924 Ga0207674_10001299
925 Ga0207674_10020233
926 Ga0207674_10815259
927 Ga0207698_10300575
928 Ga0207698_10895976
929 Ga0209371_1002879
930 Ga0207428_10079659
931 Ga0268266_10052344
932 Ga0268265_10427468
933 Ga0268264_10087875
934 Ga0268264_10312180
935 Ga0265338_10001961
936 Ga0268256_1001906
937 Ga0265330_10022063
938 Ga0265332_10049802
939 Ga0265325_10263359
940 Ga0265340_10028184
941 Ga0265331_10015374
942 Ga0307408_100038650
943 Ga0265313_10132616
944 Ga0316575_10013800
945 Ga0265314_10010556
946 Ga0316576_10168943
947 Ga0316578_10026595
948 Ga0307410_11019592
949 Ga0307406_10069770
950 Ga0307412_10181649
951 Ga0307409_100048464
952 Ga0307409_100710425
953 Ga0307415_100053362
954 Ga0316583_10000699
955 Ga0316583_10056980
956 Ga0373929_0029415
957 Ga0373954_0039189
958 Ga0316574_0021299
959 Ga0316574_0058616
960 Ga0316574_0102889
961 Ga0373927_0113961
962 Ga0373933_0092442
963 Ga0373933_0143078
964 Ga0373937_0020699
965 Ga0373937_0567725
966 Ga0316582_0017146
967 Ga0316582_0154309
968 Ga0316582_0244901
969 Ga0316582_0808205
970 Ga0316584_0176138
971 Ga0395898_0396652
972 Ga0395905_0803931
973 Ga0400490_09529
974 Ga0400488_27669
975 Ga0436361_0434733
976 Ga0451800_0247031
977 Ga0451837_1386528
978 Ga0450888_005046
979 Ga0450893_0059963
980 Ga0451577_0073039
981 Ga0466972_0008941
982 Ga0453683_0151561
983 Ga0466965_0145020
984 Ga0466966_0433732
985 Ga0466961_0361612
986 Ga0466963_0010310
987 Ga0466963_0245237
988 Ga0466964_0358889
989 Ga0453684_0000035
990 Ga0453684_0306335
991 Ga0466968_0000953
992 Ga0466968_0017516
993 Ga0466957_0583555
994 Ga0466959_0151284
995 Ga0451576_0018547
996 Ga0451576_0056135
997 Ga0466967_0272689
998 Ga0466967_0333466
999 Ga0466967_0591471
1000 Ga0466967_1704594
1001 Ga0495617_016505
1002 Ga0495627_035332
1003 Ga0495591_006237
1004 Ga0495638_0001060
1005 Ga0495650_0000422
1006 Ga0495650_0018892
1007 Ga0495580_0054844
1008 Ga0495605_0003418
1009 Ga0495584_0002408
1010 Ga0495585_0011306
1011 Ga0495596_0000558
1012 Ga0495607_0000415
1013 Ga0495607_0006935
1014 Ga0495607_0029490
1015 Ga0495607_0040004
1016 Ga0495583_0008060
1017 Ga0495583_0057862
1018 Ga0495606_0000083
1019 Ga0495606_0012181
1020 Ga0495606_0089542
1021 Ga0495610_0027147
1022 Ga0495610_0044615
1023 Ga0495616_0018498
1024 Ga0495616_0118019
1025 Ga0495630_0264338
1026 Ga0495631_0028633
1027 Ga0495632_0013739
1028 Ga0495632_0016743
1029 Ga0495632_0053420
1030 Ga0495637_0000045
1031 Ga0495637_0004935
1032 Ga0495643_0005307
1033 Ga0495643_0010834
1034 Ga0495643_0015362
1035 Ga0495644_0000297
1036 Ga0495648_0001520
1037 Ga0495648_0002366
1038 Ga0495648_0034410
1039 Ga0495663_0000474
1040 Ga0495654_0008863
1041 Ga0495654_0074595
1042 Ga0495665_0241619
1043 Ga0495609_0000703
1044 Ga0495622_0001407
1045 Ga0495622_0002387
1046 Ga0495668_0209797
1047 Ga0495611_0002172
1048 Ga0495611_0157307
1049 Ga0495625_0000061
1050 Ga0495625_0028667
1051 Ga0495625_0155537
1052 Ga0495661_0000060
1053 Ga0495661_0045156
1054 Ga0495588_0001359
1055 Ga0495623_0030255
1056 Ga0495671_0072896
1057 Ga0495671_0076061
1058 Ga0495649_0000899
1059 Ga0495649_0003785
1060 Ga0495649_0023331
1061 Ga0495649_0517056
1062 Ga0495660_0033150
1063 Ga0495660_0099794
1064 Ga0495672_0104458
1065 Ga0495676_0000011
1066 Ga0495683_0152207
1067 Ga0495687_001221
1068 Ga0495687_022857
1069 Ga0495679_006532
1070 Ga0495679_060467
1071 Ga0495673_0212317
1072 Ga0495681_0002843
1073 Ga0495681_0030801
1074 Ga0495686_0008777
1075 Ga0495593_0275407
1076 Ga0495602_0157026
1077 Ga0495602_0619535
1078 Ga0496100_0012135
1079 Ga0496101_0023409
1080 Ga0496102_0012765
1081 Ga0496103_0003161
1082 Ga0496106_0267179
1083 Ga0496110_0004752
1084 Ga0496111_0478031
1085 Ga0496112_0008815
1086 Ga0496112_0010903
1087 Ga0496113_0010278
1088 Ga0496113_0821393
1089 Ga0496116_0012712
1090 Ga0496117_0005406
1091 Ga0496117_0055258
1092 Ga0496118_0006076
1093 Ga0496119_0015122
1094 Ga0496119_0126518
1095 Ga0496119_0195651
1096 Ga0496120_0010975
1097 Ga0496120_0082949
1098 Ga0496121_0009446
1099 Ga0496121_0146296
1100 Ga0496122_0032510
1101 Ga0496123_0040023
1102 Ga0496123_0079218
1103 Ga0496124_0000005
1104 Ga0496124_0019193
1105 Ga0496124_0066286
1106 Ga0496124_0306473
1107 Ga0496125_0005807
1108 Ga0496125_0278282
1109 Ga0496126_0061225
1110 Ga0496126_0135385
1111 Ga0495678_000778
1112 Ga0495678_002192
1113 Ga0495678_136895
1114 Ga0495682_0000385
1115 Ga0495682_0005015
1116 Ga0495682_0150709
1117 Ga0501072_0560468
1118 Ga0501073_0109409
1119 Ga0501077_0083899
1120 nmdc:mga03n38_604046_c1
1121 nmdc:mga0k408_72462_c2
1122 Ga0495612_0085981
1123 Ga0500643_000008
1124 Ga0500643_000147
1125 Ga0500641_0060052
1126 Ga0500608_042088
1127 Ga0500618_001095
1128 Ga0500564_011025
1129 Ga0500568_0001957
1130 Ga0500568_0015272
1131 Ga0500573_0012418
1132 Ga0500574_000021
1133 Ga0500616_0000070
1134 Ga0500627_0191702
1135 Ga0500638_000044
1136 Ga0500636_0001029
1137 Ga0500636_0021864
1138 Ga0500636_0042982
1139 Ga0501084_0042305
1140 Ga0590071_000668
1141 2511181812
1142 2524458707
1143 2585205938
1144 2585279703
1145 2585327539
1146 2585335793
1147 2585537205
1148 2585551159
1149 2585897107
1150 2585909029
1151 2587984443
1152 2601627379
1153 2616306492
1154 2616551403
1155 2616551809
1156 2671117136
1157 2738691881
1158 2738882512
1159 2739263368
1160 2778178019
1161 2819638590
1162 2838034246
1163 2839990296
1164 2842300030
1165 2842358941
1166 2842480992
1167 2842486371
1168 2842507603
1169 2842511456
1170 2919411347
1171 2998344793
1172 8005264627
1173 8005317879
1174 8005487300
1175 8005647227
1176 8057581883

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

22

194

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9751 2 171
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9743 2 175
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9725 1 179
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9698 2 176
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9686 2 176
ID Description Score Start End Superfamily
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9645 2 178 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.963 12 179 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9547 1 174 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9512 7 175 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9504 2 171 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3S5E6V5-F1-model_v4 deleted 0.9922 1 173
AF-A0A7V8VTN2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9911 1 163 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1F3TT77-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9902 1 179 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A5Q2V2X4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9892 1 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7V8PM70-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9891 1 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map