F466669

General Info

Members Datasets Scaffolds Average Seq Length
587 279 1174 157

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10687606|Ga0105246_106876061
Length 164
Sequence VAAELPVTILAGELRAHAGARFAIIASRWNPGIVDALIEGARRAFAAHGVADAALDVVRVPGAWEIPLAASRAASGYAAIIALGCVVRGETRHFDHVADECARGLMRVALDTGVPVLNGVLAVERHEHAKARAGGAHGNKGEEVALAAMEIVDLLKKVPVARPA

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
147 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
148 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
249 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
254 2643221559 Lysobacter sp. Root559 Isolate Unclassified
255 2643221573 Lysobacter sp. Root604 Isolate Unclassified
256 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
257 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
258 2643221586 Lysobacter sp. Root667 Isolate Unclassified
259 2643221612 Lysobacter sp. Root76 Isolate Unclassified
260 2643221695 Lysobacter sp. Root494 Isolate Unclassified
261 2643221720 Lysobacter sp. Root916 Isolate Unclassified
262 2643221727 Lysobacter sp. Root96 Isolate Unclassified
263 2643221728 Lysobacter sp. Root983 Isolate Unclassified
264 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
265 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
266 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
267 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
268 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
269 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
270 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
271 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
272 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
273 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
274 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
275 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
276 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
277 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
278 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
279 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.23
Metatranscriptomes 0.17
Isolates 4.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 11.58
Nodule 0.17
Rhizoplane 1.36
Rhizosphere 77.34
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10687606 3300011119 Bacteria 895
2 JGI24741J21665_1002712 3300001915 Bacteria 4500
3 rootL2_10062548 3300003322 Bacteria 2050
4 Ga0055526_1000005 3300003771 Bacteria 344542
5 Ga0055526_1002233 3300003771 Bacteria 13264
6 Ga0055537_1000288 3300003773 Bacteria 35795
7 Ga0055537_1001737 3300003773 Bacteria 8041
8 Ga0055537_1002054 3300003773 Bacteria 7092
9 Ga0055524_1000005 3300003775 Bacteria 344542
10 Ga0055524_1004724 3300003775 Bacteria 6240
11 Ga0055536_1001397 3300003781 Bacteria 14601
12 Ga0055536_1002130 3300003781 Bacteria 11268
13 Ga0055536_1003244 3300003781 Bacteria 8810
14 Ga0055536_1007869 3300003781 Bacteria 4687
15 Ga0055534_1000002 3300003784 Bacteria 390762
16 Ga0055534_1001086 3300003784 Bacteria 11648
17 Ga0055528_1000002 3300003790 Bacteria 368879
18 Ga0055528_1001584 3300003790 Bacteria 13495
19 Ga0055530_10001810 3300003791 Bacteria 14821
20 Ga0055530_10002674 3300003791 Bacteria 11111
21 Ga0055530_10007278 3300003791 Bacteria 4697
22 Ga0055540_1017257 3300003792 Bacteria 2020
23 Ga0055531_10002857 3300003794 Bacteria 11263
24 Ga0055531_10021694 3300003794 Bacteria 2480
25 Ga0070658_10057638 3300005327 Bacteria 3160
26 Ga0070676_10528254 3300005328 Bacteria 842
27 Ga0070683_100142437 3300005329 Bacteria 2271
28 Ga0070690_101167641 3300005330 Bacteria 613
29 Ga0068869_100686999 3300005334 Bacteria 872
30 Ga0070666_10000487 3300005335 Bacteria 23992
31 Ga0070666_10796171 3300005335 Bacteria 696
32 Ga0070680_100000582 3300005336 Bacteria 25199
33 Ga0070680_100568292 3300005336 Bacteria 972
34 Ga0070682_100757472 3300005337 Bacteria 784
35 Ga0070660_100080578 3300005339 Bacteria 2555
36 Ga0070661_100137980 3300005344 Bacteria 1836
37 Ga0070668_100142822 3300005347 Bacteria 1930
38 Ga0070668_100186094 3300005347 Bacteria 1698
39 Ga0070668_100557435 3300005347 Bacteria 998
40 Ga0070669_100148290 3300005353 Bacteria 1814
41 Ga0070671_100031400 3300005355 Bacteria 4387
42 Ga0070673_100433739 3300005364 Bacteria 1180
43 Ga0070659_100058492 3300005366 Bacteria 3042
44 Ga0070659_100194822 3300005366 Bacteria 1666
45 Ga0070659_100424645 3300005366 Bacteria 1125
46 Ga0070667_100231233 3300005367 Bacteria 1648
47 Ga0070667_100244360 3300005367 Bacteria 1603
48 Ga0070709_10024435 3300005434 Bacteria 3557
49 Ga0070709_10297833 3300005434 Bacteria 1177
50 Ga0070713_100533431 3300005436 Bacteria 1110
51 Ga0070711_100719187 3300005439 Bacteria 842
52 Ga0070663_100028812 3300005455 Bacteria 3786
53 Ga0070663_100053496 3300005455 Bacteria 2882
54 Ga0070663_101108360 3300005455 Bacteria 692
55 Ga0070662_100696018 3300005457 Bacteria 860
56 Ga0070681_10003299 3300005458 Bacteria 15068
57 Ga0070681_10128599 3300005458 Bacteria 2465
58 Ga0068867_100068420 3300005459 Bacteria 2650
59 Ga0070679_100003151 3300005530 Bacteria 15068
60 Ga0070679_100697750 3300005530 Bacteria 958
61 Ga0070684_100089335 3300005535 Bacteria 2738
62 Ga0068853_100016385 3300005539 Bacteria 6099
63 Ga0068853_100053738 3300005539 Bacteria 3469
64 Ga0068853_100218568 3300005539 Bacteria 1739
65 Ga0068853_100771040 3300005539 Bacteria 920
66 Ga0070672_101062330 3300005543 Bacteria 719
67 Ga0070696_100019620 3300005546 Bacteria 4581
68 Ga0070665_100000092 3300005548 Bacteria 174397
69 Ga0068855_100066164 3300005563 Bacteria 4213
70 Ga0068855_100804432 3300005563 Bacteria 999
71 Ga0068855_101362137 3300005563 Bacteria 732
72 Ga0070664_100128266 3300005564 Bacteria 2226
73 Ga0068857_100038503 3300005577 Bacteria 4235
74 Ga0068857_100209905 3300005577 Bacteria 1777
75 Ga0068857_100226826 3300005577 Bacteria 1707
76 Ga0068854_100030061 3300005578 Bacteria 3765
77 Ga0068854_100210651 3300005578 Bacteria 1533
78 Ga0068854_100512631 3300005578 Bacteria 1012
79 Ga0068856_100121458 3300005614 Bacteria 2614
80 Ga0068856_100161443 3300005614 Bacteria 2251
81 Ga0068852_100042035 3300005616 Bacteria 3868
82 Ga0068852_100075304 3300005616 Bacteria 2977
83 Ga0068852_100178626 3300005616 Bacteria 1994
84 Ga0068852_100268916 3300005616 Bacteria 1639
85 Ga0068859_100665524 3300005617 Bacteria 1133
86 Ga0068859_100667523 3300005617 Bacteria 1131
87 Ga0068864_100004209 3300005618 Bacteria 11834
88 Ga0068864_100111094 3300005618 Bacteria 2442
89 Ga0068864_100211538 3300005618 Bacteria 1786
90 Ga0068851_10019388 3300005834 Bacteria 3286
91 Ga0068863_100006254 3300005841 Bacteria 11695
92 Ga0068863_100173587 3300005841 Bacteria 2068
93 Ga0068863_100192490 3300005841 Bacteria 1960
94 Ga0068858_100288904 3300005842 Bacteria 1563
95 Ga0068860_100017401 3300005843 Bacteria 7003
96 Ga0068860_100270877 3300005843 Bacteria 1657
97 Ga0068860_100912179 3300005843 Bacteria 895
98 Ga0068862_100437022 3300005844 Bacteria 1231
99 Ga0075368_10393426 3300006042 Bacteria 608
100 Ga0075364_10044264 3300006051 Bacteria 2895
101 Ga0075367_10005201 3300006178 Bacteria 6433
102 Ga0097621_100180729 3300006237 Bacteria 1823
103 Ga0097621_100937885 3300006237 Unclassified 807
104 Ga0097621_101366427 3300006237 Bacteria 670
105 Ga0068871_100040170 3300006358 Bacteria 3747
106 Ga0068871_100065158 3300006358 Bacteria 2984
107 Ga0068871_100231117 3300006358 Bacteria 1605
108 Ga0068871_100248883 3300006358 Bacteria 1547
109 Ga0068871_100522659 3300006358 Bacteria 1072
110 Ga0068871_100808254 3300006358 Bacteria 865
111 Ga0068871_101688111 3300006358 Bacteria 600
112 Ga0068865_100004889 3300006881 Bacteria 8101
113 Ga0097620_100665493 3300006931 Bacteria 1133
114 Ga0097620_100667404 3300006931 Bacteria 1131
115 Ga0099826_10191757 3300006948 Bacteria 1127
116 Ga0105251_10006537 3300009011 Bacteria 7395
117 Ga0105244_10158075 3300009036 Bacteria 1083
118 Ga0105240_10040352 3300009093 Bacteria 5971
119 Ga0105240_10092747 3300009093 Bacteria 3687
120 Ga0105240_10152926 3300009093 Bacteria 2746
121 Ga0105240_10880220 3300009093 Bacteria 965
122 Ga0105245_10039307 3300009098 Bacteria 4211
123 Ga0105245_10286466 3300009098 Bacteria 1612
124 Ga0105245_10467241 3300009098 Bacteria 1273
125 Ga0105245_10912161 3300009098 Bacteria 920
126 Ga0105241_10021278 3300009174 Bacteria 4793
127 Ga0105241_10094532 3300009174 Bacteria 2364
128 Ga0105241_10340325 3300009174 Bacteria 1299
129 Ga0105241_10642918 3300009174 Bacteria 963
130 Ga0105242_10012218 3300009176 Bacteria 6610
131 Ga0105237_10155336 3300009545 Bacteria 2284
132 Ga0105237_11023099 3300009545 Bacteria 833
133 Ga0105237_11074482 3300009545 Bacteria 812
134 Ga0105238_10046014 3300009551 Bacteria 4407
135 Ga0105238_10049996 3300009551 Bacteria 4209
136 Ga0105238_10138581 3300009551 Bacteria 2410
137 Ga0105238_10659351 3300009551 Bacteria 1057
138 Ga0105239_10050230 3300010375 Bacteria 4575
139 Ga0105239_10073582 3300010375 Bacteria 3756
140 Ga0105239_10761847 3300010375 Bacteria 1108
141 Ga0105239_11848295 3300010375 Bacteria 700
142 Ga0105246_10011815 3300011119 Bacteria 5427
143 Ga0157373_10006648 3300013100 Bacteria 8613
144 Ga0157370_10001293 3300013104 Bacteria 31203
145 Ga0157370_10002303 3300013104 Bacteria 23111
146 Ga0157370_10519422 3300013104 Bacteria 1093
147 Ga0157370_10645111 3300013104 Bacteria 968
148 Ga0157369_10000001 3300013105 Bacteria 554908
149 Ga0157369_10124679 3300013105 Bacteria 2732
150 Ga0157369_10264932 3300013105 Bacteria 1792
151 Ga0157369_10631295 3300013105 Bacteria 1105
152 Ga0157374_10189274 3300013296 Bacteria 2013
153 Ga0157378_10408304 3300013297 Bacteria 1340
154 Ga0157378_10609073 3300013297 Bacteria 1104
155 Ga0163162_10043381 3300013306 Bacteria 4503
156 Ga0163162_11612043 3300013306 Bacteria 740
157 Ga0157372_10044203 3300013307 Bacteria 4935
158 Ga0157372_10056619 3300013307 Bacteria 4380
159 Ga0157372_10123346 3300013307 Bacteria 2978
160 Ga0157372_11067992 3300013307 Bacteria 934
161 Ga0157375_10000675 3300013308 Bacteria 30223
162 Ga0157375_11822700 3300013308 Bacteria 721
163 Ga0157375_12716674 3300013308 Bacteria 592
164 Ga0163163_10000112 3300014325 Bacteria 86324
165 Ga0163163_10000585 3300014325 Bacteria 32121
166 Ga0163163_10119878 3300014325 Bacteria 2664
167 Ga0182008_10000084 3300014497 Bacteria 72998
168 Ga0182008_10006699 3300014497 Bacteria 6412
169 Ga0157379_10007853 3300014968 Bacteria 9242
170 Ga0157379_10604651 3300014968 Bacteria 1024
171 Ga0157379_11373490 3300014968 Bacteria 684
172 Ga0157376_10157556 3300014969 Bacteria 2055
173 Ga0157376_10165117 3300014969 Bacteria 2011
174 Ga0157376_10563632 3300014969 Bacteria 1129
175 Ga0182006_1010206 3300015261 Bacteria 4185
176 Ga0182006_1092154 3300015261 Bacteria 1088
177 Ga0182007_10000060 3300015262 Bacteria 88258
178 Ga0182005_1000421 3300015265 Bacteria 22901
179 Ga0163161_10003404 3300017792 Bacteria 11160
180 Ga0163161_10144503 3300017792 Bacteria 1803
181 Ga0163161_10153076 3300017792 Bacteria 1754
182 Ga0163161_10229818 3300017792 Bacteria 1439
183 Ga0206354_10119145 3300020081 Bacteria 1756
184 Ga0207425_1012369 3300025245 Bacteria 2005
185 Ga0209565_1000001 3300025263 Bacteria 2950419
186 Ga0209565_1000037 3300025263 Bacteria 289371
187 Ga0209673_1000001 3300025273 Bacteria 3176258
188 Ga0209673_1000032 3300025273 Bacteria 339956
189 Ga0209673_1013309 3300025273 Bacteria 3253
190 Ga0209130_1005313 3300025284 Bacteria 4515
191 Ga0209675_1000001 3300025291 Bacteria 2950293
192 Ga0209675_1000020 3300025291 Bacteria 335854
193 Ga0209675_1007097 3300025291 Bacteria 4358
194 Ga0209675_1025045 3300025291 Bacteria 1512
195 Ga0209676_1000027 3300025292 Bacteria 560222
196 Ga0209676_1001321 3300025292 Bacteria 25097
197 Ga0209676_1002606 3300025292 Bacteria 12366
198 Ga0209676_1002880 3300025292 Bacteria 11320
199 Ga0209676_1003992 3300025292 Bacteria 8519
200 Ga0209025_1001895 3300025294 Bacteria 24398
201 Ga0209025_1003656 3300025294 Bacteria 14253
202 Ga0209564_1000001 3300025295 Bacteria 3176258
203 Ga0209564_1000210 3300025295 Bacteria 133323
204 Ga0209050_1001000 3300025298 Bacteria 35489
205 Ga0209050_1001322 3300025298 Bacteria 27684
206 Ga0209050_1001688 3300025298 Bacteria 22135
207 Ga0209050_1020324 3300025298 Bacteria 2474
208 Ga0209256_1000006 3300025299 Bacteria 1250310
209 Ga0209256_1005518 3300025299 Bacteria 7236
210 Ga0209256_1006467 3300025299 Bacteria 6181
211 Ga0209256_1018437 3300025299 Bacteria 2267
212 Ga0209051_1001347 3300025303 Bacteria 21327
213 Ga0209051_1002391 3300025303 Bacteria 13542
214 Ga0209257_1000086 3300025304 Bacteria 287437
215 Ga0209257_1000787 3300025304 Bacteria 46608
216 Ga0209257_1002744 3300025304 Bacteria 16691
217 Ga0209257_1002831 3300025304 Bacteria 16284
218 Ga0209257_1003134 3300025304 Bacteria 14754
219 Ga0209257_1004658 3300025304 Bacteria 10339
220 Ga0209257_1008390 3300025304 Bacteria 5889
221 Ga0209257_1124319 3300025304 Bacteria 599
222 Ga0207656_10021793 3300025321 Bacteria 2564
223 Ga0207655_1064832 3300025728 Bacteria 1390
224 Ga0207680_10000598 3300025903 Bacteria 17011
225 Ga0207647_10002208 3300025904 Bacteria 14832
226 Ga0207699_10389201 3300025906 Bacteria 991
227 Ga0207645_10038862 3300025907 Bacteria 3050
228 Ga0207705_10037183 3300025909 Bacteria 3483
229 Ga0207705_10041202 3300025909 Bacteria 3313
230 Ga0207707_10000146 3300025912 Bacteria 73614
231 Ga0207707_10053049 3300025912 Bacteria 3529
232 Ga0207695_10003607 3300025913 Bacteria 21652
233 Ga0207695_10031094 3300025913 Bacteria 5864
234 Ga0207695_10063232 3300025913 Bacteria 3816
235 Ga0207695_10383888 3300025913 Bacteria 1290
236 Ga0207671_10007138 3300025914 Bacteria 9746
237 Ga0207663_10123363 3300025916 Bacteria 1778
238 Ga0207663_10964753 3300025916 Bacteria 683
239 Ga0207660_10000676 3300025917 Bacteria 22769
240 Ga0207660_10001813 3300025917 Bacteria 14233
241 Ga0207657_10002836 3300025919 Bacteria 18613
242 Ga0207657_10029430 3300025919 Bacteria 5000
243 Ga0207657_10041210 3300025919 Bacteria 4084
244 Ga0207649_10113639 3300025920 Bacteria 1814
245 Ga0207649_10199837 3300025920 Bacteria 1411
246 Ga0207652_10000084 3300025921 Bacteria 101874
247 Ga0207652_10008959 3300025921 Bacteria 8065
248 Ga0207652_10333672 3300025921 Bacteria 1369
249 Ga0207681_10127555 3300025923 Bacteria 1876
250 Ga0207681_10649266 3300025923 Bacteria 875
251 Ga0207694_10070662 3300025924 Bacteria 2728
252 Ga0207694_10594962 3300025924 Bacteria 930
253 Ga0207650_11295193 3300025925 Bacteria 620
254 Ga0207687_10022314 3300025927 Bacteria 4211
255 Ga0207687_10341692 3300025927 Bacteria 1217
256 Ga0207700_10528283 3300025928 Bacteria 1046
257 Ga0207690_10235728 3300025932 Bacteria 1407
258 Ga0207706_10133414 3300025933 Bacteria 2184
259 Ga0207706_10207804 3300025933 Bacteria 1716
260 Ga0207706_10395886 3300025933 Bacteria 1198
261 Ga0207686_10029773 3300025934 Bacteria 3225
262 Ga0207670_10475966 3300025936 Bacteria 1011
263 Ga0207704_10045400 3300025938 Bacteria 2610
264 Ga0207704_10842285 3300025938 Bacteria 768
265 Ga0207689_10144046 3300025942 Bacteria 1963
266 Ga0207661_10373039 3300025944 Bacteria 1290
267 Ga0207661_10698846 3300025944 Bacteria 933
268 Ga0207679_10054898 3300025945 Bacteria 2935
269 Ga0207679_10624077 3300025945 Bacteria 973
270 Ga0207667_10007024 3300025949 Bacteria 13600
271 Ga0207667_10055758 3300025949 Bacteria 4153
272 Ga0207667_10204493 3300025949 Bacteria 2025
273 Ga0207667_11325522 3300025949 Bacteria 695
274 Ga0207651_10620468 3300025960 Bacteria 947
275 Ga0207668_11024692 3300025972 Bacteria 738
276 Ga0207640_10001128 3300025981 Bacteria 14684
277 Ga0207640_10014621 3300025981 Bacteria 4522
278 Ga0207658_10023690 3300025986 Bacteria 4288
279 Ga0207658_10390331 3300025986 Bacteria 1221
280 Ga0207703_10176324 3300026035 Bacteria 1883
281 Ga0207639_10007555 3300026041 Bacteria 7414
282 Ga0207678_10020270 3300026067 Bacteria 5834
283 Ga0207678_10027074 3300026067 Bacteria 5000
284 Ga0207678_10166502 3300026067 Bacteria 1882
285 Ga0207678_10183136 3300026067 Bacteria 1789
286 Ga0207702_10005423 3300026078 Bacteria 11165
287 Ga0207702_10498199 3300026078 Bacteria 1187
288 Ga0207641_10367693 3300026088 Bacteria 1374
289 Ga0207648_10173825 3300026089 Bacteria 1904
290 Ga0207648_10497745 3300026089 Bacteria 1115
291 Ga0207676_10038682 3300026095 Bacteria 3643
292 Ga0207676_10046848 3300026095 Bacteria 3348
293 Ga0207674_10002886 3300026116 Bacteria 21357
294 Ga0207674_10046326 3300026116 Bacteria 4465
295 Ga0207698_10051344 3300026142 Bacteria 3152
296 Ga0207698_10511574 3300026142 Bacteria 1170
297 Ga0268266_10000001 3300028379 Bacteria 4040580
298 Ga0268266_10054421 3300028379 Bacteria 3438
299 Ga0268266_10086831 3300028379 Bacteria 2735
300 Ga0268266_10446606 3300028379 Bacteria 1229
301 Ga0268265_10190399 3300028380 Bacteria 1771
302 Ga0268264_10003031 3300028381 Bacteria 14566
303 Ga0268264_10077764 3300028381 Bacteria 2827
304 Ga0268264_10296646 3300028381 Bacteria 1520
305 Ga0316176_1053738 3300030732 Bacteria 1840
306 Ga0314311_1109848 3300030733 Bacteria 1035
307 Ga0316182_1371761 3300030745 Bacteria 1006
308 Ga0307513_10009721 3300031456 Bacteria 12153
309 Ga0307513_10106363 3300031456 Bacteria 2812
310 Ga0307513_10342646 3300031456 Bacteria 1245
311 Ga0307408_100128425 3300031548 Bacteria 1974
312 Ga0307408_100637053 3300031548 Bacteria 951
313 Ga0307516_10231023 3300031730 Bacteria 1553
314 Ga0307405_10570977 3300031731 Bacteria 918
315 Ga0307405_10602492 3300031731 Bacteria 897
316 Ga0307413_10048178 3300031824 Bacteria 2546
317 Ga0307413_10203386 3300031824 Bacteria 1432
318 Ga0307413_10872122 3300031824 Bacteria 762
319 Ga0307413_11274197 3300031824 Bacteria 642
320 Ga0307406_10005878 3300031901 Bacteria 6732
321 Ga0307407_10236064 3300031903 Bacteria 1245
322 Ga0307412_11123344 3300031911 Bacteria 700
323 Ga0307416_100117487 3300032002 Bacteria 2361
324 Ga0307416_100124835 3300032002 Bacteria 2304
325 Ga0307416_100294936 3300032002 Bacteria 1608
326 Ga0307416_100357438 3300032002 Bacteria 1481
327 Ga0307414_10050399 3300032004 Bacteria 2884
328 Ga0307414_10177091 3300032004 Bacteria 1711
329 Ga0307414_10228356 3300032004 Bacteria 1533
330 Ga0307414_10253829 3300032004 Bacteria 1463
331 Ga0307414_10335657 3300032004 Bacteria 1292
332 Ga0307414_10385843 3300032004 Bacteria 1212
333 Ga0307414_10416047 3300032004 Bacteria 1171
334 Ga0307414_10520523 3300032004 Bacteria 1055
335 Ga0307411_10018060 3300032005 Bacteria 4037
336 Ga0307411_10516004 3300032005 Bacteria 1013
337 Ga0307411_11663912 3300032005 Bacteria 590
338 Ga0307411_11763537 3300032005 Bacteria 574
339 Ga0307415_100367198 3300032126 Bacteria 1217
340 Ga0307415_100409390 3300032126 Bacteria 1160
341 Ga0373927_0572581 3300035695 Bacteria 746
342 Ga0373933_0603539 3300035724 Bacteria 721
343 Ga0373937_0156456 3300036401 Bacteria 2136
344 Ga0373925_0063447 3300037068 Bacteria 2780
345 Ga0395905_0242318 3300037471 Bacteria 1685
346 Ga0439436_0014434 3300041404 Bacteria 2383
347 Ga0439436_0026940 3300041404 Bacteria 1683
348 Ga0439439_0012251 3300041406 Bacteria 2072
349 Ga0439439_0021225 3300041406 Bacteria 1618
350 Ga0439439_0042155 3300041406 Bacteria 1185
351 Ga0439465_0008753 3300041413 Bacteria 3189
352 Ga0439465_0010904 3300041413 Bacteria 2851
353 Ga0439465_0287416 3300041413 Bacteria 613
354 Ga0451789_0966542 3300041443 Bacteria 552
355 Ga0451797_0088711 3300041453 Bacteria 677
356 Ga0451833_1184932 3300041491 Bacteria 994
357 Ga0451837_1457555 3300041494 Bacteria 1539
358 Ga0451841_1204927 3300041498 Bacteria 1235
359 Ga0451843_1369231 3300041509 Bacteria 1199
360 Ga0451853_1403713 3300041512 Bacteria 1844
361 Ga0451853_1931247 3300041512 Bacteria 889
362 Ga0439433_0041699 3300041999 Bacteria 1070
363 Ga0439432_013875 3300042006 Bacteria 2732
364 Ga0439432_063813 3300042006 Bacteria 1131
365 Ga0439432_101543 3300042006 Bacteria 860
366 Ga0439432_132878 3300042006 Bacteria 734
367 Ga0439449_0006386 3300042007 Bacteria 4509
368 Ga0439449_0109812 3300042007 Bacteria 1021
369 Ga0439449_0216024 3300042007 Bacteria 718
370 Ga0439462_0016609 3300042015 Bacteria 1903
371 Ga0439434_0025767 3300042435 Bacteria 1776
372 Ga0495638_0006777 3300046460 Bacteria 8286
373 Ga0495638_0014382 3300046460 Bacteria 5351
374 Ga0495638_0056420 3300046460 Bacteria 2437
375 Ga0495638_0162900 3300046460 Bacteria 1285
376 Ga0495582_0022836 3300046473 Bacteria 3422
377 Ga0495616_0072228 3300046513 Bacteria 1667
378 Ga0495628_0289744 3300046516 Bacteria 1214
379 Ga0495643_0001835 3300046522 Bacteria 18063
380 Ga0495643_0333888 3300046522 Bacteria 683
381 Ga0495663_0000485 3300046525 Bacteria 14449
382 Ga0495663_0000914 3300046525 Bacteria 9862
383 Ga0495665_0304763 3300046531 Bacteria 815
384 Ga0495587_0104875 3300046536 Bacteria 1627
385 Ga0495633_0138389 3300046558 Bacteria 1126
386 Ga0495625_0105857 3300046660 Bacteria 1926
387 Ga0495625_0110158 3300046660 Bacteria 1882
388 Ga0495635_0099496 3300046663 Bacteria 1988
389 Ga0495658_0025135 3300046683 Bacteria 3181
390 Ga0495671_0032292 3300046692 Bacteria 2673
391 Ga0495674_1160078 3300047319 Bacteria 586
392 Ga0495672_0001556 3300047320 Bacteria 22458
393 Ga0495686_0082597 3300047472 Bacteria 1960
394 Ga0496100_0025856 3300048903 Bacteria 3593
395 Ga0496104_0000012 3300048907 Bacteria 438011
396 Ga0496105_0000032 3300048908 Bacteria 135801
397 Ga0496113_0350055 3300048916 Bacteria 1185
398 Ga0496114_0930648 3300048917 Bacteria 751
399 Ga0496115_0747285 3300048918 Bacteria 765
400 Ga0496116_0083618 3300048919 Bacteria 1969
401 Ga0496116_0084783 3300048919 Bacteria 1950
402 Ga0496117_0004764 3300048920 Bacteria 14721
403 Ga0496118_0004204 3300048921 Bacteria 17306
404 Ga0496118_0004296 3300048921 Bacteria 17034
405 Ga0496118_0010793 3300048921 Bacteria 9003
406 Ga0496118_0010794 3300048921 Bacteria 9002
407 Ga0496121_0044131 3300048924 Bacteria 3850
408 Ga0496122_0072047 3300048925 Bacteria 2459
409 Ga0496122_0094712 3300048925 Bacteria 2020
410 Ga0496122_0116918 3300048925 Bacteria 1733
411 Ga0496122_0155091 3300048925 Bacteria 1406
412 Ga0496123_0004282 3300048926 Bacteria 15181
413 Ga0496123_0007695 3300048926 Bacteria 10063
414 Ga0496123_0045387 3300048926 Bacteria 2994
415 Ga0496124_0002535 3300048927 Bacteria 23710
416 Ga0496124_0005775 3300048927 Bacteria 13772
417 Ga0496124_0011580 3300048927 Bacteria 8801
418 Ga0496124_0235171 3300048927 Bacteria 1366
419 Ga0496124_0253353 3300048927 Bacteria 1300
420 Ga0496125_0006793 3300048928 Bacteria 12288
421 Ga0496125_0007934 3300048928 Bacteria 11210
422 Ga0496125_0050417 3300048928 Bacteria 3446
423 Ga0496125_0216964 3300048928 Bacteria 1236
424 Ga0496126_0052949 3300048929 Bacteria 3685
425 Ga0496126_0074047 3300048929 Bacteria 3025
426 Ga0496126_0159770 3300048929 Bacteria 1926
427 Ga0501031_0033784 3300049568 Bacteria 3339
428 Ga0501031_0179292 3300049568 Bacteria 1384
429 Ga0501032_0003925 3300049569 Bacteria 11289
430 Ga0501032_0045378 3300049569 Bacteria 2972
431 Ga0501033_0001369 3300049570 Bacteria 21743
432 Ga0501033_0003778 3300049570 Bacteria 12306
433 Ga0501033_0260447 3300049570 Bacteria 1227
434 Ga0501033_0657675 3300049570 Bacteria 715
435 Ga0501034_0001709 3300049571 Bacteria 28248
436 Ga0501034_0003104 3300049571 Bacteria 19154
437 Ga0501034_0006620 3300049571 Bacteria 12432
438 Ga0501034_0023513 3300049571 Bacteria 6279
439 Ga0501034_0053395 3300049571 Bacteria 4069
440 Ga0501034_0054601 3300049571 Bacteria 4021
441 Ga0501034_0574717 3300049571 Bacteria 1034
442 Ga0501036_0018039 3300049572 Bacteria 5907
443 Ga0501036_0394918 3300049572 Bacteria 1154
444 Ga0501036_0398902 3300049572 Bacteria 1147
445 Ga0501036_0445524 3300049572 Bacteria 1079
446 Ga0501036_0619410 3300049572 Bacteria 897
447 Ga0501037_0018053 3300049573 Bacteria 5196
448 Ga0501037_0036022 3300049573 Bacteria 3647
449 Ga0501037_0269449 3300049573 Bacteria 1188
450 Ga0501037_0362009 3300049573 Bacteria 999
451 Ga0501037_0363525 3300049573 Bacteria 997
452 Ga0501037_0684654 3300049573 Bacteria 683
453 Ga0501038_0003076 3300049574 Bacteria 15552
454 Ga0501038_0015538 3300049574 Bacteria 6920
455 Ga0501039_0005931 3300049575 Bacteria 9255
456 Ga0501039_0219262 3300049575 Bacteria 1495
457 Ga0501040_0065684 3300049576 Bacteria 2499
458 Ga0501042_0250892 3300049578 Bacteria 1277
459 Ga0501043_0010472 3300049579 Bacteria 7263
460 Ga0501043_0169927 3300049579 Bacteria 1701
461 Ga0501043_0276634 3300049579 Bacteria 1287
462 Ga0501046_0003886 3300049580 Bacteria 13666
463 Ga0501046_0027669 3300049580 Bacteria 4624
464 Ga0501046_0101993 3300049580 Bacteria 2200
465 Ga0501046_0234302 3300049580 Bacteria 1355
466 Ga0501046_0262061 3300049580 Bacteria 1270
467 Ga0501046_0453991 3300049580 Bacteria 921
468 Ga0501047_0002093 3300049581 Bacteria 19094
469 Ga0501047_0003063 3300049581 Bacteria 15848
470 Ga0501047_0290931 3300049581 Bacteria 1477
471 Ga0501047_0306993 3300049581 Bacteria 1428
472 Ga0501047_0312531 3300049581 Bacteria 1411
473 Ga0501047_0352465 3300049581 Bacteria 1308
474 Ga0501047_1086554 3300049581 Bacteria 613
475 Ga0501048_0042444 3300049582 Bacteria 3256
476 Ga0501067_0000583 3300049583 Bacteria 19798
477 Ga0501067_0002819 3300049583 Bacteria 9564
478 Ga0501067_0326358 3300049583 Bacteria 855
479 Ga0501068_0029797 3300049584 Bacteria 3234
480 Ga0501068_0184873 3300049584 Bacteria 1318
481 Ga0501069_0002178 3300049585 Bacteria 9867
482 Ga0501069_0013764 3300049585 Bacteria 4316
483 Ga0501069_0022289 3300049585 Bacteria 3443
484 Ga0501069_0138008 3300049585 Bacteria 1398
485 Ga0501070_0022458 3300049586 Bacteria 5284
486 Ga0501070_0061919 3300049586 Bacteria 3099
487 Ga0501070_0066254 3300049586 Bacteria 2990
488 Ga0501070_0340871 3300049586 Bacteria 1217
489 Ga0501070_0598102 3300049586 Bacteria 879
490 Ga0501071_0008797 3300049587 Bacteria 6689
491 Ga0501071_0125145 3300049587 Bacteria 1907
492 Ga0501072_0002507 3300049588 Bacteria 13756
493 Ga0501072_0139019 3300049588 Bacteria 1936
494 Ga0501073_0008095 3300049589 Bacteria 7799
495 Ga0501073_0015945 3300049589 Bacteria 5445
496 Ga0501073_0036928 3300049589 Bacteria 3470
497 Ga0501073_0058739 3300049589 Bacteria 2688
498 Ga0501073_0159283 3300049589 Bacteria 1564
499 Ga0501073_0240835 3300049589 Bacteria 1249
500 Ga0501073_0495901 3300049589 Bacteria 844
501 Ga0501073_0640827 3300049589 Bacteria 733
502 Ga0501074_0003499 3300049590 Bacteria 11147
503 Ga0501074_0005938 3300049590 Bacteria 8802
504 Ga0501074_0062333 3300049590 Bacteria 2685
505 Ga0501074_0065446 3300049590 Bacteria 2616
506 Ga0501074_0223444 3300049590 Bacteria 1340
507 Ga0501074_0335234 3300049590 Bacteria 1073
508 Ga0501076_0554827 3300049592 Bacteria 947
509 Ga0501077_0304286 3300049593 Bacteria 1016
510 Ga0501079_0023751 3300049741 Bacteria 4704
511 Ga0501079_0026319 3300049741 Bacteria 4461
512 Ga0501079_0084900 3300049741 Bacteria 2449
513 Ga0501079_0173661 3300049741 Bacteria 1680
514 Ga0501079_0419027 3300049741 Bacteria 1051
515 Ga0501080_0000256 3300049742 Bacteria 40148
516 Ga0501080_0001893 3300049742 Bacteria 18018
517 Ga0501080_0008868 3300049742 Bacteria 9143
518 Ga0501080_0009555 3300049742 Bacteria 8853
519 Ga0501080_0016829 3300049742 Bacteria 6753
520 Ga0501080_0312935 3300049742 Bacteria 1423
521 Ga0501080_0433568 3300049742 Bacteria 1179
522 Ga0501080_0832949 3300049742 Bacteria 807
523 Ga0501081_0079654 3300049743 Bacteria 2291
524 Ga0501083_0001929 3300049744 Bacteria 14264
525 Ga0501083_0063372 3300049744 Bacteria 2465
526 Ga0501083_0082394 3300049744 Bacteria 2132
527 Ga0501266_009904 3300049763 Bacteria 1209
528 Ga0501035_0019099 3300049822 Bacteria 6309
529 Ga0501035_0084105 3300049822 Bacteria 2806
530 Ga0501035_0084441 3300049822 Bacteria 2800
531 Ga0501035_0118458 3300049822 Bacteria 2316
532 Ga0501035_0290178 3300049822 Bacteria 1381
533 Ga0501035_0739270 3300049822 Bacteria 790
534 Ga0501044_0003272 3300049823 Bacteria 18232
535 Ga0501044_0014368 3300049823 Bacteria 8550
536 Ga0501044_0014551 3300049823 Bacteria 8488
537 Ga0501044_0045639 3300049823 Bacteria 4540
538 Ga0501044_0051011 3300049823 Bacteria 4267
539 Ga0501044_0076742 3300049823 Bacteria 3390
540 Ga0501044_0100985 3300049823 Bacteria 2903
541 Ga0501044_0111078 3300049823 Bacteria 2749
542 Ga0501044_0114409 3300049823 Bacteria 2704
543 Ga0501044_0186880 3300049823 Bacteria 2036
544 Ga0501045_0029231 3300049824 Bacteria 3982
545 nmdc:mga00v17_72407_c1 3300050491 Bacteria 2138
546 nmdc:mga06z11_15223_c1 3300050494 Bacteria 3428
547 Ga0500556_0284571 3300053104 Bacteria 648
548 Ga0500568_0001136 3300053139 Bacteria 17862
549 Ga0500624_075777 3300053157 Bacteria 664
550 Ga0500565_010107 3300053734 Bacteria 956
551 Ga0501084_0025460 3300054114 Bacteria 4937
552 Ga0501084_0169997 3300054114 Bacteria 1840
553 Ga0501084_0204750 3300054114 Bacteria 1665
554 Ga0501084_0291415 3300054114 Bacteria 1379
555 Ga0501084_0593938 3300054114 Bacteria 935
556 Ga0501082_0000141 3300060353 Bacteria 59767
557 Ga0501082_0201301 3300060353 Bacteria 1732
558 Ga0501082_0211016 3300060353 Bacteria 1689
559 Ga0501082_0287069 3300060353 Bacteria 1432
560 Ga0530510_0334839 3300061734 Bacteria 1136
561 2578459691 2576861471 Bacteria 4648976
562 2643818364 2643221559 Bacteria 4424915
563 2643880781 2643221573 Bacteria 4784121
564 2643905312 2643221579 Bacteria 4443405
565 2643914994 2643221581 Bacteria 3893603
566 2643938495 2643221586 Bacteria 4446529
567 2644079147 2643221612 Bacteria 4361984
568 2644530553 2643221695 Bacteria 3441323
569 2644661351 2643221720 Bacteria 4694283
570 2644693923 2643221727 Bacteria 4415595
571 2644699430 2643221728 Bacteria 4797149
572 2842759574 2842757796 Bacteria 3981385
573 2852652946 2852649853 Bacteria 4036942
574 2857444433 2857442823 Bacteria 4562550
575 2919132149 2919130084 Bacteria 5301837
576 2923517424 2923516293 Bacteria 3716336
577 2929199112 2929195423 Bacteria 5325372
578 2939592517 2939589442 Bacteria 4214238
579 2939624844 2939622612 Bacteria 4698046
580 2941477434 2941475908 Bacteria 4145589
581 2974310127 2974307012 Bacteria 4172388
582 2977250861 2977247770 Bacteria 4160543
583 2984514652 2984514374 Bacteria 4172479
584 2987608104 2987605356 Bacteria 4187822
585 2995949929 2995948881 Bacteria 6358104
586 8003015227 8003014200 Bacteria 4059994
587 8021650535 8021648035 Bacteria 4772378
588 Ga0105246_10687606
589 JGI24741J21665_1002712
590 rootL2_10062548
591 Ga0055526_1000005
592 Ga0055526_1002233
593 Ga0055537_1000288
594 Ga0055537_1001737
595 Ga0055537_1002054
596 Ga0055524_1000005
597 Ga0055524_1004724
598 Ga0055536_1001397
599 Ga0055536_1002130
600 Ga0055536_1003244
601 Ga0055536_1007869
602 Ga0055534_1000002
603 Ga0055534_1001086
604 Ga0055528_1000002
605 Ga0055528_1001584
606 Ga0055530_10001810
607 Ga0055530_10002674
608 Ga0055530_10007278
609 Ga0055540_1017257
610 Ga0055531_10002857
611 Ga0055531_10021694
612 Ga0070658_10057638
613 Ga0070676_10528254
614 Ga0070683_100142437
615 Ga0070690_101167641
616 Ga0068869_100686999
617 Ga0070666_10000487
618 Ga0070666_10796171
619 Ga0070680_100000582
620 Ga0070680_100568292
621 Ga0070682_100757472
622 Ga0070660_100080578
623 Ga0070661_100137980
624 Ga0070668_100142822
625 Ga0070668_100186094
626 Ga0070668_100557435
627 Ga0070669_100148290
628 Ga0070671_100031400
629 Ga0070673_100433739
630 Ga0070659_100058492
631 Ga0070659_100194822
632 Ga0070659_100424645
633 Ga0070667_100231233
634 Ga0070667_100244360
635 Ga0070709_10024435
636 Ga0070709_10297833
637 Ga0070713_100533431
638 Ga0070711_100719187
639 Ga0070663_100028812
640 Ga0070663_100053496
641 Ga0070663_101108360
642 Ga0070662_100696018
643 Ga0070681_10003299
644 Ga0070681_10128599
645 Ga0068867_100068420
646 Ga0070679_100003151
647 Ga0070679_100697750
648 Ga0070684_100089335
649 Ga0068853_100016385
650 Ga0068853_100053738
651 Ga0068853_100218568
652 Ga0068853_100771040
653 Ga0070672_101062330
654 Ga0070696_100019620
655 Ga0070665_100000092
656 Ga0068855_100066164
657 Ga0068855_100804432
658 Ga0068855_101362137
659 Ga0070664_100128266
660 Ga0068857_100038503
661 Ga0068857_100209905
662 Ga0068857_100226826
663 Ga0068854_100030061
664 Ga0068854_100210651
665 Ga0068854_100512631
666 Ga0068856_100121458
667 Ga0068856_100161443
668 Ga0068852_100042035
669 Ga0068852_100075304
670 Ga0068852_100178626
671 Ga0068852_100268916
672 Ga0068859_100665524
673 Ga0068859_100667523
674 Ga0068864_100004209
675 Ga0068864_100111094
676 Ga0068864_100211538
677 Ga0068851_10019388
678 Ga0068863_100006254
679 Ga0068863_100173587
680 Ga0068863_100192490
681 Ga0068858_100288904
682 Ga0068860_100017401
683 Ga0068860_100270877
684 Ga0068860_100912179
685 Ga0068862_100437022
686 Ga0075368_10393426
687 Ga0075364_10044264
688 Ga0075367_10005201
689 Ga0097621_100180729
690 Ga0097621_100937885
691 Ga0097621_101366427
692 Ga0068871_100040170
693 Ga0068871_100065158
694 Ga0068871_100231117
695 Ga0068871_100248883
696 Ga0068871_100522659
697 Ga0068871_100808254
698 Ga0068871_101688111
699 Ga0068865_100004889
700 Ga0097620_100665493
701 Ga0097620_100667404
702 Ga0099826_10191757
703 Ga0105251_10006537
704 Ga0105244_10158075
705 Ga0105240_10040352
706 Ga0105240_10092747
707 Ga0105240_10152926
708 Ga0105240_10880220
709 Ga0105245_10039307
710 Ga0105245_10286466
711 Ga0105245_10467241
712 Ga0105245_10912161
713 Ga0105241_10021278
714 Ga0105241_10094532
715 Ga0105241_10340325
716 Ga0105241_10642918
717 Ga0105242_10012218
718 Ga0105237_10155336
719 Ga0105237_11023099
720 Ga0105237_11074482
721 Ga0105238_10046014
722 Ga0105238_10049996
723 Ga0105238_10138581
724 Ga0105238_10659351
725 Ga0105239_10050230
726 Ga0105239_10073582
727 Ga0105239_10761847
728 Ga0105239_11848295
729 Ga0105246_10011815
730 Ga0157373_10006648
731 Ga0157370_10001293
732 Ga0157370_10002303
733 Ga0157370_10519422
734 Ga0157370_10645111
735 Ga0157369_10000001
736 Ga0157369_10124679
737 Ga0157369_10264932
738 Ga0157369_10631295
739 Ga0157374_10189274
740 Ga0157378_10408304
741 Ga0157378_10609073
742 Ga0163162_10043381
743 Ga0163162_11612043
744 Ga0157372_10044203
745 Ga0157372_10056619
746 Ga0157372_10123346
747 Ga0157372_11067992
748 Ga0157375_10000675
749 Ga0157375_11822700
750 Ga0157375_12716674
751 Ga0163163_10000112
752 Ga0163163_10000585
753 Ga0163163_10119878
754 Ga0182008_10000084
755 Ga0182008_10006699
756 Ga0157379_10007853
757 Ga0157379_10604651
758 Ga0157379_11373490
759 Ga0157376_10157556
760 Ga0157376_10165117
761 Ga0157376_10563632
762 Ga0182006_1010206
763 Ga0182006_1092154
764 Ga0182007_10000060
765 Ga0182005_1000421
766 Ga0163161_10003404
767 Ga0163161_10144503
768 Ga0163161_10153076
769 Ga0163161_10229818
770 Ga0206354_10119145
771 Ga0207425_1012369
772 Ga0209565_1000001
773 Ga0209565_1000037
774 Ga0209673_1000001
775 Ga0209673_1000032
776 Ga0209673_1013309
777 Ga0209130_1005313
778 Ga0209675_1000001
779 Ga0209675_1000020
780 Ga0209675_1007097
781 Ga0209675_1025045
782 Ga0209676_1000027
783 Ga0209676_1001321
784 Ga0209676_1002606
785 Ga0209676_1002880
786 Ga0209676_1003992
787 Ga0209025_1001895
788 Ga0209025_1003656
789 Ga0209564_1000001
790 Ga0209564_1000210
791 Ga0209050_1001000
792 Ga0209050_1001322
793 Ga0209050_1001688
794 Ga0209050_1020324
795 Ga0209256_1000006
796 Ga0209256_1005518
797 Ga0209256_1006467
798 Ga0209256_1018437
799 Ga0209051_1001347
800 Ga0209051_1002391
801 Ga0209257_1000086
802 Ga0209257_1000787
803 Ga0209257_1002744
804 Ga0209257_1002831
805 Ga0209257_1003134
806 Ga0209257_1004658
807 Ga0209257_1008390
808 Ga0209257_1124319
809 Ga0207656_10021793
810 Ga0207655_1064832
811 Ga0207680_10000598
812 Ga0207647_10002208
813 Ga0207699_10389201
814 Ga0207645_10038862
815 Ga0207705_10037183
816 Ga0207705_10041202
817 Ga0207707_10000146
818 Ga0207707_10053049
819 Ga0207695_10003607
820 Ga0207695_10031094
821 Ga0207695_10063232
822 Ga0207695_10383888
823 Ga0207671_10007138
824 Ga0207663_10123363
825 Ga0207663_10964753
826 Ga0207660_10000676
827 Ga0207660_10001813
828 Ga0207657_10002836
829 Ga0207657_10029430
830 Ga0207657_10041210
831 Ga0207649_10113639
832 Ga0207649_10199837
833 Ga0207652_10000084
834 Ga0207652_10008959
835 Ga0207652_10333672
836 Ga0207681_10127555
837 Ga0207681_10649266
838 Ga0207694_10070662
839 Ga0207694_10594962
840 Ga0207650_11295193
841 Ga0207687_10022314
842 Ga0207687_10341692
843 Ga0207700_10528283
844 Ga0207690_10235728
845 Ga0207706_10133414
846 Ga0207706_10207804
847 Ga0207706_10395886
848 Ga0207686_10029773
849 Ga0207670_10475966
850 Ga0207704_10045400
851 Ga0207704_10842285
852 Ga0207689_10144046
853 Ga0207661_10373039
854 Ga0207661_10698846
855 Ga0207679_10054898
856 Ga0207679_10624077
857 Ga0207667_10007024
858 Ga0207667_10055758
859 Ga0207667_10204493
860 Ga0207667_11325522
861 Ga0207651_10620468
862 Ga0207668_11024692
863 Ga0207640_10001128
864 Ga0207640_10014621
865 Ga0207658_10023690
866 Ga0207658_10390331
867 Ga0207703_10176324
868 Ga0207639_10007555
869 Ga0207678_10020270
870 Ga0207678_10027074
871 Ga0207678_10166502
872 Ga0207678_10183136
873 Ga0207702_10005423
874 Ga0207702_10498199
875 Ga0207641_10367693
876 Ga0207648_10173825
877 Ga0207648_10497745
878 Ga0207676_10038682
879 Ga0207676_10046848
880 Ga0207674_10002886
881 Ga0207674_10046326
882 Ga0207698_10051344
883 Ga0207698_10511574
884 Ga0268266_10000001
885 Ga0268266_10054421
886 Ga0268266_10086831
887 Ga0268266_10446606
888 Ga0268265_10190399
889 Ga0268264_10003031
890 Ga0268264_10077764
891 Ga0268264_10296646
892 Ga0316176_1053738
893 Ga0314311_1109848
894 Ga0316182_1371761
895 Ga0307513_10009721
896 Ga0307513_10106363
897 Ga0307513_10342646
898 Ga0307408_100128425
899 Ga0307408_100637053
900 Ga0307516_10231023
901 Ga0307405_10570977
902 Ga0307405_10602492
903 Ga0307413_10048178
904 Ga0307413_10203386
905 Ga0307413_10872122
906 Ga0307413_11274197
907 Ga0307406_10005878
908 Ga0307407_10236064
909 Ga0307412_11123344
910 Ga0307416_100117487
911 Ga0307416_100124835
912 Ga0307416_100294936
913 Ga0307416_100357438
914 Ga0307414_10050399
915 Ga0307414_10177091
916 Ga0307414_10228356
917 Ga0307414_10253829
918 Ga0307414_10335657
919 Ga0307414_10385843
920 Ga0307414_10416047
921 Ga0307414_10520523
922 Ga0307411_10018060
923 Ga0307411_10516004
924 Ga0307411_11663912
925 Ga0307411_11763537
926 Ga0307415_100367198
927 Ga0307415_100409390
928 Ga0373927_0572581
929 Ga0373933_0603539
930 Ga0373937_0156456
931 Ga0373925_0063447
932 Ga0395905_0242318
933 Ga0439436_0014434
934 Ga0439436_0026940
935 Ga0439439_0012251
936 Ga0439439_0021225
937 Ga0439439_0042155
938 Ga0439465_0008753
939 Ga0439465_0010904
940 Ga0439465_0287416
941 Ga0451789_0966542
942 Ga0451797_0088711
943 Ga0451833_1184932
944 Ga0451837_1457555
945 Ga0451841_1204927
946 Ga0451843_1369231
947 Ga0451853_1403713
948 Ga0451853_1931247
949 Ga0439433_0041699
950 Ga0439432_013875
951 Ga0439432_063813
952 Ga0439432_101543
953 Ga0439432_132878
954 Ga0439449_0006386
955 Ga0439449_0109812
956 Ga0439449_0216024
957 Ga0439462_0016609
958 Ga0439434_0025767
959 Ga0495638_0006777
960 Ga0495638_0014382
961 Ga0495638_0056420
962 Ga0495638_0162900
963 Ga0495582_0022836
964 Ga0495616_0072228
965 Ga0495628_0289744
966 Ga0495643_0001835
967 Ga0495643_0333888
968 Ga0495663_0000485
969 Ga0495663_0000914
970 Ga0495665_0304763
971 Ga0495587_0104875
972 Ga0495633_0138389
973 Ga0495625_0105857
974 Ga0495625_0110158
975 Ga0495635_0099496
976 Ga0495658_0025135
977 Ga0495671_0032292
978 Ga0495674_1160078
979 Ga0495672_0001556
980 Ga0495686_0082597
981 Ga0496100_0025856
982 Ga0496104_0000012
983 Ga0496105_0000032
984 Ga0496113_0350055
985 Ga0496114_0930648
986 Ga0496115_0747285
987 Ga0496116_0083618
988 Ga0496116_0084783
989 Ga0496117_0004764
990 Ga0496118_0004204
991 Ga0496118_0004296
992 Ga0496118_0010793
993 Ga0496118_0010794
994 Ga0496121_0044131
995 Ga0496122_0072047
996 Ga0496122_0094712
997 Ga0496122_0116918
998 Ga0496122_0155091
999 Ga0496123_0004282
1000 Ga0496123_0007695
1001 Ga0496123_0045387
1002 Ga0496124_0002535
1003 Ga0496124_0005775
1004 Ga0496124_0011580
1005 Ga0496124_0235171
1006 Ga0496124_0253353
1007 Ga0496125_0006793
1008 Ga0496125_0007934
1009 Ga0496125_0050417
1010 Ga0496125_0216964
1011 Ga0496126_0052949
1012 Ga0496126_0074047
1013 Ga0496126_0159770
1014 Ga0501031_0033784
1015 Ga0501031_0179292
1016 Ga0501032_0003925
1017 Ga0501032_0045378
1018 Ga0501033_0001369
1019 Ga0501033_0003778
1020 Ga0501033_0260447
1021 Ga0501033_0657675
1022 Ga0501034_0001709
1023 Ga0501034_0003104
1024 Ga0501034_0006620
1025 Ga0501034_0023513
1026 Ga0501034_0053395
1027 Ga0501034_0054601
1028 Ga0501034_0574717
1029 Ga0501036_0018039
1030 Ga0501036_0394918
1031 Ga0501036_0398902
1032 Ga0501036_0445524
1033 Ga0501036_0619410
1034 Ga0501037_0018053
1035 Ga0501037_0036022
1036 Ga0501037_0269449
1037 Ga0501037_0362009
1038 Ga0501037_0363525
1039 Ga0501037_0684654
1040 Ga0501038_0003076
1041 Ga0501038_0015538
1042 Ga0501039_0005931
1043 Ga0501039_0219262
1044 Ga0501040_0065684
1045 Ga0501042_0250892
1046 Ga0501043_0010472
1047 Ga0501043_0169927
1048 Ga0501043_0276634
1049 Ga0501046_0003886
1050 Ga0501046_0027669
1051 Ga0501046_0101993
1052 Ga0501046_0234302
1053 Ga0501046_0262061
1054 Ga0501046_0453991
1055 Ga0501047_0002093
1056 Ga0501047_0003063
1057 Ga0501047_0290931
1058 Ga0501047_0306993
1059 Ga0501047_0312531
1060 Ga0501047_0352465
1061 Ga0501047_1086554
1062 Ga0501048_0042444
1063 Ga0501067_0000583
1064 Ga0501067_0002819
1065 Ga0501067_0326358
1066 Ga0501068_0029797
1067 Ga0501068_0184873
1068 Ga0501069_0002178
1069 Ga0501069_0013764
1070 Ga0501069_0022289
1071 Ga0501069_0138008
1072 Ga0501070_0022458
1073 Ga0501070_0061919
1074 Ga0501070_0066254
1075 Ga0501070_0340871
1076 Ga0501070_0598102
1077 Ga0501071_0008797
1078 Ga0501071_0125145
1079 Ga0501072_0002507
1080 Ga0501072_0139019
1081 Ga0501073_0008095
1082 Ga0501073_0015945
1083 Ga0501073_0036928
1084 Ga0501073_0058739
1085 Ga0501073_0159283
1086 Ga0501073_0240835
1087 Ga0501073_0495901
1088 Ga0501073_0640827
1089 Ga0501074_0003499
1090 Ga0501074_0005938
1091 Ga0501074_0062333
1092 Ga0501074_0065446
1093 Ga0501074_0223444
1094 Ga0501074_0335234
1095 Ga0501076_0554827
1096 Ga0501077_0304286
1097 Ga0501079_0023751
1098 Ga0501079_0026319
1099 Ga0501079_0084900
1100 Ga0501079_0173661
1101 Ga0501079_0419027
1102 Ga0501080_0000256
1103 Ga0501080_0001893
1104 Ga0501080_0008868
1105 Ga0501080_0009555
1106 Ga0501080_0016829
1107 Ga0501080_0312935
1108 Ga0501080_0433568
1109 Ga0501080_0832949
1110 Ga0501081_0079654
1111 Ga0501083_0001929
1112 Ga0501083_0063372
1113 Ga0501083_0082394
1114 Ga0501266_009904
1115 Ga0501035_0019099
1116 Ga0501035_0084105
1117 Ga0501035_0084441
1118 Ga0501035_0118458
1119 Ga0501035_0290178
1120 Ga0501035_0739270
1121 Ga0501044_0003272
1122 Ga0501044_0014368
1123 Ga0501044_0014551
1124 Ga0501044_0045639
1125 Ga0501044_0051011
1126 Ga0501044_0076742
1127 Ga0501044_0100985
1128 Ga0501044_0111078
1129 Ga0501044_0114409
1130 Ga0501044_0186880
1131 Ga0501045_0029231
1132 nmdc:mga00v17_72407_c1
1133 nmdc:mga06z11_15223_c1
1134 Ga0500556_0284571
1135 Ga0500568_0001136
1136 Ga0500624_075777
1137 Ga0500565_010107
1138 Ga0501084_0025460
1139 Ga0501084_0169997
1140 Ga0501084_0204750
1141 Ga0501084_0291415
1142 Ga0501084_0593938
1143 Ga0501082_0000141
1144 Ga0501082_0201301
1145 Ga0501082_0211016
1146 Ga0501082_0287069
1147 Ga0530510_0334839
1148 2578459691
1149 2643818364
1150 2643880781
1151 2643905312
1152 2643914994
1153 2643938495
1154 2644079147
1155 2644530553
1156 2644661351
1157 2644693923
1158 2644699430
1159 2842759574
1160 2852652946
1161 2857444433
1162 2919132149
1163 2923517424
1164 2929199112
1165 2939592517
1166 2939624844
1167 2941477434
1168 2974310127
1169 2977250861
1170 2984514652
1171 2987608104
1172 2995949929
1173 8003015227
1174 8021650535

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

19

156

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a4f-assembly1.cif.gz_AI aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.9792 17 82
7a4f-assembly1.cif.gz_AC aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) 0.979 17 82
8f25-assembly1.cif.gz_A cryo-em structure of lumazine synthase nanoparticle linked to vp8* antigen 0.9691 12 158
1hqk-assembly1.cif.gz_A crystal structure analysis of lumazine synthase from aquifex aeolicus 0.9678 12 156
7a4h-assembly1.cif.gz_BB aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) 0.9665 17 82
ID Description Score Start End Superfamily
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.971 12 156 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9669 12 158 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9648 14 157 3.40.50.960
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9394 12 152 3.40.50.960
2vi5I00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9287 17 158 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A2E5Z939-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9824 18 159 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A2E9F1P6-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9819 18 159 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A8DVC9-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (EC 2.5.1.78) 0.9812 18 157 GO:0000906
GO:0005737
GO:0005829
GO:0009231
GO:0009349
AF-A0A7Y4ZTM4-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9809 12 157 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A661MHD8-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9807 13 159 GO:0000906
GO:0009231
GO:0009349

Map