F466744

General Info

Members Datasets Scaffolds Average Seq Length
588 291 1176 181

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10020864|Ga0070709_100208642
Length 195
Sequence MPSRFHKLRARQQEREPLTAHGRINLVPLVDILTSIVFFSLLTYTGAVMTNLTAFDLALPPVVVTAPGQTNGANIDTTTLILAVGIHQNGLRVEHSNGGGTPFNQDIPGHSQASLDTLQATLQSIKQQFPTSDAVMVVPDDDIAYDDIVHVLERVKLAHFPKISLTSAARSMQTASTGSSTRGASLLALARPGGR

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 3.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 28.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10020864 3300005434 Bacteria 3811
2 JGI24740J21852_10087294 3300001979 Bacteria 809
3 Ga0032354_1052388 3300003693 Bacteria 800
4 Ga0065707_10375339 3300005295 Bacteria 884
5 Ga0065707_10471023 3300005295 Unclassified 782
6 Ga0070658_10002068 3300005327 Bacteria 16834
7 Ga0070658_10119808 3300005327 Unclassified 2186
8 Ga0070658_10375816 3300005327 Bacteria 1219
9 Ga0070676_10025534 3300005328 Unclassified 3340
10 Ga0070676_10565747 3300005328 Bacteria 815
11 Ga0070683_100188175 3300005329 Unclassified 1960
12 Ga0070683_100235846 3300005329 Bacteria 1740
13 Ga0070683_100369812 3300005329 Bacteria 1366
14 Ga0070683_100466511 3300005329 Bacteria 1205
15 Ga0070690_100259985 3300005330 Bacteria 1231
16 Ga0070670_100001355 3300005331 Bacteria 19630
17 Ga0070670_100004550 3300005331 Bacteria 11628
18 Ga0070670_100325557 3300005331 Unclassified 1347
19 Ga0070677_10058839 3300005333 Bacteria 1579
20 Ga0068869_100020631 3300005334 Unclassified 4521
21 Ga0070666_10205212 3300005335 Bacteria 1387
22 Ga0070680_100011613 3300005336 Bacteria 6821
23 Ga0070680_100058057 3300005336 Bacteria 3164
24 Ga0070680_100068381 3300005336 Unclassified 2915
25 Ga0070680_100126031 3300005336 Unclassified 2140
26 Ga0070682_100316493 3300005337 Unclassified 1151
27 Ga0070682_100719851 3300005337 Unclassified 802
28 Ga0070682_100892788 3300005337 Unclassified 730
29 Ga0068868_100909224 3300005338 Bacteria 800
30 Ga0070660_100012393 3300005339 Bacteria 6087
31 Ga0070660_100158378 3300005339 Unclassified 1823
32 Ga0070660_100201653 3300005339 Bacteria 1614
33 Ga0070689_100034464 3300005340 Unclassified 3862
34 Ga0070691_10031235 3300005341 Unclassified 2497
35 Ga0070687_100011661 3300005343 Bacteria 3853
36 Ga0070661_100007976 3300005344 Bacteria 7310
37 Ga0070661_100019265 3300005344 Unclassified 4862
38 Ga0070661_100046333 3300005344 Unclassified 3181
39 Ga0070661_100102689 3300005344 Bacteria 2128
40 Ga0070692_10007054 3300005345 Bacteria 4929
41 Ga0070692_10029546 3300005345 Bacteria 2733
42 Ga0070668_100006883 3300005347 Bacteria 8426
43 Ga0070668_100015618 3300005347 Bacteria 5676
44 Ga0070668_100023834 3300005347 Bacteria 4633
45 Ga0070669_100005328 3300005353 Bacteria 9287
46 Ga0070669_100013675 3300005353 Bacteria 5770
47 Ga0070669_100037172 3300005353 Bacteria 3532
48 Ga0070675_100000384 3300005354 Bacteria 29945
49 Ga0070675_100004326 3300005354 Bacteria 10828
50 Ga0070675_101206699 3300005354 Unclassified 697
51 Ga0070671_100128965 3300005355 Unclassified 2129
52 Ga0070674_100022589 3300005356 Bacteria 4060
53 Ga0070674_100073002 3300005356 Unclassified 2431
54 Ga0070674_100376633 3300005356 Bacteria 1154
55 Ga0070674_100411313 3300005356 Bacteria 1108
56 Ga0070673_100028009 3300005364 Bacteria 4184
57 Ga0070673_100904269 3300005364 Unclassified 819
58 Ga0070688_100005267 3300005365 Bacteria 6803
59 Ga0070659_100014214 3300005366 Bacteria 5943
60 Ga0070659_100072735 3300005366 Bacteria 2736
61 Ga0070659_100091183 3300005366 Bacteria 2443
62 Ga0070659_100122139 3300005366 Bacteria 2111
63 Ga0070667_100017568 3300005367 Bacteria 5929
64 Ga0070709_10233665 3300005434 Bacteria 1317
65 Ga0070714_100009153 3300005435 Bacteria 7773
66 Ga0070714_100013776 3300005435 Bacteria 6483
67 Ga0070714_100027313 3300005435 Unclassified 4725
68 Ga0070714_100117749 3300005435 Bacteria 2360
69 Ga0070713_100000317 3300005436 Bacteria 31612
70 Ga0070713_100455838 3300005436 Bacteria 1202
71 Ga0070713_101039854 3300005436 Bacteria 791
72 Ga0070710_10050132 3300005437 Bacteria 2339
73 Ga0070701_10015927 3300005438 Unclassified 3484
74 Ga0070701_10375914 3300005438 Unclassified 894
75 Ga0070705_100547666 3300005440 Bacteria 886
76 Ga0070700_100016644 3300005441 Unclassified 4192
77 Ga0070694_100022831 3300005444 Bacteria 4015
78 Ga0070694_100057448 3300005444 Bacteria 2645
79 Ga0070663_100025122 3300005455 Unclassified 4020
80 Ga0070663_100130979 3300005455 Bacteria 1904
81 Ga0070678_100374851 3300005456 Bacteria 1230
82 Ga0070662_100000842 3300005457 Bacteria 18859
83 Ga0070662_100054351 3300005457 Bacteria 2902
84 Ga0070662_100081723 3300005457 Bacteria 2408
85 Ga0070681_10000800 3300005458 Bacteria 26235
86 Ga0070681_10003098 3300005458 Bacteria 15444
87 Ga0070681_10005490 3300005458 Bacteria 12250
88 Ga0070681_10119648 3300005458 Unclassified 2569
89 Ga0070681_10231568 3300005458 Bacteria 1762
90 Ga0070681_10818580 3300005458 Unclassified 848
91 Ga0068867_100374241 3300005459 Unclassified 1195
92 Ga0070685_10020397 3300005466 Unclassified 3586
93 Ga0070685_10180873 3300005466 Unclassified 1357
94 Ga0070698_100172851 3300005471 Bacteria 2101
95 Ga0070679_100001604 3300005530 Bacteria 20306
96 Ga0070679_100002871 3300005530 Bacteria 15666
97 Ga0070679_100018746 3300005530 Bacteria 6717
98 Ga0070679_100223301 3300005530 Bacteria 1844
99 Ga0070679_100228254 3300005530 Unclassified 1822
100 Ga0070679_100315848 3300005530 Bacteria 1512
101 Ga0070679_100427331 3300005530 Bacteria 1270
102 Ga0070684_100014699 3300005535 Bacteria 6350
103 Ga0070684_100122825 3300005535 Bacteria 2337
104 Ga0070684_100516254 3300005535 Bacteria 1107
105 Ga0070684_100565306 3300005535 Unclassified 1056
106 Ga0070697_100527635 3300005536 Bacteria 1034
107 Ga0068853_100006414 3300005539 Bacteria 9348
108 Ga0068853_100100360 3300005539 Unclassified 2559
109 Ga0068853_100102728 3300005539 Unclassified 2529
110 Ga0068853_100796307 3300005539 Unclassified 905
111 Ga0070672_100007911 3300005543 Bacteria 7259
112 Ga0070672_100025699 3300005543 Bacteria 4371
113 Ga0070672_100063260 3300005543 Bacteria 2922
114 Ga0070693_100047171 3300005547 Unclassified 2450
115 Ga0070693_100081775 3300005547 Unclassified 1927
116 Ga0070665_100048591 3300005548 Bacteria 4258
117 Ga0070665_100082249 3300005548 Unclassified 3225
118 Ga0070665_100782956 3300005548 Bacteria 967
119 Ga0068855_100033666 3300005563 Bacteria 6113
120 Ga0068855_100588311 3300005563 Bacteria 1201
121 Ga0070664_100017349 3300005564 Bacteria 5911
122 Ga0070664_100022189 3300005564 Bacteria 5236
123 Ga0070664_100041306 3300005564 Bacteria 3892
124 Ga0070664_100179152 3300005564 Bacteria 1883
125 Ga0070664_100446856 3300005564 Unclassified 1186
126 Ga0070664_100497906 3300005564 Bacteria 1123
127 Ga0068857_100005630 3300005577 Bacteria 10707
128 Ga0068857_100013153 3300005577 Bacteria 7212
129 Ga0068857_100386476 3300005577 Bacteria 1300
130 Ga0068857_101069753 3300005577 Bacteria 778
131 Ga0068854_100279767 3300005578 Bacteria 1343
132 Ga0068854_100350966 3300005578 Bacteria 1207
133 Ga0068854_100635170 3300005578 Unclassified 915
134 Ga0068854_100835975 3300005578 Bacteria 805
135 Ga0068856_100161155 3300005614 Bacteria 2254
136 Ga0068856_100183358 3300005614 Unclassified 2107
137 Ga0068852_100008048 3300005616 Bacteria 7732
138 Ga0068852_100017449 3300005616 Bacteria 5632
139 Ga0068852_100167399 3300005616 Bacteria 2057
140 Ga0068852_100173718 3300005616 Bacteria 2021
141 Ga0068852_100531353 3300005616 Bacteria 1174
142 Ga0068852_100573852 3300005616 Bacteria 1130
143 Ga0068859_100136335 3300005617 Unclassified 2527
144 Ga0068864_100163479 3300005618 Bacteria 2025
145 Ga0068864_100560205 3300005618 Bacteria 1106
146 Ga0068861_100003148 3300005719 Bacteria 10910
147 Ga0068861_100003555 3300005719 Bacteria 10366
148 Ga0068851_10118422 3300005834 Unclassified 1421
149 Ga0068870_10289018 3300005840 Bacteria 1030
150 Ga0068863_100072104 3300005841 Bacteria 3268
151 Ga0068858_100005394 3300005842 Bacteria 12533
152 Ga0068860_100043742 3300005843 Bacteria 4270
153 Ga0068862_100000817 3300005844 Bacteria 30841
154 Ga0068862_100079458 3300005844 Unclassified 2843
155 Ga0068862_100193923 3300005844 Unclassified 1829
156 Ga0068862_101272157 3300005844 Unclassified 736
157 Ga0081539_10014236 3300005985 Bacteria 5905
158 Ga0070717_10002758 3300006028 Bacteria 12420
159 Ga0070717_10178642 3300006028 Bacteria 1849
160 Ga0070717_10325244 3300006028 Bacteria 1371
161 Ga0070717_11598795 3300006028 Unclassified 591
162 Ga0075432_10293690 3300006058 Unclassified 672
163 Ga0070712_100022460 3300006175 Bacteria 4157
164 Ga0070712_100648776 3300006175 Bacteria 897
165 Ga0097621_100743203 3300006237 Bacteria 906
166 Ga0075428_100092528 3300006844 Unclassified 3297
167 Ga0075428_100617339 3300006844 Bacteria 1157
168 Ga0075430_100008637 3300006846 Bacteria 8592
169 Ga0075430_100027221 3300006846 Unclassified 4861
170 Ga0075430_100158862 3300006846 Unclassified 1882
171 Ga0075430_100380711 3300006846 Unclassified 1164
172 Ga0075431_100007881 3300006847 Bacteria 10613
173 Ga0075431_100035274 3300006847 Bacteria 5149
174 Ga0075431_100075276 3300006847 Bacteria 3484
175 Ga0075431_100140181 3300006847 Unclassified 2492
176 Ga0075431_100253895 3300006847 Bacteria 1786
177 Ga0075431_100405560 3300006847 Unclassified 1364
178 Ga0075433_10018756 3300006852 Bacteria 5756
179 Ga0075433_10020635 3300006852 Bacteria 5514
180 Ga0075433_10437398 3300006852 Bacteria 1153
181 Ga0075434_100004027 3300006871 Bacteria 13171
182 Ga0075434_100005745 3300006871 Bacteria 11327
183 Ga0075434_100008831 3300006871 Bacteria 9379
184 Ga0075434_100244844 3300006871 Bacteria 1813
185 Ga0075434_100273664 3300006871 Bacteria 1708
186 Ga0075429_100037038 3300006880 Bacteria 4246
187 Ga0075429_100111171 3300006880 Unclassified 2395
188 Ga0075429_100194519 3300006880 Bacteria 1776
189 Ga0068865_100012173 3300006881 Bacteria 5410
190 Ga0075436_100019116 3300006914 Bacteria 4694
191 Ga0097620_100136337 3300006931 Unclassified 2527
192 Ga0075435_100114585 3300007076 Bacteria 2244
193 Ga0075435_100335245 3300007076 Unclassified 1296
194 Ga0075435_100340515 3300007076 Bacteria 1285
195 Ga0105240_10022138 3300009093 Bacteria 8434
196 Ga0105240_10048308 3300009093 Bacteria 5379
197 Ga0111539_10283545 3300009094 Unclassified 1928
198 Ga0111539_10430271 3300009094 Bacteria 1537
199 Ga0105245_11470747 3300009098 Bacteria 732
200 Ga0114129_10009395 3300009147 Bacteria 13937
201 Ga0114129_10229281 3300009147 Bacteria 2502
202 Ga0105241_10232696 3300009174 Bacteria 1554
203 Ga0105241_10268789 3300009174 Unclassified 1452
204 Ga0105241_10554875 3300009174 Unclassified 1032
205 Ga0105242_10126943 3300009176 Bacteria 2196
206 Ga0105248_10002656 3300009177 Bacteria 19848
207 Ga0105248_10280186 3300009177 Unclassified 1877
208 Ga0105248_10401900 3300009177 Bacteria 1542
209 Ga0105237_10147535 3300009545 Bacteria 2347
210 Ga0105238_10004576 3300009551 Bacteria 13675
211 Ga0105238_10006752 3300009551 Bacteria 11463
212 Ga0105249_10000151 3300009553 Bacteria 87816
213 Ga0105249_10000186 3300009553 Bacteria 71781
214 Ga0105249_10000946 3300009553 Bacteria 25696
215 Ga0105239_10026174 3300010375 Bacteria 6421
216 Ga0157373_10083428 3300013100 Unclassified 2252
217 Ga0157373_10203289 3300013100 Bacteria 1396
218 Ga0157373_10358218 3300013100 Bacteria 1041
219 Ga0157371_10045743 3300013102 Unclassified 3114
220 Ga0157371_10249242 3300013102 Bacteria 1278
221 Ga0157370_10007021 3300013104 Bacteria 12298
222 Ga0157370_10061046 3300013104 Bacteria 3578
223 Ga0157370_10417071 3300013104 Unclassified 1235
224 Ga0157370_11035922 3300013104 Unclassified 742
225 Ga0157369_10161541 3300013105 Unclassified 2365
226 Ga0157369_10227277 3300013105 Bacteria 1952
227 Ga0157369_10262170 3300013105 Unclassified 1802
228 Ga0157369_10687529 3300013105 Unclassified 1054
229 Ga0157374_11262210 3300013296 Bacteria 760
230 Ga0157374_11446221 3300013296 Bacteria 710
231 Ga0157378_10209382 3300013297 Unclassified 1848
232 Ga0163162_10005033 3300013306 Bacteria 12735
233 Ga0163162_10077536 3300013306 Bacteria 3387
234 Ga0157372_10127356 3300013307 Unclassified 2928
235 Ga0157372_11444364 3300013307 Bacteria 793
236 Ga0157375_10015601 3300013308 Bacteria 6804
237 Ga0157375_11179744 3300013308 Unclassified 898
238 Ga0157380_10106158 3300014326 Unclassified 2350
239 Ga0182008_10001348 3300014497 Bacteria 16699
240 Ga0182008_10119355 3300014497 Unclassified 1310
241 Ga0157379_10000492 3300014968 Bacteria 32096
242 Ga0157376_10033031 3300014969 Bacteria 4162
243 Ga0182007_10114361 3300015262 Unclassified 900
244 Ga0182007_10164003 3300015262 Bacteria 761
245 Ga0182005_1072566 3300015265 Bacteria 946
246 Ga0163161_10136043 3300017792 Bacteria 1858
247 Ga0206356_10131535 3300020070 Bacteria 1451
248 Ga0206352_10177264 3300020078 Unclassified 1375
249 Ga0206354_10070493 3300020081 Bacteria 1322
250 Ga0224712_10147480 3300022467 Bacteria 1040
251 Ga0207697_10011144 3300025315 Bacteria 3811
252 Ga0207656_10044637 3300025321 Bacteria 1894
253 Ga0207656_10050745 3300025321 Bacteria 1792
254 Ga0207653_10113382 3300025885 Bacteria 970
255 Ga0207682_10069082 3300025893 Unclassified 1493
256 Ga0207682_10149614 3300025893 Bacteria 1052
257 Ga0207642_10234772 3300025899 Unclassified 1032
258 Ga0207688_10012073 3300025901 Bacteria 4699
259 Ga0207680_10164859 3300025903 Bacteria 1489
260 Ga0207699_10005885 3300025906 Bacteria 5898
261 Ga0207699_10230065 3300025906 Bacteria 1269
262 Ga0207645_10000103 3300025907 Bacteria 62417
263 Ga0207645_10256270 3300025907 Bacteria 1158
264 Ga0207643_10008286 3300025908 Bacteria 5577
265 Ga0207705_10138898 3300025909 Bacteria 1813
266 Ga0207707_10000262 3300025912 Bacteria 56811
267 Ga0207707_10010620 3300025912 Bacteria 7998
268 Ga0207707_10033037 3300025912 Unclassified 4528
269 Ga0207707_10045285 3300025912 Bacteria 3834
270 Ga0207707_10098599 3300025912 Unclassified 2554
271 Ga0207707_10101599 3300025912 Unclassified 2513
272 Ga0207707_10111080 3300025912 Unclassified 2396
273 Ga0207707_10261652 3300025912 Bacteria 1501
274 Ga0207707_10418684 3300025912 Bacteria 1149
275 Ga0207707_10549770 3300025912 Unclassified 981
276 Ga0207695_10000580 3300025913 Bacteria 74519
277 Ga0207695_10100057 3300025913 Bacteria 2896
278 Ga0207695_10264402 3300025913 Bacteria 1617
279 Ga0207695_10625682 3300025913 Bacteria 958
280 Ga0207693_10031272 3300025915 Bacteria 4205
281 Ga0207663_10891413 3300025916 Bacteria 711
282 Ga0207660_10108413 3300025917 Unclassified 2086
283 Ga0207660_10394158 3300025917 Bacteria 1114
284 Ga0207662_10012659 3300025918 Bacteria 4702
285 Ga0207657_10008984 3300025919 Bacteria 10097
286 Ga0207657_10034592 3300025919 Bacteria 4542
287 Ga0207657_10231571 3300025919 Bacteria 1477
288 Ga0207649_10012050 3300025920 Bacteria 4785
289 Ga0207649_10021720 3300025920 Unclassified 3700
290 Ga0207649_10083107 3300025920 Bacteria 2078
291 Ga0207649_10090139 3300025920 Unclassified 2006
292 Ga0207652_10004657 3300025921 Bacteria 11119
293 Ga0207652_10022265 3300025921 Bacteria 5241
294 Ga0207652_10041582 3300025921 Bacteria 3908
295 Ga0207652_10056136 3300025921 Bacteria 3390
296 Ga0207652_10070965 3300025921 Unclassified 3025
297 Ga0207652_10080781 3300025921 Unclassified 2843
298 Ga0207681_10002985 3300025923 Bacteria 10634
299 Ga0207681_10029599 3300025923 Bacteria 3560
300 Ga0207694_10034035 3300025924 Bacteria 3905
301 Ga0207694_10235858 3300025924 Bacteria 1494
302 Ga0207694_10463129 3300025924 Bacteria 1059
303 Ga0207650_10008218 3300025925 Bacteria 7121
304 Ga0207650_10016545 3300025925 Bacteria 5158
305 Ga0207659_10003902 3300025926 Bacteria 8992
306 Ga0207659_10063510 3300025926 Bacteria 2669
307 Ga0207659_10412059 3300025926 Unclassified 1132
308 Ga0207687_10550487 3300025927 Bacteria 968
309 Ga0207700_10000640 3300025928 Bacteria 20431
310 Ga0207700_10313493 3300025928 Bacteria 1358
311 Ga0207664_10005683 3300025929 Bacteria 8526
312 Ga0207664_10199298 3300025929 Unclassified 1727
313 Ga0207664_11090294 3300025929 Bacteria 714
314 Ga0207644_10366573 3300025931 Bacteria 1173
315 Ga0207690_10015974 3300025932 Unclassified 4560
316 Ga0207690_10062464 3300025932 Bacteria 2536
317 Ga0207690_10090682 3300025932 Bacteria 2158
318 Ga0207690_10157799 3300025932 Bacteria 1688
319 Ga0207706_10000292 3300025933 Bacteria 54285
320 Ga0207706_10067390 3300025933 Bacteria 3149
321 Ga0207706_10107237 3300025933 Bacteria 2458
322 Ga0207706_10126949 3300025933 Bacteria 2243
323 Ga0207686_11074829 3300025934 Bacteria 655
324 Ga0207670_10165685 3300025936 Bacteria 1653
325 Ga0207669_10212214 3300025937 Bacteria 1414
326 Ga0207669_10330313 3300025937 Bacteria 1170
327 Ga0207704_10169685 3300025938 Bacteria 1563
328 Ga0207691_10001257 3300025940 Bacteria 25372
329 Ga0207691_10018309 3300025940 Bacteria 6635
330 Ga0207691_10832302 3300025940 Bacteria 775
331 Ga0207711_10048527 3300025941 Bacteria 3631
332 Ga0207711_10233935 3300025941 Bacteria 1683
333 Ga0207661_10053798 3300025944 Unclassified 3223
334 Ga0207661_10102144 3300025944 Unclassified 2410
335 Ga0207661_10437039 3300025944 Bacteria 1190
336 Ga0207661_10469938 3300025944 Bacteria 1147
337 Ga0207679_10001964 3300025945 Bacteria 12750
338 Ga0207679_10003851 3300025945 Bacteria 9304
339 Ga0207679_10025008 3300025945 Bacteria 4102
340 Ga0207679_10043743 3300025945 Bacteria 3227
341 Ga0207679_10073827 3300025945 Bacteria 2582
342 Ga0207679_10121546 3300025945 Bacteria 2080
343 Ga0207679_10481581 3300025945 Unclassified 1105
344 Ga0207679_10602989 3300025945 Bacteria 990
345 Ga0207667_10145451 3300025949 Unclassified 2440
346 Ga0207667_10465443 3300025949 Unclassified 1284
347 Ga0207651_10168091 3300025960 Bacteria 1727
348 Ga0207712_10000475 3300025961 Bacteria 33753
349 Ga0207712_10031551 3300025961 Bacteria 3570
350 Ga0207712_10151485 3300025961 Bacteria 1792
351 Ga0207668_10002406 3300025972 Bacteria 10942
352 Ga0207668_10008610 3300025972 Bacteria 6090
353 Ga0207640_10091662 3300025981 Bacteria 2106
354 Ga0207640_10391525 3300025981 Unclassified 1129
355 Ga0207658_10103281 3300025986 Unclassified 2237
356 Ga0207677_10083628 3300026023 Bacteria 2298
357 Ga0207677_10140836 3300026023 Unclassified 1846
358 Ga0207703_10024670 3300026035 Unclassified 4731
359 Ga0207639_10018501 3300026041 Bacteria 4953
360 Ga0207639_10094010 3300026041 Unclassified 2406
361 Ga0207678_10004288 3300026067 Bacteria 12794
362 Ga0207678_10124813 3300026067 Unclassified 2196
363 Ga0207708_10001365 3300026075 Bacteria 18353
364 Ga0207708_10151118 3300026075 Bacteria 1828
365 Ga0207702_10061103 3300026078 Bacteria 3213
366 Ga0207702_10160189 3300026078 Bacteria 2055
367 Ga0207702_10168355 3300026078 Unclassified 2007
368 Ga0207702_11218535 3300026078 Bacteria 747
369 Ga0207641_10023105 3300026088 Bacteria 5123
370 Ga0207648_10083645 3300026089 Bacteria 2783
371 Ga0207648_10963824 3300026089 Bacteria 798
372 Ga0207676_10228727 3300026095 Bacteria 1661
373 Ga0207676_10872089 3300026095 Unclassified 881
374 Ga0207676_11443621 3300026095 Unclassified 684
375 Ga0207674_10002656 3300026116 Bacteria 22323
376 Ga0207674_10009235 3300026116 Bacteria 11303
377 Ga0207674_10013803 3300026116 Bacteria 8937
378 Ga0207674_10284563 3300026116 Unclassified 1601
379 Ga0207675_100000024 3300026118 Bacteria 114684
380 Ga0207675_100005236 3300026118 Bacteria 12477
381 Ga0207698_10066228 3300026142 Bacteria 2842
382 Ga0207698_10197294 3300026142 Bacteria 1799
383 Ga0207698_10212902 3300026142 Bacteria 1740
384 Ga0207698_10372136 3300026142 Bacteria 1357
385 Ga0207698_10674633 3300026142 Bacteria 1026
386 Ga0207428_10292236 3300027907 Bacteria 1207
387 Ga0268266_10166171 3300028379 Unclassified 1999
388 Ga0268265_10000144 3300028380 Bacteria 90132
389 Ga0268265_10094902 3300028380 Bacteria 2393
390 Ga0268264_10005819 3300028381 Bacteria 10451
391 Ga0265340_10108636 3300031247 Unclassified 1284
392 Ga0265327_10032493 3300031251 Bacteria 2920
393 Ga0307408_100005215 3300031548 Bacteria 8713
394 Ga0307408_100064105 3300031548 Bacteria 2690
395 Ga0307408_100168773 3300031548 Bacteria 1745
396 Ga0307408_100577194 3300031548 Bacteria 996
397 Ga0265314_10031713 3300031711 Bacteria 3897
398 Ga0307405_10000447 3300031731 Bacteria 15431
399 Ga0307413_10008605 3300031824 Bacteria 4831
400 Ga0307410_10003576 3300031852 Bacteria 7829
401 Ga0307410_10059188 3300031852 Unclassified 2615
402 Ga0307410_10586596 3300031852 Bacteria 928
403 Ga0307406_10000711 3300031901 Bacteria 18736
404 Ga0307406_10013178 3300031901 Bacteria 4731
405 Ga0307406_10213795 3300031901 Bacteria 1428
406 Ga0307406_10291822 3300031901 Unclassified 1249
407 Ga0307407_10004248 3300031903 Bacteria 6047
408 Ga0307407_10128807 3300031903 Bacteria 1616
409 Ga0307412_10001848 3300031911 Bacteria 11734
410 Ga0307412_10218369 3300031911 Unclassified 1460
411 Ga0307412_10628547 3300031911 Bacteria 913
412 Ga0307409_100212700 3300031995 Bacteria 1739
413 Ga0307409_101215920 3300031995 Bacteria 777
414 Ga0307416_100019916 3300032002 Unclassified 4770
415 Ga0307416_100235042 3300032002 Bacteria 1770
416 Ga0307416_100257820 3300032002 Unclassified 1702
417 Ga0307416_100543110 3300032002 Bacteria 1234
418 Ga0307416_100574518 3300032002 Unclassified 1204
419 Ga0307416_100820464 3300032002 Bacteria 1027
420 Ga0307414_10155660 3300032004 Bacteria 1809
421 Ga0307411_10019378 3300032005 Bacteria 3929
422 Ga0307415_100021639 3300032126 Unclassified 3957
423 Ga0373926_0002430 3300035083 Bacteria 5902
424 Ga0373934_0006093 3300035086 Unclassified 4465
425 Ga0373923_0002824 3300035111 Bacteria 5443
426 Ga0373936_0125132 3300035113 Unclassified 1101
427 Ga0373945_0000886 3300035116 Bacteria 8845
428 Ga0373953_0022979 3300035117 Bacteria 2357
429 Ga0373954_0023609 3300035118 Bacteria 2798
430 Ga0373956_0001312 3300035119 Bacteria 10286
431 Ga0373943_0000833 3300035170 Bacteria 13595
432 Ga0373946_0004022 3300035171 Bacteria 5233
433 Ga0373955_0002647 3300035172 Bacteria 7834
434 Ga0373924_0005145 3300035410 Unclassified 4616
435 Ga0373935_0124814 3300035692 Unclassified 1723
436 Ga0373927_0002038 3300035695 Bacteria 14882
437 Ga0373933_0000305 3300035724 Bacteria 31659
438 Ga0373933_0178209 3300035724 Bacteria 1355
439 Ga0373947_0001615 3300035725 Bacteria 13822
440 Ga0373947_0097001 3300035725 Bacteria 1847
441 Ga0373937_0092745 3300036401 Unclassified 2799
442 Ga0373925_0000472 3300037068 Bacteria 40154
443 Ga0373925_0452393 3300037068 Bacteria 1051
444 Ga0395905_0392692 3300037471 Bacteria 1282
445 Ga0439439_0064331 3300041406 Bacteria 977
446 Ga0451577_0119958 3300042876 Bacteria 2355
447 Ga0451577_0142116 3300042876 Bacteria 2157
448 Ga0451577_0282608 3300042876 Bacteria 1503
449 Ga0466966_0147084 3300044684 Unclassified 1438
450 Ga0466963_0195809 3300044694 Bacteria 1413
451 Ga0453684_0000325 3300044712 Bacteria 200781
452 Ga0453684_0020640 3300044712 Bacteria 9915
453 Ga0453684_0035131 3300044712 Bacteria 6935
454 Ga0466957_0052004 3300044842 Unclassified 2494
455 Ga0466959_0019427 3300045049 Bacteria 4997
456 Ga0466959_0825411 3300045049 Bacteria 619
457 Ga0451576_0102652 3300045051 Bacteria 2975
458 Ga0451576_0124417 3300045051 Unclassified 2686
459 Ga0466958_0046667 3300045836 Bacteria 2614
460 Ga0466958_0060541 3300045836 Bacteria 2305
461 Ga0466967_0179085 3300045976 Unclassified 1998
462 Ga0466967_0612140 3300045976 Bacteria 1075
463 Ga0495592_0001353 3300046454 Bacteria 16950
464 Ga0495592_0209405 3300046454 Bacteria 1310
465 Ga0495592_0259153 3300046454 Bacteria 1146
466 Ga0495629_0009110 3300046459 Bacteria 7270
467 Ga0495629_0030299 3300046459 Bacteria 3837
468 Ga0495641_0190400 3300046461 Unclassified 919
469 Ga0495651_0000448 3300046462 Bacteria 31774
470 Ga0495651_0018823 3300046462 Bacteria 5349
471 Ga0495653_0001606 3300046463 Bacteria 17765
472 Ga0495653_0122562 3300046463 Unclassified 1850
473 Ga0495580_0000284 3300046472 Bacteria 41171
474 Ga0495580_0280700 3300046472 Bacteria 1136
475 Ga0495582_0006170 3300046473 Bacteria 6669
476 Ga0495639_0000089 3300046475 Bacteria 44172
477 Ga0495662_0092132 3300046476 Unclassified 1478
478 Ga0495585_0223926 3300046492 Unclassified 948
479 Ga0495594_0367360 3300046499 Unclassified 819
480 Ga0495608_0000482 3300046511 Bacteria 27697
481 Ga0495608_0040782 3300046511 Unclassified 3109
482 Ga0495608_0153133 3300046511 Bacteria 1469
483 Ga0495618_0125030 3300046514 Unclassified 1647
484 Ga0495628_0013366 3300046516 Bacteria 6905
485 Ga0495628_0035841 3300046516 Bacteria 3985
486 Ga0495630_0000946 3300046517 Bacteria 20299
487 Ga0495630_0021172 3300046517 Unclassified 4801
488 Ga0495630_0061275 3300046517 Bacteria 2825
489 Ga0495652_0005176 3300046529 Bacteria 12329
490 Ga0495652_0119254 3300046529 Unclassified 2108
491 Ga0495652_0329090 3300046529 Bacteria 1101
492 Ga0495665_0000018 3300046531 Bacteria 62843
493 Ga0495665_0088146 3300046531 Unclassified 1631
494 Ga0495665_0179622 3300046531 Unclassified 1100
495 Ga0495640_0031090 3300046533 Bacteria 3814
496 Ga0495586_0106517 3300046535 Bacteria 1559
497 Ga0495587_0004075 3300046536 Bacteria 9681
498 Ga0495587_0109448 3300046536 Bacteria 1588
499 Ga0495645_0003458 3300046543 Bacteria 10716
500 Ga0495667_0002048 3300046559 Bacteria 13376
501 Ga0495667_0045374 3300046559 Bacteria 2910
502 Ga0495634_0031232 3300046642 Bacteria 3670
503 Ga0495635_0002137 3300046663 Bacteria 13408
504 Ga0495635_0046188 3300046663 Unclassified 3004
505 Ga0495588_0000844 3300046674 Bacteria 13570
506 Ga0495657_0000832 3300046675 Bacteria 27258
507 Ga0495657_0046040 3300046675 Bacteria 2956
508 Ga0495599_0001031 3300046678 Bacteria 15639
509 Ga0495599_0163078 3300046678 Bacteria 1377
510 Ga0495623_0003345 3300046679 Bacteria 10601
511 Ga0495623_0050554 3300046679 Unclassified 2632
512 Ga0495658_0001158 3300046683 Bacteria 13917
513 Ga0495613_0004897 3300046689 Bacteria 10059
514 Ga0495613_0027522 3300046689 Bacteria 4230
515 Ga0495624_0558701 3300046690 Bacteria 683
516 Ga0495670_0310846 3300046691 Unclassified 845
517 Ga0495600_0000463 3300046809 Bacteria 21090
518 Ga0495600_0127835 3300046809 Unclassified 1652
519 Ga0495581_0000124 3300047315 Bacteria 33166
520 Ga0495581_0158927 3300047315 Unclassified 1321
521 Ga0495604_0000184 3300047317 Bacteria 55687
522 Ga0495604_0054246 3300047317 Unclassified 3094
523 Ga0495674_0004511 3300047319 Bacteria 13392
524 Ga0495674_0011512 3300047319 Bacteria 8346
525 Ga0495680_0004147 3300047322 Bacteria 13933
526 Ga0495680_0020091 3300047322 Bacteria 5628
527 Ga0495675_0068591 3300047444 Bacteria 2240
528 Ga0495675_0120048 3300047444 Bacteria 1637
529 Ga0495675_0151625 3300047444 Bacteria 1432
530 Ga0495684_0001087 3300047471 Bacteria 21918
531 Ga0495684_0072654 3300047471 Unclassified 2613
532 Ga0495593_0000172 3300047673 Bacteria 33560
533 Ga0495602_0009326 3300048088 Bacteria 10212
534 Ga0495602_0138432 3300048088 Unclassified 1930
535 Ga0495614_0000019 3300048089 Bacteria 49609
536 Ga0496101_0613079 3300048904 Bacteria 860
537 Ga0496102_0782252 3300048905 Unclassified 877
538 Ga0496109_0058302 3300048912 Unclassified 3527
539 Ga0496112_0658715 3300048915 Unclassified 976
540 Ga0496114_0075188 3300048917 Unclassified 2845
541 Ga0496115_0011391 3300048918 Bacteria 6665
542 Ga0501034_0311423 3300049571 Unclassified 1509
543 Ga0501070_0150425 3300049586 Unclassified 1921
544 nmdc:mga05p37_129550_c1 3300050507 Bacteria 3096
545 nmdc:mga05p37_36396_c1 3300050507 Bacteria 6038
546 nmdc:mga09592_145333_c1 3300050508 Unclassified 2045
547 nmdc:mga09592_190291_c1 3300050508 Bacteria 1776
548 nmdc:mga09592_68407_c1 3300050508 Bacteria 3012
549 nmdc:mga0qj67_231082_c1 3300050509 Unclassified 1501
550 nmdc:mga0qj67_43938_c1 3300050509 Unclassified 3519
551 nmdc:mga0qj67_4887_c1 3300050509 Bacteria 9744
552 nmdc:mga0qj67_832133_c1 3300050509 Unclassified 730
553 nmdc:mga06r32_18165_c1 3300050510 Bacteria 6433
554 nmdc:mga06r32_273428_c1 3300050510 Unclassified 1677
555 nmdc:mga06r32_39713_c1 3300050510 Bacteria 4466
556 nmdc:mga06r32_789555_c1 3300050510 Bacteria 911
557 nmdc:mga08y16_248803_c1 3300050511 Unclassified 1837
558 nmdc:mga0n895_11816_c1 3300050512 Bacteria 7807
559 nmdc:mga0n895_166117_c1 3300050512 Unclassified 2238
560 nmdc:mga0n895_259348_c1 3300050512 Bacteria 1764
561 nmdc:mga0n895_424_c1 3300050512 Bacteria 28339
562 nmdc:mga0n895_995151_c1 3300050512 Bacteria 820
563 nmdc:mga0n895_9971_c1 3300050512 Bacteria 8357
564 nmdc:mga0rr50_267676_c1 3300050513 Bacteria 1423
565 nmdc:mga08x19_1120_c1 3300050514 Bacteria 16723
566 nmdc:mga0a205_119360_c1 3300050515 Bacteria 2536
567 nmdc:mga0a205_5341_c1 3300050515 Bacteria 11579
568 Ga0495601_0010260 3300053077 Bacteria 5570
569 Ga0495612_0040262 3300053078 Bacteria 1903
570 Ga0495619_0008489 3300053085 Bacteria 6497
571 Ga0590071_023282 3300059421 Bacteria 1463
572 Ga0590071_024783 3300059421 Unclassified 1422
573 Ga0587066_000483 3300059490 Unclassified 3251
574 Ga0587073_0000182 3300059492 Unclassified 4627
575 Ga0587073_0004288 3300059492 Bacteria 2035
576 Ga0587080_029092 3300059503 Bacteria 952
577 Ga0587082_000964 3300059504 Unclassified 2757
578 Ga0587083_0040295 3300059505 Bacteria 975
579 Ga0587088_000905 3300059508 Unclassified 2812
580 Ga0587091_006155 3300059511 Bacteria 1672
581 Ga0587069_054177 3300059642 Unclassified 722
582 Ga0587072_077555 3300059643 Bacteria 712
583 Ga0587075_004175 3300059644 Unclassified 1662
584 Ga0587075_009074 3300059644 Bacteria 1287
585 Ga0587076_006251 3300059645 Unclassified 1579
586 Ga0587076_022244 3300059645 Unclassified 1058
587 Ga0587071_002783 3300060344 Unclassified 2427
588 Ga0587071_081003 3300060344 Bacteria 723
589 Ga0070709_10020864
590 JGI24740J21852_10087294
591 Ga0032354_1052388
592 Ga0065707_10375339
593 Ga0065707_10471023
594 Ga0070658_10002068
595 Ga0070658_10119808
596 Ga0070658_10375816
597 Ga0070676_10025534
598 Ga0070676_10565747
599 Ga0070683_100188175
600 Ga0070683_100235846
601 Ga0070683_100369812
602 Ga0070683_100466511
603 Ga0070690_100259985
604 Ga0070670_100001355
605 Ga0070670_100004550
606 Ga0070670_100325557
607 Ga0070677_10058839
608 Ga0068869_100020631
609 Ga0070666_10205212
610 Ga0070680_100011613
611 Ga0070680_100058057
612 Ga0070680_100068381
613 Ga0070680_100126031
614 Ga0070682_100316493
615 Ga0070682_100719851
616 Ga0070682_100892788
617 Ga0068868_100909224
618 Ga0070660_100012393
619 Ga0070660_100158378
620 Ga0070660_100201653
621 Ga0070689_100034464
622 Ga0070691_10031235
623 Ga0070687_100011661
624 Ga0070661_100007976
625 Ga0070661_100019265
626 Ga0070661_100046333
627 Ga0070661_100102689
628 Ga0070692_10007054
629 Ga0070692_10029546
630 Ga0070668_100006883
631 Ga0070668_100015618
632 Ga0070668_100023834
633 Ga0070669_100005328
634 Ga0070669_100013675
635 Ga0070669_100037172
636 Ga0070675_100000384
637 Ga0070675_100004326
638 Ga0070675_101206699
639 Ga0070671_100128965
640 Ga0070674_100022589
641 Ga0070674_100073002
642 Ga0070674_100376633
643 Ga0070674_100411313
644 Ga0070673_100028009
645 Ga0070673_100904269
646 Ga0070688_100005267
647 Ga0070659_100014214
648 Ga0070659_100072735
649 Ga0070659_100091183
650 Ga0070659_100122139
651 Ga0070667_100017568
652 Ga0070709_10233665
653 Ga0070714_100009153
654 Ga0070714_100013776
655 Ga0070714_100027313
656 Ga0070714_100117749
657 Ga0070713_100000317
658 Ga0070713_100455838
659 Ga0070713_101039854
660 Ga0070710_10050132
661 Ga0070701_10015927
662 Ga0070701_10375914
663 Ga0070705_100547666
664 Ga0070700_100016644
665 Ga0070694_100022831
666 Ga0070694_100057448
667 Ga0070663_100025122
668 Ga0070663_100130979
669 Ga0070678_100374851
670 Ga0070662_100000842
671 Ga0070662_100054351
672 Ga0070662_100081723
673 Ga0070681_10000800
674 Ga0070681_10003098
675 Ga0070681_10005490
676 Ga0070681_10119648
677 Ga0070681_10231568
678 Ga0070681_10818580
679 Ga0068867_100374241
680 Ga0070685_10020397
681 Ga0070685_10180873
682 Ga0070698_100172851
683 Ga0070679_100001604
684 Ga0070679_100002871
685 Ga0070679_100018746
686 Ga0070679_100223301
687 Ga0070679_100228254
688 Ga0070679_100315848
689 Ga0070679_100427331
690 Ga0070684_100014699
691 Ga0070684_100122825
692 Ga0070684_100516254
693 Ga0070684_100565306
694 Ga0070697_100527635
695 Ga0068853_100006414
696 Ga0068853_100100360
697 Ga0068853_100102728
698 Ga0068853_100796307
699 Ga0070672_100007911
700 Ga0070672_100025699
701 Ga0070672_100063260
702 Ga0070693_100047171
703 Ga0070693_100081775
704 Ga0070665_100048591
705 Ga0070665_100082249
706 Ga0070665_100782956
707 Ga0068855_100033666
708 Ga0068855_100588311
709 Ga0070664_100017349
710 Ga0070664_100022189
711 Ga0070664_100041306
712 Ga0070664_100179152
713 Ga0070664_100446856
714 Ga0070664_100497906
715 Ga0068857_100005630
716 Ga0068857_100013153
717 Ga0068857_100386476
718 Ga0068857_101069753
719 Ga0068854_100279767
720 Ga0068854_100350966
721 Ga0068854_100635170
722 Ga0068854_100835975
723 Ga0068856_100161155
724 Ga0068856_100183358
725 Ga0068852_100008048
726 Ga0068852_100017449
727 Ga0068852_100167399
728 Ga0068852_100173718
729 Ga0068852_100531353
730 Ga0068852_100573852
731 Ga0068859_100136335
732 Ga0068864_100163479
733 Ga0068864_100560205
734 Ga0068861_100003148
735 Ga0068861_100003555
736 Ga0068851_10118422
737 Ga0068870_10289018
738 Ga0068863_100072104
739 Ga0068858_100005394
740 Ga0068860_100043742
741 Ga0068862_100000817
742 Ga0068862_100079458
743 Ga0068862_100193923
744 Ga0068862_101272157
745 Ga0081539_10014236
746 Ga0070717_10002758
747 Ga0070717_10178642
748 Ga0070717_10325244
749 Ga0070717_11598795
750 Ga0075432_10293690
751 Ga0070712_100022460
752 Ga0070712_100648776
753 Ga0097621_100743203
754 Ga0075428_100092528
755 Ga0075428_100617339
756 Ga0075430_100008637
757 Ga0075430_100027221
758 Ga0075430_100158862
759 Ga0075430_100380711
760 Ga0075431_100007881
761 Ga0075431_100035274
762 Ga0075431_100075276
763 Ga0075431_100140181
764 Ga0075431_100253895
765 Ga0075431_100405560
766 Ga0075433_10018756
767 Ga0075433_10020635
768 Ga0075433_10437398
769 Ga0075434_100004027
770 Ga0075434_100005745
771 Ga0075434_100008831
772 Ga0075434_100244844
773 Ga0075434_100273664
774 Ga0075429_100037038
775 Ga0075429_100111171
776 Ga0075429_100194519
777 Ga0068865_100012173
778 Ga0075436_100019116
779 Ga0097620_100136337
780 Ga0075435_100114585
781 Ga0075435_100335245
782 Ga0075435_100340515
783 Ga0105240_10022138
784 Ga0105240_10048308
785 Ga0111539_10283545
786 Ga0111539_10430271
787 Ga0105245_11470747
788 Ga0114129_10009395
789 Ga0114129_10229281
790 Ga0105241_10232696
791 Ga0105241_10268789
792 Ga0105241_10554875
793 Ga0105242_10126943
794 Ga0105248_10002656
795 Ga0105248_10280186
796 Ga0105248_10401900
797 Ga0105237_10147535
798 Ga0105238_10004576
799 Ga0105238_10006752
800 Ga0105249_10000151
801 Ga0105249_10000186
802 Ga0105249_10000946
803 Ga0105239_10026174
804 Ga0157373_10083428
805 Ga0157373_10203289
806 Ga0157373_10358218
807 Ga0157371_10045743
808 Ga0157371_10249242
809 Ga0157370_10007021
810 Ga0157370_10061046
811 Ga0157370_10417071
812 Ga0157370_11035922
813 Ga0157369_10161541
814 Ga0157369_10227277
815 Ga0157369_10262170
816 Ga0157369_10687529
817 Ga0157374_11262210
818 Ga0157374_11446221
819 Ga0157378_10209382
820 Ga0163162_10005033
821 Ga0163162_10077536
822 Ga0157372_10127356
823 Ga0157372_11444364
824 Ga0157375_10015601
825 Ga0157375_11179744
826 Ga0157380_10106158
827 Ga0182008_10001348
828 Ga0182008_10119355
829 Ga0157379_10000492
830 Ga0157376_10033031
831 Ga0182007_10114361
832 Ga0182007_10164003
833 Ga0182005_1072566
834 Ga0163161_10136043
835 Ga0206356_10131535
836 Ga0206352_10177264
837 Ga0206354_10070493
838 Ga0224712_10147480
839 Ga0207697_10011144
840 Ga0207656_10044637
841 Ga0207656_10050745
842 Ga0207653_10113382
843 Ga0207682_10069082
844 Ga0207682_10149614
845 Ga0207642_10234772
846 Ga0207688_10012073
847 Ga0207680_10164859
848 Ga0207699_10005885
849 Ga0207699_10230065
850 Ga0207645_10000103
851 Ga0207645_10256270
852 Ga0207643_10008286
853 Ga0207705_10138898
854 Ga0207707_10000262
855 Ga0207707_10010620
856 Ga0207707_10033037
857 Ga0207707_10045285
858 Ga0207707_10098599
859 Ga0207707_10101599
860 Ga0207707_10111080
861 Ga0207707_10261652
862 Ga0207707_10418684
863 Ga0207707_10549770
864 Ga0207695_10000580
865 Ga0207695_10100057
866 Ga0207695_10264402
867 Ga0207695_10625682
868 Ga0207693_10031272
869 Ga0207663_10891413
870 Ga0207660_10108413
871 Ga0207660_10394158
872 Ga0207662_10012659
873 Ga0207657_10008984
874 Ga0207657_10034592
875 Ga0207657_10231571
876 Ga0207649_10012050
877 Ga0207649_10021720
878 Ga0207649_10083107
879 Ga0207649_10090139
880 Ga0207652_10004657
881 Ga0207652_10022265
882 Ga0207652_10041582
883 Ga0207652_10056136
884 Ga0207652_10070965
885 Ga0207652_10080781
886 Ga0207681_10002985
887 Ga0207681_10029599
888 Ga0207694_10034035
889 Ga0207694_10235858
890 Ga0207694_10463129
891 Ga0207650_10008218
892 Ga0207650_10016545
893 Ga0207659_10003902
894 Ga0207659_10063510
895 Ga0207659_10412059
896 Ga0207687_10550487
897 Ga0207700_10000640
898 Ga0207700_10313493
899 Ga0207664_10005683
900 Ga0207664_10199298
901 Ga0207664_11090294
902 Ga0207644_10366573
903 Ga0207690_10015974
904 Ga0207690_10062464
905 Ga0207690_10090682
906 Ga0207690_10157799
907 Ga0207706_10000292
908 Ga0207706_10067390
909 Ga0207706_10107237
910 Ga0207706_10126949
911 Ga0207686_11074829
912 Ga0207670_10165685
913 Ga0207669_10212214
914 Ga0207669_10330313
915 Ga0207704_10169685
916 Ga0207691_10001257
917 Ga0207691_10018309
918 Ga0207691_10832302
919 Ga0207711_10048527
920 Ga0207711_10233935
921 Ga0207661_10053798
922 Ga0207661_10102144
923 Ga0207661_10437039
924 Ga0207661_10469938
925 Ga0207679_10001964
926 Ga0207679_10003851
927 Ga0207679_10025008
928 Ga0207679_10043743
929 Ga0207679_10073827
930 Ga0207679_10121546
931 Ga0207679_10481581
932 Ga0207679_10602989
933 Ga0207667_10145451
934 Ga0207667_10465443
935 Ga0207651_10168091
936 Ga0207712_10000475
937 Ga0207712_10031551
938 Ga0207712_10151485
939 Ga0207668_10002406
940 Ga0207668_10008610
941 Ga0207640_10091662
942 Ga0207640_10391525
943 Ga0207658_10103281
944 Ga0207677_10083628
945 Ga0207677_10140836
946 Ga0207703_10024670
947 Ga0207639_10018501
948 Ga0207639_10094010
949 Ga0207678_10004288
950 Ga0207678_10124813
951 Ga0207708_10001365
952 Ga0207708_10151118
953 Ga0207702_10061103
954 Ga0207702_10160189
955 Ga0207702_10168355
956 Ga0207702_11218535
957 Ga0207641_10023105
958 Ga0207648_10083645
959 Ga0207648_10963824
960 Ga0207676_10228727
961 Ga0207676_10872089
962 Ga0207676_11443621
963 Ga0207674_10002656
964 Ga0207674_10009235
965 Ga0207674_10013803
966 Ga0207674_10284563
967 Ga0207675_100000024
968 Ga0207675_100005236
969 Ga0207698_10066228
970 Ga0207698_10197294
971 Ga0207698_10212902
972 Ga0207698_10372136
973 Ga0207698_10674633
974 Ga0207428_10292236
975 Ga0268266_10166171
976 Ga0268265_10000144
977 Ga0268265_10094902
978 Ga0268264_10005819
979 Ga0265340_10108636
980 Ga0265327_10032493
981 Ga0307408_100005215
982 Ga0307408_100064105
983 Ga0307408_100168773
984 Ga0307408_100577194
985 Ga0265314_10031713
986 Ga0307405_10000447
987 Ga0307413_10008605
988 Ga0307410_10003576
989 Ga0307410_10059188
990 Ga0307410_10586596
991 Ga0307406_10000711
992 Ga0307406_10013178
993 Ga0307406_10213795
994 Ga0307406_10291822
995 Ga0307407_10004248
996 Ga0307407_10128807
997 Ga0307412_10001848
998 Ga0307412_10218369
999 Ga0307412_10628547
1000 Ga0307409_100212700
1001 Ga0307409_101215920
1002 Ga0307416_100019916
1003 Ga0307416_100235042
1004 Ga0307416_100257820
1005 Ga0307416_100543110
1006 Ga0307416_100574518
1007 Ga0307416_100820464
1008 Ga0307414_10155660
1009 Ga0307411_10019378
1010 Ga0307415_100021639
1011 Ga0373926_0002430
1012 Ga0373934_0006093
1013 Ga0373923_0002824
1014 Ga0373936_0125132
1015 Ga0373945_0000886
1016 Ga0373953_0022979
1017 Ga0373954_0023609
1018 Ga0373956_0001312
1019 Ga0373943_0000833
1020 Ga0373946_0004022
1021 Ga0373955_0002647
1022 Ga0373924_0005145
1023 Ga0373935_0124814
1024 Ga0373927_0002038
1025 Ga0373933_0000305
1026 Ga0373933_0178209
1027 Ga0373947_0001615
1028 Ga0373947_0097001
1029 Ga0373937_0092745
1030 Ga0373925_0000472
1031 Ga0373925_0452393
1032 Ga0395905_0392692
1033 Ga0439439_0064331
1034 Ga0451577_0119958
1035 Ga0451577_0142116
1036 Ga0451577_0282608
1037 Ga0466966_0147084
1038 Ga0466963_0195809
1039 Ga0453684_0000325
1040 Ga0453684_0020640
1041 Ga0453684_0035131
1042 Ga0466957_0052004
1043 Ga0466959_0019427
1044 Ga0466959_0825411
1045 Ga0451576_0102652
1046 Ga0451576_0124417
1047 Ga0466958_0046667
1048 Ga0466958_0060541
1049 Ga0466967_0179085
1050 Ga0466967_0612140
1051 Ga0495592_0001353
1052 Ga0495592_0209405
1053 Ga0495592_0259153
1054 Ga0495629_0009110
1055 Ga0495629_0030299
1056 Ga0495641_0190400
1057 Ga0495651_0000448
1058 Ga0495651_0018823
1059 Ga0495653_0001606
1060 Ga0495653_0122562
1061 Ga0495580_0000284
1062 Ga0495580_0280700
1063 Ga0495582_0006170
1064 Ga0495639_0000089
1065 Ga0495662_0092132
1066 Ga0495585_0223926
1067 Ga0495594_0367360
1068 Ga0495608_0000482
1069 Ga0495608_0040782
1070 Ga0495608_0153133
1071 Ga0495618_0125030
1072 Ga0495628_0013366
1073 Ga0495628_0035841
1074 Ga0495630_0000946
1075 Ga0495630_0021172
1076 Ga0495630_0061275
1077 Ga0495652_0005176
1078 Ga0495652_0119254
1079 Ga0495652_0329090
1080 Ga0495665_0000018
1081 Ga0495665_0088146
1082 Ga0495665_0179622
1083 Ga0495640_0031090
1084 Ga0495586_0106517
1085 Ga0495587_0004075
1086 Ga0495587_0109448
1087 Ga0495645_0003458
1088 Ga0495667_0002048
1089 Ga0495667_0045374
1090 Ga0495634_0031232
1091 Ga0495635_0002137
1092 Ga0495635_0046188
1093 Ga0495588_0000844
1094 Ga0495657_0000832
1095 Ga0495657_0046040
1096 Ga0495599_0001031
1097 Ga0495599_0163078
1098 Ga0495623_0003345
1099 Ga0495623_0050554
1100 Ga0495658_0001158
1101 Ga0495613_0004897
1102 Ga0495613_0027522
1103 Ga0495624_0558701
1104 Ga0495670_0310846
1105 Ga0495600_0000463
1106 Ga0495600_0127835
1107 Ga0495581_0000124
1108 Ga0495581_0158927
1109 Ga0495604_0000184
1110 Ga0495604_0054246
1111 Ga0495674_0004511
1112 Ga0495674_0011512
1113 Ga0495680_0004147
1114 Ga0495680_0020091
1115 Ga0495675_0068591
1116 Ga0495675_0120048
1117 Ga0495675_0151625
1118 Ga0495684_0001087
1119 Ga0495684_0072654
1120 Ga0495593_0000172
1121 Ga0495602_0009326
1122 Ga0495602_0138432
1123 Ga0495614_0000019
1124 Ga0496101_0613079
1125 Ga0496102_0782252
1126 Ga0496109_0058302
1127 Ga0496112_0658715
1128 Ga0496114_0075188
1129 Ga0496115_0011391
1130 Ga0501034_0311423
1131 Ga0501070_0150425
1132 nmdc:mga05p37_129550_c1
1133 nmdc:mga05p37_36396_c1
1134 nmdc:mga09592_145333_c1
1135 nmdc:mga09592_190291_c1
1136 nmdc:mga09592_68407_c1
1137 nmdc:mga0qj67_231082_c1
1138 nmdc:mga0qj67_43938_c1
1139 nmdc:mga0qj67_4887_c1
1140 nmdc:mga0qj67_832133_c1
1141 nmdc:mga06r32_18165_c1
1142 nmdc:mga06r32_273428_c1
1143 nmdc:mga06r32_39713_c1
1144 nmdc:mga06r32_789555_c1
1145 nmdc:mga08y16_248803_c1
1146 nmdc:mga0n895_11816_c1
1147 nmdc:mga0n895_166117_c1
1148 nmdc:mga0n895_259348_c1
1149 nmdc:mga0n895_424_c1
1150 nmdc:mga0n895_995151_c1
1151 nmdc:mga0n895_9971_c1
1152 nmdc:mga0rr50_267676_c1
1153 nmdc:mga08x19_1120_c1
1154 nmdc:mga0a205_119360_c1
1155 nmdc:mga0a205_5341_c1
1156 Ga0495601_0010260
1157 Ga0495612_0040262
1158 Ga0495619_0008489
1159 Ga0590071_023282
1160 Ga0590071_024783
1161 Ga0587066_000483
1162 Ga0587073_0000182
1163 Ga0587073_0004288
1164 Ga0587080_029092
1165 Ga0587082_000964
1166 Ga0587083_0040295
1167 Ga0587088_000905
1168 Ga0587091_006155
1169 Ga0587069_054177
1170 Ga0587072_077555
1171 Ga0587075_004175
1172 Ga0587075_009074
1173 Ga0587076_006251
1174 Ga0587076_022244
1175 Ga0587071_002783
1176 Ga0587071_081003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

19

169

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3arr-assembly1.cif.gz_A crystal structure analysis of chitinase a from vibrio harveyi with novel inhibitors - complex structure with pentoxifylline 0.7635 110 159
3b9e-assembly1.cif.gz_A crystal structure of inactive mutant e315m chitinase a from vibrio harveyi 0.7568 110 158
4nb4-assembly2.cif.gz_C pantothenamide-bound pantothenate kinase from staphylococcus aureus 0.7389 81 166
5by4-assembly1.cif.gz_A-2 structure and function of the escherichia coli tol-pal stator protein tolr 0.7252 76 166
1t99-assembly1.cif.gz_A r106g kdo8ps without substrates 0.7177 119 165
ID Description Score Start End Superfamily
af_Q58803_167_347_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7878 115 166 3.40.50.300
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7748 134 166 3.40.50.2020
3vthA04 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7637 114 169 3.30.420.40
af_P37325_17_284_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7571 111 169 3.20.20.80
af_A0A1D6E1S5_31_265_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7525 88 109 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A538U2N7-F1-model_v4 Biopolymer transporter ExbD 0.8912 75 166 GO:0005886
GO:0015031
GO:0022857
AF-A0A7Y6UHN8-F1-model_v4 Uncharacterized protein 0.8607 81 166
AF-A0A4Q6CQE4-F1-model_v4 deleted 0.8418 81 165
AF-K7YSC0-F1-model_v4 TolR protein 0.831 83 169 GO:0005886
GO:0015031
GO:0022857
AF-A0A6I6JT74-F1-model_v4 Peptidase M56 domain-containing protein 0.8262 111 166 GO:0016020

Map