F466680

General Info

Members Datasets Scaffolds Average Seq Length
587 218 1174 133

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10422002|Ga0307405_104220022
Length 149
Sequence VTDVIEKGGGSALINSVPTLHLTKVAFACRDLEMLQRRIASRASGGEIRIATRMRPKRAAEAVGGNLYWIVKHRIIAGLEILRFDDREDGRIDIVCAAELRTVAPIPRRAHQGWRYLEEVDAPSTDDDGSGLGELPPRLYGRLAALALV

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
158 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
202 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
205 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
210 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
211 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
212 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
213 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.3
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10422002 3300031731 Bacteria 1050
2 JGI24740J21852_10006499 3300001979 Bacteria 4833
3 JGI24737J22298_10002565 3300001990 Bacteria 6449
4 Ga0070658_10006628 3300005327 Bacteria 9383
5 Ga0070658_10014846 3300005327 Bacteria 6241
6 Ga0070658_10096061 3300005327 Bacteria 2446
7 Ga0070658_10123322 3300005327 Bacteria 2154
8 Ga0070658_10278496 3300005327 Bacteria 1423
9 Ga0070658_10517866 3300005327 Unclassified 1031
10 Ga0070676_10209739 3300005328 Unclassified 1281
11 Ga0070683_100013929 3300005329 Bacteria 7025
12 Ga0070683_100022108 3300005329 Bacteria 5681
13 Ga0070690_100002246 3300005330 Bacteria 10357
14 Ga0070670_100044551 3300005331 Bacteria 3815
15 Ga0070670_100152474 3300005331 Bacteria 2000
16 Ga0070666_10003379 3300005335 Bacteria 9675
17 Ga0070666_10004591 3300005335 Bacteria 8426
18 Ga0070666_10007248 3300005335 Bacteria 6837
19 Ga0070680_100016156 3300005336 Bacteria 5869
20 Ga0070680_101137641 3300005336 Bacteria 675
21 Ga0070680_101854154 3300005336 Bacteria 523
22 Ga0070682_100004662 3300005337 Bacteria 7615
23 Ga0070682_100169427 3300005337 Bacteria 1516
24 Ga0070682_101231761 3300005337 Bacteria 633
25 Ga0068868_100013572 3300005338 Bacteria 5979
26 Ga0068868_100346972 3300005338 Bacteria 1271
27 Ga0068868_100605792 3300005338 Bacteria 971
28 Ga0070660_100297179 3300005339 Bacteria 1323
29 Ga0070689_101942367 3300005340 Unclassified 538
30 Ga0070691_10000817 3300005341 Bacteria 12472
31 Ga0070687_100908194 3300005343 Bacteria 632
32 Ga0070661_100018334 3300005344 Bacteria 4976
33 Ga0070661_100071316 3300005344 Bacteria 2556
34 Ga0070661_100137714 3300005344 Bacteria 1838
35 Ga0070661_100169778 3300005344 Bacteria 1656
36 Ga0070661_100173892 3300005344 Bacteria 1636
37 Ga0070668_100179721 3300005347 Bacteria 1728
38 Ga0070668_100970767 3300005347 Unclassified 762
39 Ga0070668_101145486 3300005347 Bacteria 703
40 Ga0070671_100024194 3300005355 Bacteria 4971
41 Ga0070671_100031476 3300005355 Bacteria 4383
42 Ga0070671_100121174 3300005355 Bacteria 2201
43 Ga0070674_100015687 3300005356 Bacteria 4736
44 Ga0070674_100250086 3300005356 Bacteria 1392
45 Ga0070673_100011040 3300005364 Bacteria 6152
46 Ga0070673_100139748 3300005364 Bacteria 2042
47 Ga0070673_100388199 3300005364 Bacteria 1246
48 Ga0070673_100663368 3300005364 Bacteria 955
49 Ga0070673_100709144 3300005364 Bacteria 924
50 Ga0070659_100019271 3300005366 Bacteria 5166
51 Ga0070659_100065013 3300005366 Bacteria 2888
52 Ga0070659_100088628 3300005366 Bacteria 2478
53 Ga0070659_100323878 3300005366 Bacteria 1289
54 Ga0070659_100939462 3300005366 Bacteria 757
55 Ga0070659_100999973 3300005366 Bacteria 734
56 Ga0070659_101305241 3300005366 Bacteria 644
57 Ga0070667_100001244 3300005367 Bacteria 23122
58 Ga0070667_102319947 3300005367 Bacteria 505
59 Ga0070713_100022716 3300005436 Bacteria 4852
60 Ga0070663_100057098 3300005455 Bacteria 2799
61 Ga0070663_100322954 3300005455 Bacteria 1242
62 Ga0070663_100680404 3300005455 Bacteria 873
63 Ga0070663_100778995 3300005455 Bacteria 819
64 Ga0070663_101046548 3300005455 Unclassified 711
65 Ga0070678_100010809 3300005456 Bacteria 5595
66 Ga0070678_100235389 3300005456 Bacteria 1529
67 Ga0070678_100307602 3300005456 Bacteria 1349
68 Ga0070662_100015985 3300005457 Bacteria 5034
69 Ga0070662_100032141 3300005457 Bacteria 3687
70 Ga0070662_100120067 3300005457 Bacteria 2014
71 Ga0070662_100156148 3300005457 Bacteria 1781
72 Ga0070662_100326179 3300005457 Bacteria 1253
73 Ga0070662_100690348 3300005457 Bacteria 863
74 Ga0070662_101039975 3300005457 Bacteria 702
75 Ga0070662_101105317 3300005457 Bacteria 680
76 Ga0070681_10043394 3300005458 Bacteria 4505
77 Ga0068867_100026383 3300005459 Bacteria 4171
78 Ga0068867_100102815 3300005459 Bacteria 2184
79 Ga0070679_100011120 3300005530 Bacteria 8568
80 Ga0070679_100261142 3300005530 Bacteria 1687
81 Ga0070684_100007495 3300005535 Bacteria 8490
82 Ga0070684_100034981 3300005535 Bacteria 4297
83 Ga0068853_100144170 3300005539 Bacteria 2139
84 Ga0068853_100479099 3300005539 Bacteria 1173
85 Ga0068853_101817368 3300005539 Bacteria 591
86 Ga0070672_100093113 3300005543 Bacteria 2434
87 Ga0070672_100487865 3300005543 Bacteria 1065
88 Ga0070686_100009751 3300005544 Bacteria 5396
89 Ga0070686_100413420 3300005544 Bacteria 1029
90 Ga0070693_100136629 3300005547 Bacteria 1539
91 Ga0070693_101040817 3300005547 Bacteria 621
92 Ga0070665_101036671 3300005548 Bacteria 832
93 Ga0068855_100675763 3300005563 Bacteria 1107
94 Ga0070664_100002139 3300005564 Bacteria 15828
95 Ga0070664_100036427 3300005564 Bacteria 4133
96 Ga0070664_100129993 3300005564 Bacteria 2211
97 Ga0070664_100706371 3300005564 Bacteria 940
98 Ga0068857_100007325 3300005577 Bacteria 9503
99 Ga0068857_100057551 3300005577 Bacteria 3450
100 Ga0068857_100137680 3300005577 Bacteria 2205
101 Ga0068857_100185116 3300005577 Bacteria 1896
102 Ga0068854_100007384 3300005578 Bacteria 7024
103 Ga0068854_100024104 3300005578 Bacteria 4163
104 Ga0068854_100181086 3300005578 Bacteria 1646
105 Ga0068854_100849865 3300005578 Bacteria 799
106 Ga0068854_100949854 3300005578 Unclassified 758
107 Ga0068856_100054426 3300005614 Bacteria 3946
108 Ga0068856_100076496 3300005614 Bacteria 3316
109 Ga0068856_100131507 3300005614 Bacteria 2507
110 Ga0068856_100224970 3300005614 Bacteria 1892
111 Ga0068856_100340727 3300005614 Bacteria 1517
112 Ga0068856_100367906 3300005614 Bacteria 1456
113 Ga0068856_101166898 3300005614 Bacteria 787
114 Ga0068856_101778358 3300005614 Unclassified 628
115 Ga0068852_100008892 3300005616 Bacteria 7430
116 Ga0068852_100144153 3300005616 Bacteria 2207
117 Ga0068852_100271947 3300005616 Bacteria 1631
118 Ga0068852_100381085 3300005616 Bacteria 1383
119 Ga0068852_100407507 3300005616 Bacteria 1339
120 Ga0068852_100448673 3300005616 Bacteria 1277
121 Ga0068852_100591782 3300005616 Bacteria 1113
122 Ga0068852_100618715 3300005616 Bacteria 1088
123 Ga0068852_101378887 3300005616 Bacteria 727
124 Ga0068859_100038581 3300005617 Bacteria 4791
125 Ga0068859_100229047 3300005617 Bacteria 1946
126 Ga0068859_101823964 3300005617 Unclassified 672
127 Ga0068859_102009868 3300005617 Bacteria 638
128 Ga0068864_100007944 3300005618 Bacteria 8743
129 Ga0068861_100626286 3300005719 Bacteria 991
130 Ga0068861_102258386 3300005719 Bacteria 546
131 Ga0068851_10013181 3300005834 Bacteria 3910
132 Ga0068851_10190458 3300005834 Bacteria 1140
133 Ga0068863_100004490 3300005841 Bacteria 13763
134 Ga0068863_100006550 3300005841 Bacteria 11429
135 Ga0068858_100061299 3300005842 Bacteria 3477
136 Ga0068858_100233048 3300005842 Bacteria 1746
137 Ga0068860_100305004 3300005843 Bacteria 1561
138 Ga0068862_100489103 3300005844 Bacteria 1166
139 Ga0068862_100553292 3300005844 Bacteria 1099
140 Ga0070717_10003959 3300006028 Bacteria 10658
141 Ga0097621_100123729 3300006237 Bacteria 2196
142 Ga0097621_100262362 3300006237 Bacteria 1516
143 Ga0068871_100045973 3300006358 Bacteria 3515
144 Ga0068871_100991745 3300006358 Bacteria 782
145 Ga0075431_101088464 3300006847 Bacteria 764
146 Ga0075434_100701488 3300006871 Bacteria 1029
147 Ga0075434_101837132 3300006871 Bacteria 612
148 Ga0097620_100038582 3300006931 Bacteria 4791
149 Ga0097620_100229051 3300006931 Bacteria 1946
150 Ga0097620_101824167 3300006931 Unclassified 672
151 Ga0097620_102010969 3300006931 Bacteria 638
152 Ga0105240_10190048 3300009093 Bacteria 2415
153 Ga0105240_10486504 3300009093 Bacteria 1375
154 Ga0105240_11129099 3300009093 Bacteria 833
155 Ga0111539_10189237 3300009094 Bacteria 2402
156 Ga0111539_10270440 3300009094 Bacteria 1978
157 Ga0105245_10231538 3300009098 Bacteria 1787
158 Ga0105245_10741266 3300009098 Bacteria 1018
159 Ga0105245_11168553 3300009098 Unclassified 817
160 Ga0105247_10926353 3300009101 Bacteria 675
161 Ga0105243_10114037 3300009148 Bacteria 2267
162 Ga0105241_10042425 3300009174 Bacteria 3442
163 Ga0105241_11140051 3300009174 Bacteria 736
164 Ga0105242_10011982 3300009176 Bacteria 6676
165 Ga0105248_10005852 3300009177 Bacteria 13514
166 Ga0105248_10048712 3300009177 Bacteria 4752
167 Ga0105248_10077509 3300009177 Bacteria 3736
168 Ga0105248_10114316 3300009177 Bacteria 3044
169 Ga0105248_10114694 3300009177 Bacteria 3039
170 Ga0105248_10704092 3300009177 Bacteria 1140
171 Ga0105237_10271522 3300009545 Bacteria 1699
172 Ga0105238_10076920 3300009551 Bacteria 3330
173 Ga0105239_10118076 3300010375 Bacteria 2944
174 Ga0105246_10368876 3300011119 Bacteria 1182
175 Ga0157373_10034072 3300013100 Bacteria 3658
176 Ga0157373_10120915 3300013100 Bacteria 1841
177 Ga0157373_10290583 3300013100 Bacteria 1159
178 Ga0157371_10066172 3300013102 Bacteria 2559
179 Ga0157371_10116050 3300013102 Bacteria 1902
180 Ga0157371_10466077 3300013102 Bacteria 930
181 Ga0157370_10019987 3300013104 Bacteria 6699
182 Ga0157370_10029290 3300013104 Bacteria 5406
183 Ga0157370_10047989 3300013104 Bacteria 4091
184 Ga0157370_10189274 3300013104 Bacteria 1910
185 Ga0157369_10072740 3300013105 Bacteria 3690
186 Ga0157369_10296184 3300013105 Bacteria 1683
187 Ga0157369_11187392 3300013105 Bacteria 779
188 Ga0157369_11273843 3300013105 Bacteria 750
189 Ga0157374_10034797 3300013296 Bacteria 4605
190 Ga0157374_10431605 3300013296 Bacteria 1317
191 Ga0157374_10478770 3300013296 Bacteria 1248
192 Ga0157378_10082425 3300013297 Bacteria 2908
193 Ga0157378_10562188 3300013297 Bacteria 1147
194 Ga0157378_10619735 3300013297 Bacteria 1095
195 Ga0157378_12586505 3300013297 Bacteria 560
196 Ga0157378_12586508 3300013297 Bacteria 560
197 Ga0163162_10031243 3300013306 Bacteria 5282
198 Ga0163162_11918357 3300013306 Unclassified 678
199 Ga0157372_10029065 3300013307 Bacteria 6031
200 Ga0157372_10279030 3300013307 Bacteria 1942
201 Ga0157372_10360689 3300013307 Bacteria 1693
202 Ga0157372_10499922 3300013307 Bacteria 1418
203 Ga0157372_10757765 3300013307 Bacteria 1129
204 Ga0157372_10937419 3300013307 Bacteria 1004
205 Ga0157375_10047602 3300013308 Bacteria 4189
206 Ga0157375_11271874 3300013308 Bacteria 864
207 Ga0163163_10014330 3300014325 Bacteria 7288
208 Ga0163163_10163520 3300014325 Bacteria 2272
209 Ga0163163_10239918 3300014325 Bacteria 1862
210 Ga0157379_10000566 3300014968 Bacteria 29886
211 Ga0157379_10092607 3300014968 Bacteria 2711
212 Ga0157379_10715718 3300014968 Bacteria 940
213 Ga0157379_10865254 3300014968 Unclassified 856
214 Ga0163161_10211298 3300017792 Bacteria 1499
215 Ga0197907_10214016 3300020069 Bacteria 811
216 Ga0197907_10662426 3300020069 Bacteria 659
217 Ga0206356_11140250 3300020070 Bacteria 2237
218 Ga0206353_10611812 3300020082 Bacteria 1662
219 Ga0206353_12045327 3300020082 Bacteria 933
220 Ga0224712_10240763 3300022467 Bacteria 833
221 Ga0207656_10049167 3300025321 Bacteria 1818
222 Ga0207680_10021777 3300025903 Bacteria 3474
223 Ga0207647_10001456 3300025904 Bacteria 18185
224 Ga0207647_10003752 3300025904 Bacteria 11357
225 Ga0207647_10022246 3300025904 Bacteria 4215
226 Ga0207647_10104312 3300025904 Bacteria 1680
227 Ga0207647_10125631 3300025904 Bacteria 1510
228 Ga0207647_10244622 3300025904 Bacteria 1030
229 Ga0207645_10042298 3300025907 Bacteria 2915
230 Ga0207705_10007023 3300025909 Bacteria 8305
231 Ga0207705_10090652 3300025909 Bacteria 2238
232 Ga0207705_10149527 3300025909 Bacteria 1749
233 Ga0207705_10197960 3300025909 Bacteria 1522
234 Ga0207654_10128453 3300025911 Bacteria 1601
235 Ga0207660_10099559 3300025917 Bacteria 2169
236 Ga0207662_10197043 3300025918 Bacteria 1302
237 Ga0207662_10260638 3300025918 Bacteria 1141
238 Ga0207657_10005366 3300025919 Bacteria 13423
239 Ga0207657_10006651 3300025919 Bacteria 11964
240 Ga0207657_10014227 3300025919 Bacteria 7777
241 Ga0207657_10154450 3300025919 Bacteria 1867
242 Ga0207657_10162024 3300025919 Bacteria 1816
243 Ga0207657_11383661 3300025919 Bacteria 529
244 Ga0207649_10047999 3300025920 Bacteria 2631
245 Ga0207649_10049588 3300025920 Bacteria 2594
246 Ga0207649_10081212 3300025920 Bacteria 2099
247 Ga0207649_10179942 3300025920 Bacteria 1479
248 Ga0207649_10319740 3300025920 Bacteria 1140
249 Ga0207649_11003012 3300025920 Unclassified 657
250 Ga0207652_10020470 3300025921 Bacteria 5447
251 Ga0207652_10862236 3300025921 Bacteria 801
252 Ga0207681_10069053 3300025923 Bacteria 2457
253 Ga0207694_10042000 3300025924 Bacteria 3525
254 Ga0207694_10642237 3300025924 Bacteria 894
255 Ga0207650_10038482 3300025925 Bacteria 3493
256 Ga0207650_10329308 3300025925 Bacteria 1252
257 Ga0207650_10867414 3300025925 Bacteria 766
258 Ga0207687_10060632 3300025927 Bacteria 2669
259 Ga0207687_10429784 3300025927 Bacteria 1091
260 Ga0207700_10006687 3300025928 Bacteria 6994
261 Ga0207644_10023487 3300025931 Bacteria 4224
262 Ga0207644_10030503 3300025931 Bacteria 3750
263 Ga0207644_10051763 3300025931 Bacteria 2948
264 Ga0207644_10095012 3300025931 Bacteria 2229
265 Ga0207644_10227310 3300025931 Bacteria 1481
266 Ga0207644_10755862 3300025931 Bacteria 812
267 Ga0207690_10004090 3300025932 Bacteria 8610
268 Ga0207690_10014291 3300025932 Bacteria 4793
269 Ga0207690_10024030 3300025932 Bacteria 3812
270 Ga0207690_10107773 3300025932 Bacteria 2001
271 Ga0207706_10018828 3300025933 Bacteria 6209
272 Ga0207706_10020154 3300025933 Bacteria 5992
273 Ga0207706_10037047 3300025933 Bacteria 4331
274 Ga0207706_10203857 3300025933 Bacteria 1734
275 Ga0207706_10315537 3300025933 Bacteria 1361
276 Ga0207706_10596494 3300025933 Bacteria 949
277 Ga0207709_10287960 3300025935 Bacteria 1216
278 Ga0207669_10448798 3300025937 Bacteria 1021
279 Ga0207704_10211789 3300025938 Bacteria 1427
280 Ga0207691_10104165 3300025940 Bacteria 2529
281 Ga0207691_10664850 3300025940 Bacteria 880
282 Ga0207691_10980604 3300025940 Bacteria 706
283 Ga0207711_10210809 3300025941 Bacteria 1774
284 Ga0207661_10017711 3300025944 Bacteria 5278
285 Ga0207679_10005439 3300025945 Bacteria 7980
286 Ga0207679_10009256 3300025945 Bacteria 6300
287 Ga0207667_10019026 3300025949 Bacteria 7677
288 Ga0207667_10024632 3300025949 Bacteria 6603
289 Ga0207667_10033960 3300025949 Bacteria 5481
290 Ga0207651_10031164 3300025960 Bacteria 3405
291 Ga0207651_10237636 3300025960 Bacteria 1483
292 Ga0207651_11171768 3300025960 Bacteria 689
293 Ga0207668_10544970 3300025972 Bacteria 1004
294 Ga0207640_10002645 3300025981 Bacteria 9593
295 Ga0207640_10125004 3300025981 Bacteria 1850
296 Ga0207640_10169216 3300025981 Bacteria 1626
297 Ga0207658_10050693 3300025986 Bacteria 3055
298 Ga0207677_10008767 3300026023 Bacteria 5666
299 Ga0207703_10003782 3300026035 Bacteria 12580
300 Ga0207639_10062353 3300026041 Bacteria 2883
301 Ga0207678_10003440 3300026067 Bacteria 14260
302 Ga0207678_10042990 3300026067 Bacteria 3911
303 Ga0207678_10120975 3300026067 Bacteria 2234
304 Ga0207678_10445739 3300026067 Bacteria 1125
305 Ga0207678_10529975 3300026067 Bacteria 1028
306 Ga0207678_11299436 3300026067 Unclassified 644
307 Ga0207702_10011823 3300026078 Bacteria 7266
308 Ga0207702_10067180 3300026078 Bacteria 3076
309 Ga0207702_10121740 3300026078 Bacteria 2336
310 Ga0207702_10191881 3300026078 Bacteria 1888
311 Ga0207702_10265203 3300026078 Bacteria 1618
312 Ga0207702_10512550 3300026078 Bacteria 1170
313 Ga0207702_10523095 3300026078 Bacteria 1158
314 Ga0207702_11274600 3300026078 Bacteria 729
315 Ga0207648_10092443 3300026089 Bacteria 2645
316 Ga0207676_10101553 3300026095 Bacteria 2385
317 Ga0207674_10000989 3300026116 Bacteria 37099
318 Ga0207674_10008766 3300026116 Bacteria 11646
319 Ga0207674_10017737 3300026116 Bacteria 7758
320 Ga0207674_10022142 3300026116 Bacteria 6830
321 Ga0207674_10034831 3300026116 Bacteria 5258
322 Ga0207674_10078508 3300026116 Bacteria 3306
323 Ga0207674_10730232 3300026116 Bacteria 956
324 Ga0207675_101166436 3300026118 Bacteria 790
325 Ga0207683_10449495 3300026121 Bacteria 1188
326 Ga0207698_10017677 3300026142 Bacteria 4845
327 Ga0207698_10026433 3300026142 Bacteria 4106
328 Ga0207698_10029784 3300026142 Bacteria 3915
329 Ga0207698_10151369 3300026142 Bacteria 2014
330 Ga0207698_10217939 3300026142 Bacteria 1722
331 Ga0207698_10302665 3300026142 Bacteria 1489
332 Ga0207698_10345998 3300026142 Bacteria 1402
333 Ga0207698_10607880 3300026142 Bacteria 1078
334 Ga0207698_11054405 3300026142 Bacteria 825
335 Ga0268266_11661689 3300028379 Bacteria 614
336 Ga0268265_10097185 3300028380 Bacteria 2369
337 Ga0268265_11356684 3300028380 Bacteria 712
338 Ga0307408_100131790 3300031548 Bacteria 1951
339 Ga0307408_100215292 3300031548 Bacteria 1564
340 Ga0307405_10133432 3300031731 Bacteria 1720
341 Ga0307405_10283649 3300031731 Bacteria 1248
342 Ga0307405_10331673 3300031731 Bacteria 1166
343 Ga0307405_10660839 3300031731 Bacteria 861
344 Ga0307413_10028008 3300031824 Bacteria 3131
345 Ga0307413_10216643 3300031824 Bacteria 1395
346 Ga0307413_10242465 3300031824 Bacteria 1332
347 Ga0307413_10318357 3300031824 Bacteria 1187
348 Ga0307410_10274950 3300031852 Unclassified 1319
349 Ga0307410_10332498 3300031852 Bacteria 1209
350 Ga0307406_10057658 3300031901 Bacteria 2492
351 Ga0307406_10077418 3300031901 Bacteria 2200
352 Ga0307406_10558206 3300031901 Bacteria 938
353 Ga0307406_10709881 3300031901 Bacteria 840
354 Ga0307406_11962372 3300031901 Bacteria 523
355 Ga0307407_10076358 3300031903 Bacteria 2011
356 Ga0307407_10111563 3300031903 Bacteria 1717
357 Ga0307412_10015503 3300031911 Bacteria 4522
358 Ga0307412_10091476 3300031911 Bacteria 2130
359 Ga0307412_10322867 3300031911 Bacteria 1229
360 Ga0307412_10995879 3300031911 Bacteria 740
361 Ga0307409_100067512 3300031995 Bacteria 2824
362 Ga0307409_100079626 3300031995 Bacteria 2641
363 Ga0307409_100101529 3300031995 Bacteria 2387
364 Ga0307409_100165365 3300031995 Bacteria 1940
365 Ga0307409_100595813 3300031995 Bacteria 1092
366 Ga0307409_100966583 3300031995 Bacteria 868
367 Ga0307416_100417791 3300032002 Bacteria 1384
368 Ga0307416_100776807 3300032002 Bacteria 1052
369 Ga0307416_101293071 3300032002 Bacteria 835
370 Ga0307416_101845467 3300032002 Bacteria 708
371 Ga0307416_101853039 3300032002 Bacteria 707
372 Ga0307414_10008811 3300032004 Bacteria 5755
373 Ga0307411_10002297 3300032005 Bacteria 8376
374 Ga0307411_10068011 3300032005 Bacteria 2399
375 Ga0307411_10520570 3300032005 Unclassified 1009
376 Ga0307411_10578674 3300032005 Bacteria 962
377 Ga0307411_11701353 3300032005 Bacteria 584
378 Ga0307415_100012445 3300032126 Bacteria 4920
379 Ga0307415_100066037 3300032126 Bacteria 2523
380 Ga0307415_100220392 3300032126 Bacteria 1520
381 Ga0307415_100405943 3300032126 Bacteria 1165
382 Ga0307415_100468526 3300032126 Bacteria 1093
383 Ga0307415_101113605 3300032126 Bacteria 740
384 Ga0307415_101541086 3300032126 Unclassified 637
385 Ga0373936_0608924 3300035113 Bacteria 513
386 Ga0373946_0039582 3300035171 Bacteria 1925
387 Ga0373935_0095563 3300035692 Bacteria 1952
388 Ga0395899_0011726 3300037312 Bacteria 6709
389 Ga0395899_0013497 3300037312 Bacteria 6244
390 Ga0395899_0013603 3300037312 Bacteria 6221
391 Ga0395899_0060893 3300037312 Bacteria 2780
392 Ga0395899_0121307 3300037312 Bacteria 1872
393 Ga0395899_0155336 3300037312 Bacteria 1619
394 Ga0395899_0165737 3300037312 Bacteria 1559
395 Ga0395899_0191735 3300037312 Bacteria 1430
396 Ga0395899_0562141 3300037312 Bacteria 732
397 Ga0395900_0009432 3300037418 Bacteria 10004
398 Ga0395900_0026028 3300037418 Bacteria 5991
399 Ga0395900_0027032 3300037418 Bacteria 5874
400 Ga0395900_0045400 3300037418 Bacteria 4526
401 Ga0395900_0048725 3300037418 Bacteria 4364
402 Ga0395900_0070642 3300037418 Bacteria 3589
403 Ga0395900_0085779 3300037418 Bacteria 3236
404 Ga0395900_0105002 3300037418 Bacteria 2902
405 Ga0395900_0141094 3300037418 Bacteria 2467
406 Ga0395900_0156941 3300037418 Bacteria 2324
407 Ga0395900_0384487 3300037418 Bacteria 1371
408 Ga0395900_0765500 3300037418 Unclassified 895
409 Ga0395900_0898224 3300037418 Bacteria 809
410 Ga0395898_0003738 3300037466 Bacteria 16877
411 Ga0395898_0007043 3300037466 Bacteria 11950
412 Ga0395898_0020871 3300037466 Bacteria 6647
413 Ga0395898_0038360 3300037466 Bacteria 4749
414 Ga0395898_0084356 3300037466 Bacteria 3062
415 Ga0395898_0122927 3300037466 Bacteria 2487
416 Ga0395898_0162886 3300037466 Bacteria 2133
417 Ga0395898_0176580 3300037466 Bacteria 2041
418 Ga0395898_0530000 3300037466 Bacteria 1119
419 Ga0395898_0610785 3300037466 Bacteria 1033
420 Ga0395898_0615347 3300037466 Bacteria 1029
421 Ga0395898_0700815 3300037466 Bacteria 954
422 Ga0395898_0919342 3300037466 Bacteria 813
423 Ga0395898_1022042 3300037466 Bacteria 762
424 Ga0395898_1124742 3300037466 Bacteria 718
425 Ga0395905_0005031 3300037471 Bacteria 13615
426 Ga0395905_0006585 3300037471 Bacteria 11667
427 Ga0395905_0009761 3300037471 Bacteria 9362
428 Ga0395905_0011160 3300037471 Bacteria 8688
429 Ga0395905_0011414 3300037471 Bacteria 8584
430 Ga0395905_0011486 3300037471 Bacteria 8558
431 Ga0395905_0013403 3300037471 Bacteria 7855
432 Ga0395905_0014495 3300037471 Bacteria 7523
433 Ga0395905_0017944 3300037471 Bacteria 6721
434 Ga0395905_0056760 3300037471 Bacteria 3662
435 Ga0395905_0060332 3300037471 Bacteria 3546
436 Ga0395905_0062156 3300037471 Bacteria 3493
437 Ga0395905_0079504 3300037471 Bacteria 3074
438 Ga0395905_0108452 3300037471 Bacteria 2606
439 Ga0395905_0109995 3300037471 Bacteria 2587
440 Ga0395905_0170512 3300037471 Bacteria 2044
441 Ga0395905_0179092 3300037471 Bacteria 1990
442 Ga0395905_0204632 3300037471 Bacteria 1850
443 Ga0395905_0300392 3300037471 Bacteria 1493
444 Ga0395905_0316103 3300037471 Bacteria 1451
445 Ga0395905_0369592 3300037471 Bacteria 1327
446 Ga0395905_0434196 3300037471 Bacteria 1210
447 Ga0395905_0449527 3300037471 Bacteria 1186
448 Ga0395905_0532259 3300037471 Unclassified 1076
449 Ga0395905_0680515 3300037471 Bacteria 931
450 Ga0395901_0000041 3300038443 Bacteria 202314
451 Ga0395901_0006129 3300038443 Bacteria 12182
452 Ga0395901_0025501 3300038443 Bacteria 6069
453 Ga0395901_0028486 3300038443 Bacteria 5743
454 Ga0395901_0031707 3300038443 Bacteria 5449
455 Ga0395901_0041794 3300038443 Bacteria 4752
456 Ga0395901_0042602 3300038443 Bacteria 4707
457 Ga0395901_0065943 3300038443 Bacteria 3771
458 Ga0395901_0093614 3300038443 Bacteria 3146
459 Ga0395901_0103396 3300038443 Bacteria 2989
460 Ga0395901_0181290 3300038443 Bacteria 2209
461 Ga0395901_0192615 3300038443 Bacteria 2138
462 Ga0395901_0199651 3300038443 Bacteria 2096
463 Ga0395901_0357201 3300038443 Bacteria 1507
464 Ga0395901_0545589 3300038443 Bacteria 1175
465 Ga0395901_0552031 3300038443 Bacteria 1167
466 Ga0395901_0678999 3300038443 Bacteria 1030
467 Ga0395901_1072812 3300038443 Bacteria 777
468 Ga0395901_1223042 3300038443 Unclassified 716
469 Ga0395901_1614585 3300038443 Bacteria 601
470 Ga0395901_2060741 3300038443 Unclassified 516
471 Ga0436365_0974222 3300039437 Bacteria 6100
472 Ga0436363_0072055 3300039450 Bacteria 3792
473 Ga0439466_0277770 3300041411 Bacteria 507
474 Ga0439465_0205227 3300041413 Bacteria 719
475 Ga0439448_0010053 3300042005 Bacteria 2796
476 Ga0439448_0131646 3300042005 Bacteria 862
477 Ga0439448_0170216 3300042005 Bacteria 760
478 Ga0439432_011188 3300042006 Bacteria 3093
479 Ga0439432_061965 3300042006 Bacteria 1152
480 Ga0439432_094081 3300042006 Bacteria 900
481 Ga0439449_0007465 3300042007 Bacteria 4155
482 Ga0439449_0245069 3300042007 Bacteria 673
483 Ga0439452_005414 3300042010 Bacteria 4109
484 Ga0439455_0028975 3300042012 Bacteria 1366
485 Ga0450912_000028 3300042116 Bacteria 4603
486 Ga0450912_005629 3300042116 Bacteria 970
487 Ga0450888_070527 3300042126 Bacteria 525
488 Ga0439458_0000134 3300042157 Bacteria 15726
489 Ga0439458_0150504 3300042157 Bacteria 623
490 Ga0466966_0168962 3300044684 Bacteria 1330
491 Ga0466966_0276202 3300044684 Unclassified 1011
492 Ga0466961_0676559 3300044693 Bacteria 619
493 Ga0466963_0009073 3300044694 Bacteria 5978
494 Ga0466963_0010787 3300044694 Bacteria 5547
495 Ga0466963_0238618 3300044694 Bacteria 1274
496 Ga0466963_0383775 3300044694 Bacteria 990
497 Ga0466963_1045399 3300044694 Unclassified 575
498 Ga0466964_0801854 3300044706 Bacteria 532
499 Ga0466971_0005034 3300044719 Bacteria 5722
500 Ga0466970_0643046 3300044765 Bacteria 617
501 Ga0466957_0025203 3300044842 Bacteria 3524
502 Ga0466960_0309470 3300044901 Bacteria 892
503 Ga0466959_0670653 3300045049 Bacteria 696
504 Ga0466958_0001013 3300045836 Bacteria 12757
505 Ga0466958_0388965 3300045836 Bacteria 900
506 Ga0466967_0014848 3300045976 Bacteria 6086
507 Ga0466967_0176515 3300045976 Bacteria 2012
508 Ga0466967_0208338 3300045976 Unclassified 1854
509 Ga0466967_0417327 3300045976 Bacteria 1307
510 Ga0466967_0535652 3300045976 Bacteria 1152
511 Ga0466967_1468961 3300045976 Bacteria 679
512 Ga0466967_1790043 3300045976 Bacteria 611
513 Ga0495585_0105634 3300046492 Bacteria 1502
514 Ga0495620_0016621 3300046515 Bacteria 3686
515 Ga0495663_0185163 3300046525 Bacteria 722
516 Ga0495642_0051836 3300046528 Bacteria 1689
517 Ga0495621_0007431 3300046539 Bacteria 3245
518 Ga0495621_0029625 3300046539 Bacteria 1867
519 Ga0495668_0047202 3300046616 Bacteria 2391
520 Ga0495659_0008679 3300046664 Bacteria 3237
521 Ga0495659_0011989 3300046664 Bacteria 2799
522 Ga0495647_0375522 3300046681 Unclassified 650
523 Ga0495669_0056179 3300046684 Bacteria 1774
524 Ga0495670_0004875 3300046691 Bacteria 6589
525 Ga0495670_0348211 3300046691 Bacteria 797
526 Ga0495670_0370262 3300046691 Bacteria 772
527 Ga0495636_0045267 3300047318 Bacteria 1834
528 Ga0495636_0082563 3300047318 Bacteria 1386
529 Ga0495593_0615863 3300047673 Unclassified 545
530 Ga0496100_0001921 3300048903 Bacteria 10394
531 Ga0496101_0001636 3300048904 Bacteria 13428
532 Ga0496102_0025508 3300048905 Bacteria 5263
533 Ga0496102_0406322 3300048905 Bacteria 1280
534 Ga0496103_0068455 3300048906 Bacteria 2218
535 Ga0496104_0144346 3300048907 Bacteria 2286
536 Ga0496105_0123655 3300048908 Bacteria 2133
537 Ga0496105_0174410 3300048908 Bacteria 1762
538 Ga0496105_0335585 3300048908 Bacteria 1209
539 Ga0496106_0033676 3300048909 Bacteria 3823
540 Ga0496106_1046179 3300048909 Bacteria 641
541 Ga0496107_0001926 3300048910 Bacteria 13168
542 Ga0496108_0003385 3300048911 Bacteria 12802
543 Ga0496108_0029204 3300048911 Bacteria 4565
544 Ga0496108_0030080 3300048911 Bacteria 4501
545 Ga0496109_0014792 3300048912 Bacteria 6789
546 Ga0496109_0026969 3300048912 Bacteria 5124
547 Ga0496109_0211076 3300048912 Bacteria 1826
548 Ga0496109_1186006 3300048912 Bacteria 700
549 Ga0496109_1367306 3300048912 Bacteria 644
550 Ga0496110_0005219 3300048913 Bacteria 10162
551 Ga0496110_0040696 3300048913 Bacteria 4051
552 Ga0496110_0043337 3300048913 Bacteria 3929
553 Ga0496110_0159267 3300048913 Bacteria 2046
554 Ga0496111_0013148 3300048914 Bacteria 5625
555 Ga0496111_0016288 3300048914 Bacteria 5118
556 Ga0496111_0169248 3300048914 Bacteria 1623
557 Ga0496111_1021411 3300048914 Bacteria 592
558 Ga0496112_0026923 3300048915 Bacteria 5541
559 Ga0496112_0034921 3300048915 Bacteria 4893
560 Ga0496112_0062833 3300048915 Bacteria 3663
561 Ga0496112_0083280 3300048915 Bacteria 3163
562 Ga0496112_0734679 3300048915 Bacteria 914
563 Ga0496113_0005222 3300048916 Bacteria 8082
564 Ga0496113_0072981 3300048916 Bacteria 2613
565 Ga0496113_0790220 3300048916 Unclassified 754
566 Ga0496114_0768530 3300048917 Bacteria 841
567 Ga0501207_027760 3300049654 Bacteria 939
568 Ga0501209_211445 3300049656 Unclassified 599
569 Ga0501223_120030 3300049663 Bacteria 555
570 Ga0501224_017017 3300049664 Bacteria 1080
571 Ga0501230_024739 3300049667 Bacteria 1078
572 Ga0501233_013260 3300049668 Bacteria 1668
573 Ga0501239_035848 3300049672 Bacteria 669
574 Ga0501256_013233 3300049685 Bacteria 811
575 Ga0501257_020947 3300049686 Bacteria 1539
576 Ga0501258_002295 3300049687 Bacteria 1666
577 Ga0501221_009050 3300049704 Bacteria 1742
578 Ga0501262_005442 3300049759 Bacteria 1504
579 Ga0501263_012583 3300049760 Bacteria 1063
580 Ga0501268_080757 3300049765 Unclassified 671
581 Ga0501279_032053 3300049775 Bacteria 782
582 Ga0501283_027228 3300049779 Bacteria 944
583 nmdc:mga0n895_1617483_c1 3300050512 Bacteria 612
584 nmdc:mga0rr50_1190650_c1 3300050513 Bacteria 647
585 Ga0590071_022025 3300059421 Bacteria 1504
586 Ga0590075_065965 3300059424 Bacteria 934
587 Ga0466962_0002264 3300061719 Bacteria 9123
588 Ga0307405_10422002
589 JGI24740J21852_10006499
590 JGI24737J22298_10002565
591 Ga0070658_10006628
592 Ga0070658_10014846
593 Ga0070658_10096061
594 Ga0070658_10123322
595 Ga0070658_10278496
596 Ga0070658_10517866
597 Ga0070676_10209739
598 Ga0070683_100013929
599 Ga0070683_100022108
600 Ga0070690_100002246
601 Ga0070670_100044551
602 Ga0070670_100152474
603 Ga0070666_10003379
604 Ga0070666_10004591
605 Ga0070666_10007248
606 Ga0070680_100016156
607 Ga0070680_101137641
608 Ga0070680_101854154
609 Ga0070682_100004662
610 Ga0070682_100169427
611 Ga0070682_101231761
612 Ga0068868_100013572
613 Ga0068868_100346972
614 Ga0068868_100605792
615 Ga0070660_100297179
616 Ga0070689_101942367
617 Ga0070691_10000817
618 Ga0070687_100908194
619 Ga0070661_100018334
620 Ga0070661_100071316
621 Ga0070661_100137714
622 Ga0070661_100169778
623 Ga0070661_100173892
624 Ga0070668_100179721
625 Ga0070668_100970767
626 Ga0070668_101145486
627 Ga0070671_100024194
628 Ga0070671_100031476
629 Ga0070671_100121174
630 Ga0070674_100015687
631 Ga0070674_100250086
632 Ga0070673_100011040
633 Ga0070673_100139748
634 Ga0070673_100388199
635 Ga0070673_100663368
636 Ga0070673_100709144
637 Ga0070659_100019271
638 Ga0070659_100065013
639 Ga0070659_100088628
640 Ga0070659_100323878
641 Ga0070659_100939462
642 Ga0070659_100999973
643 Ga0070659_101305241
644 Ga0070667_100001244
645 Ga0070667_102319947
646 Ga0070713_100022716
647 Ga0070663_100057098
648 Ga0070663_100322954
649 Ga0070663_100680404
650 Ga0070663_100778995
651 Ga0070663_101046548
652 Ga0070678_100010809
653 Ga0070678_100235389
654 Ga0070678_100307602
655 Ga0070662_100015985
656 Ga0070662_100032141
657 Ga0070662_100120067
658 Ga0070662_100156148
659 Ga0070662_100326179
660 Ga0070662_100690348
661 Ga0070662_101039975
662 Ga0070662_101105317
663 Ga0070681_10043394
664 Ga0068867_100026383
665 Ga0068867_100102815
666 Ga0070679_100011120
667 Ga0070679_100261142
668 Ga0070684_100007495
669 Ga0070684_100034981
670 Ga0068853_100144170
671 Ga0068853_100479099
672 Ga0068853_101817368
673 Ga0070672_100093113
674 Ga0070672_100487865
675 Ga0070686_100009751
676 Ga0070686_100413420
677 Ga0070693_100136629
678 Ga0070693_101040817
679 Ga0070665_101036671
680 Ga0068855_100675763
681 Ga0070664_100002139
682 Ga0070664_100036427
683 Ga0070664_100129993
684 Ga0070664_100706371
685 Ga0068857_100007325
686 Ga0068857_100057551
687 Ga0068857_100137680
688 Ga0068857_100185116
689 Ga0068854_100007384
690 Ga0068854_100024104
691 Ga0068854_100181086
692 Ga0068854_100849865
693 Ga0068854_100949854
694 Ga0068856_100054426
695 Ga0068856_100076496
696 Ga0068856_100131507
697 Ga0068856_100224970
698 Ga0068856_100340727
699 Ga0068856_100367906
700 Ga0068856_101166898
701 Ga0068856_101778358
702 Ga0068852_100008892
703 Ga0068852_100144153
704 Ga0068852_100271947
705 Ga0068852_100381085
706 Ga0068852_100407507
707 Ga0068852_100448673
708 Ga0068852_100591782
709 Ga0068852_100618715
710 Ga0068852_101378887
711 Ga0068859_100038581
712 Ga0068859_100229047
713 Ga0068859_101823964
714 Ga0068859_102009868
715 Ga0068864_100007944
716 Ga0068861_100626286
717 Ga0068861_102258386
718 Ga0068851_10013181
719 Ga0068851_10190458
720 Ga0068863_100004490
721 Ga0068863_100006550
722 Ga0068858_100061299
723 Ga0068858_100233048
724 Ga0068860_100305004
725 Ga0068862_100489103
726 Ga0068862_100553292
727 Ga0070717_10003959
728 Ga0097621_100123729
729 Ga0097621_100262362
730 Ga0068871_100045973
731 Ga0068871_100991745
732 Ga0075431_101088464
733 Ga0075434_100701488
734 Ga0075434_101837132
735 Ga0097620_100038582
736 Ga0097620_100229051
737 Ga0097620_101824167
738 Ga0097620_102010969
739 Ga0105240_10190048
740 Ga0105240_10486504
741 Ga0105240_11129099
742 Ga0111539_10189237
743 Ga0111539_10270440
744 Ga0105245_10231538
745 Ga0105245_10741266
746 Ga0105245_11168553
747 Ga0105247_10926353
748 Ga0105243_10114037
749 Ga0105241_10042425
750 Ga0105241_11140051
751 Ga0105242_10011982
752 Ga0105248_10005852
753 Ga0105248_10048712
754 Ga0105248_10077509
755 Ga0105248_10114316
756 Ga0105248_10114694
757 Ga0105248_10704092
758 Ga0105237_10271522
759 Ga0105238_10076920
760 Ga0105239_10118076
761 Ga0105246_10368876
762 Ga0157373_10034072
763 Ga0157373_10120915
764 Ga0157373_10290583
765 Ga0157371_10066172
766 Ga0157371_10116050
767 Ga0157371_10466077
768 Ga0157370_10019987
769 Ga0157370_10029290
770 Ga0157370_10047989
771 Ga0157370_10189274
772 Ga0157369_10072740
773 Ga0157369_10296184
774 Ga0157369_11187392
775 Ga0157369_11273843
776 Ga0157374_10034797
777 Ga0157374_10431605
778 Ga0157374_10478770
779 Ga0157378_10082425
780 Ga0157378_10562188
781 Ga0157378_10619735
782 Ga0157378_12586505
783 Ga0157378_12586508
784 Ga0163162_10031243
785 Ga0163162_11918357
786 Ga0157372_10029065
787 Ga0157372_10279030
788 Ga0157372_10360689
789 Ga0157372_10499922
790 Ga0157372_10757765
791 Ga0157372_10937419
792 Ga0157375_10047602
793 Ga0157375_11271874
794 Ga0163163_10014330
795 Ga0163163_10163520
796 Ga0163163_10239918
797 Ga0157379_10000566
798 Ga0157379_10092607
799 Ga0157379_10715718
800 Ga0157379_10865254
801 Ga0163161_10211298
802 Ga0197907_10214016
803 Ga0197907_10662426
804 Ga0206356_11140250
805 Ga0206353_10611812
806 Ga0206353_12045327
807 Ga0224712_10240763
808 Ga0207656_10049167
809 Ga0207680_10021777
810 Ga0207647_10001456
811 Ga0207647_10003752
812 Ga0207647_10022246
813 Ga0207647_10104312
814 Ga0207647_10125631
815 Ga0207647_10244622
816 Ga0207645_10042298
817 Ga0207705_10007023
818 Ga0207705_10090652
819 Ga0207705_10149527
820 Ga0207705_10197960
821 Ga0207654_10128453
822 Ga0207660_10099559
823 Ga0207662_10197043
824 Ga0207662_10260638
825 Ga0207657_10005366
826 Ga0207657_10006651
827 Ga0207657_10014227
828 Ga0207657_10154450
829 Ga0207657_10162024
830 Ga0207657_11383661
831 Ga0207649_10047999
832 Ga0207649_10049588
833 Ga0207649_10081212
834 Ga0207649_10179942
835 Ga0207649_10319740
836 Ga0207649_11003012
837 Ga0207652_10020470
838 Ga0207652_10862236
839 Ga0207681_10069053
840 Ga0207694_10042000
841 Ga0207694_10642237
842 Ga0207650_10038482
843 Ga0207650_10329308
844 Ga0207650_10867414
845 Ga0207687_10060632
846 Ga0207687_10429784
847 Ga0207700_10006687
848 Ga0207644_10023487
849 Ga0207644_10030503
850 Ga0207644_10051763
851 Ga0207644_10095012
852 Ga0207644_10227310
853 Ga0207644_10755862
854 Ga0207690_10004090
855 Ga0207690_10014291
856 Ga0207690_10024030
857 Ga0207690_10107773
858 Ga0207706_10018828
859 Ga0207706_10020154
860 Ga0207706_10037047
861 Ga0207706_10203857
862 Ga0207706_10315537
863 Ga0207706_10596494
864 Ga0207709_10287960
865 Ga0207669_10448798
866 Ga0207704_10211789
867 Ga0207691_10104165
868 Ga0207691_10664850
869 Ga0207691_10980604
870 Ga0207711_10210809
871 Ga0207661_10017711
872 Ga0207679_10005439
873 Ga0207679_10009256
874 Ga0207667_10019026
875 Ga0207667_10024632
876 Ga0207667_10033960
877 Ga0207651_10031164
878 Ga0207651_10237636
879 Ga0207651_11171768
880 Ga0207668_10544970
881 Ga0207640_10002645
882 Ga0207640_10125004
883 Ga0207640_10169216
884 Ga0207658_10050693
885 Ga0207677_10008767
886 Ga0207703_10003782
887 Ga0207639_10062353
888 Ga0207678_10003440
889 Ga0207678_10042990
890 Ga0207678_10120975
891 Ga0207678_10445739
892 Ga0207678_10529975
893 Ga0207678_11299436
894 Ga0207702_10011823
895 Ga0207702_10067180
896 Ga0207702_10121740
897 Ga0207702_10191881
898 Ga0207702_10265203
899 Ga0207702_10512550
900 Ga0207702_10523095
901 Ga0207702_11274600
902 Ga0207648_10092443
903 Ga0207676_10101553
904 Ga0207674_10000989
905 Ga0207674_10008766
906 Ga0207674_10017737
907 Ga0207674_10022142
908 Ga0207674_10034831
909 Ga0207674_10078508
910 Ga0207674_10730232
911 Ga0207675_101166436
912 Ga0207683_10449495
913 Ga0207698_10017677
914 Ga0207698_10026433
915 Ga0207698_10029784
916 Ga0207698_10151369
917 Ga0207698_10217939
918 Ga0207698_10302665
919 Ga0207698_10345998
920 Ga0207698_10607880
921 Ga0207698_11054405
922 Ga0268266_11661689
923 Ga0268265_10097185
924 Ga0268265_11356684
925 Ga0307408_100131790
926 Ga0307408_100215292
927 Ga0307405_10133432
928 Ga0307405_10283649
929 Ga0307405_10331673
930 Ga0307405_10660839
931 Ga0307413_10028008
932 Ga0307413_10216643
933 Ga0307413_10242465
934 Ga0307413_10318357
935 Ga0307410_10274950
936 Ga0307410_10332498
937 Ga0307406_10057658
938 Ga0307406_10077418
939 Ga0307406_10558206
940 Ga0307406_10709881
941 Ga0307406_11962372
942 Ga0307407_10076358
943 Ga0307407_10111563
944 Ga0307412_10015503
945 Ga0307412_10091476
946 Ga0307412_10322867
947 Ga0307412_10995879
948 Ga0307409_100067512
949 Ga0307409_100079626
950 Ga0307409_100101529
951 Ga0307409_100165365
952 Ga0307409_100595813
953 Ga0307409_100966583
954 Ga0307416_100417791
955 Ga0307416_100776807
956 Ga0307416_101293071
957 Ga0307416_101845467
958 Ga0307416_101853039
959 Ga0307414_10008811
960 Ga0307411_10002297
961 Ga0307411_10068011
962 Ga0307411_10520570
963 Ga0307411_10578674
964 Ga0307411_11701353
965 Ga0307415_100012445
966 Ga0307415_100066037
967 Ga0307415_100220392
968 Ga0307415_100405943
969 Ga0307415_100468526
970 Ga0307415_101113605
971 Ga0307415_101541086
972 Ga0373936_0608924
973 Ga0373946_0039582
974 Ga0373935_0095563
975 Ga0395899_0011726
976 Ga0395899_0013497
977 Ga0395899_0013603
978 Ga0395899_0060893
979 Ga0395899_0121307
980 Ga0395899_0155336
981 Ga0395899_0165737
982 Ga0395899_0191735
983 Ga0395899_0562141
984 Ga0395900_0009432
985 Ga0395900_0026028
986 Ga0395900_0027032
987 Ga0395900_0045400
988 Ga0395900_0048725
989 Ga0395900_0070642
990 Ga0395900_0085779
991 Ga0395900_0105002
992 Ga0395900_0141094
993 Ga0395900_0156941
994 Ga0395900_0384487
995 Ga0395900_0765500
996 Ga0395900_0898224
997 Ga0395898_0003738
998 Ga0395898_0007043
999 Ga0395898_0020871
1000 Ga0395898_0038360
1001 Ga0395898_0084356
1002 Ga0395898_0122927
1003 Ga0395898_0162886
1004 Ga0395898_0176580
1005 Ga0395898_0530000
1006 Ga0395898_0610785
1007 Ga0395898_0615347
1008 Ga0395898_0700815
1009 Ga0395898_0919342
1010 Ga0395898_1022042
1011 Ga0395898_1124742
1012 Ga0395905_0005031
1013 Ga0395905_0006585
1014 Ga0395905_0009761
1015 Ga0395905_0011160
1016 Ga0395905_0011414
1017 Ga0395905_0011486
1018 Ga0395905_0013403
1019 Ga0395905_0014495
1020 Ga0395905_0017944
1021 Ga0395905_0056760
1022 Ga0395905_0060332
1023 Ga0395905_0062156
1024 Ga0395905_0079504
1025 Ga0395905_0108452
1026 Ga0395905_0109995
1027 Ga0395905_0170512
1028 Ga0395905_0179092
1029 Ga0395905_0204632
1030 Ga0395905_0300392
1031 Ga0395905_0316103
1032 Ga0395905_0369592
1033 Ga0395905_0434196
1034 Ga0395905_0449527
1035 Ga0395905_0532259
1036 Ga0395905_0680515
1037 Ga0395901_0000041
1038 Ga0395901_0006129
1039 Ga0395901_0025501
1040 Ga0395901_0028486
1041 Ga0395901_0031707
1042 Ga0395901_0041794
1043 Ga0395901_0042602
1044 Ga0395901_0065943
1045 Ga0395901_0093614
1046 Ga0395901_0103396
1047 Ga0395901_0181290
1048 Ga0395901_0192615
1049 Ga0395901_0199651
1050 Ga0395901_0357201
1051 Ga0395901_0545589
1052 Ga0395901_0552031
1053 Ga0395901_0678999
1054 Ga0395901_1072812
1055 Ga0395901_1223042
1056 Ga0395901_1614585
1057 Ga0395901_2060741
1058 Ga0436365_0974222
1059 Ga0436363_0072055
1060 Ga0439466_0277770
1061 Ga0439465_0205227
1062 Ga0439448_0010053
1063 Ga0439448_0131646
1064 Ga0439448_0170216
1065 Ga0439432_011188
1066 Ga0439432_061965
1067 Ga0439432_094081
1068 Ga0439449_0007465
1069 Ga0439449_0245069
1070 Ga0439452_005414
1071 Ga0439455_0028975
1072 Ga0450912_000028
1073 Ga0450912_005629
1074 Ga0450888_070527
1075 Ga0439458_0000134
1076 Ga0439458_0150504
1077 Ga0466966_0168962
1078 Ga0466966_0276202
1079 Ga0466961_0676559
1080 Ga0466963_0009073
1081 Ga0466963_0010787
1082 Ga0466963_0238618
1083 Ga0466963_0383775
1084 Ga0466963_1045399
1085 Ga0466964_0801854
1086 Ga0466971_0005034
1087 Ga0466970_0643046
1088 Ga0466957_0025203
1089 Ga0466960_0309470
1090 Ga0466959_0670653
1091 Ga0466958_0001013
1092 Ga0466958_0388965
1093 Ga0466967_0014848
1094 Ga0466967_0176515
1095 Ga0466967_0208338
1096 Ga0466967_0417327
1097 Ga0466967_0535652
1098 Ga0466967_1468961
1099 Ga0466967_1790043
1100 Ga0495585_0105634
1101 Ga0495620_0016621
1102 Ga0495663_0185163
1103 Ga0495642_0051836
1104 Ga0495621_0007431
1105 Ga0495621_0029625
1106 Ga0495668_0047202
1107 Ga0495659_0008679
1108 Ga0495659_0011989
1109 Ga0495647_0375522
1110 Ga0495669_0056179
1111 Ga0495670_0004875
1112 Ga0495670_0348211
1113 Ga0495670_0370262
1114 Ga0495636_0045267
1115 Ga0495636_0082563
1116 Ga0495593_0615863
1117 Ga0496100_0001921
1118 Ga0496101_0001636
1119 Ga0496102_0025508
1120 Ga0496102_0406322
1121 Ga0496103_0068455
1122 Ga0496104_0144346
1123 Ga0496105_0123655
1124 Ga0496105_0174410
1125 Ga0496105_0335585
1126 Ga0496106_0033676
1127 Ga0496106_1046179
1128 Ga0496107_0001926
1129 Ga0496108_0003385
1130 Ga0496108_0029204
1131 Ga0496108_0030080
1132 Ga0496109_0014792
1133 Ga0496109_0026969
1134 Ga0496109_0211076
1135 Ga0496109_1186006
1136 Ga0496109_1367306
1137 Ga0496110_0005219
1138 Ga0496110_0040696
1139 Ga0496110_0043337
1140 Ga0496110_0159267
1141 Ga0496111_0013148
1142 Ga0496111_0016288
1143 Ga0496111_0169248
1144 Ga0496111_1021411
1145 Ga0496112_0026923
1146 Ga0496112_0034921
1147 Ga0496112_0062833
1148 Ga0496112_0083280
1149 Ga0496112_0734679
1150 Ga0496113_0005222
1151 Ga0496113_0072981
1152 Ga0496113_0790220
1153 Ga0496114_0768530
1154 Ga0501207_027760
1155 Ga0501209_211445
1156 Ga0501223_120030
1157 Ga0501224_017017
1158 Ga0501230_024739
1159 Ga0501233_013260
1160 Ga0501239_035848
1161 Ga0501256_013233
1162 Ga0501257_020947
1163 Ga0501258_002295
1164 Ga0501221_009050
1165 Ga0501262_005442
1166 Ga0501263_012583
1167 Ga0501268_080757
1168 Ga0501279_032053
1169 Ga0501283_027228
1170 nmdc:mga0n895_1617483_c1
1171 nmdc:mga0rr50_1190650_c1
1172 Ga0590071_022025
1173 Ga0590075_065965
1174 Ga0466962_0002264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07370

DUF1489

Protein of unknown function (DUF1489)

22

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v47-assembly1.cif.gz_A crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.6233 32 92
8a8d-assembly1.cif.gz_B atp sulfurylase from methanothermococcus thermolithotrophicus - monoclinic form 0.6005 47 92
8a8d-assembly1.cif.gz_A atp sulfurylase from methanothermococcus thermolithotrophicus - monoclinic form 0.5911 47 92
1v47-assembly1.cif.gz_B crystal structure of atp sulfurylase from thermus thermophillus hb8 in complex with aps 0.5843 32 92
3iyq-assembly1.cif.gz_B tmrna-smpb: a journey to the center of the bacterial ribosome 0.5647 61 86
ID Description Score Start End Superfamily
af_Q58168_23_157_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.6821 63 80 3.30.1380.20
af_Q54TH6_325_411_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6605 63 80 3.30.200.20
af_Q03957_171_264_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.644 63 80 3.30.200.20
af_Q9N5K0_204_324_3.30.70.960 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SEA domain 0.638 61 88 3.30.70.960
af_Q54D75_4_80_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.627 63 80 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A2W5APN5-F1-model_v4 DUF1489 domain-containing protein 0.9476 1 87
AF-A0A2W5APN5-F1-model_v4 DUF1489 domain-containing protein 0.9372 1 87
AF-A0A2R7IW93-F1-model_v4 DUF1489 domain-containing protein 0.9334 3 107
AF-A0A3B9BGW1-F1-model_v4 DUF1489 domain-containing protein 0.9208 3 107
AF-A0A6A4U4Y7-F1-model_v4 DUF1489 domain-containing protein 0.9072 1 108

Map