F466669
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 587 | 279 | 1174 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300011119|Ga0105246_10687606|Ga0105246_106876061 |
| Length | 164 |
| Sequence | VAAELPVTILAGELRAHAGARFAIIASRWNPGIVDALIEGARRAFAAHGVADAALDVVRVPGAWEIPLAASRAASGYAAIIALGCVVRGETRHFDHVADECARGLMRVALDTGVPVLNGVLAVERHEHAKARAGGAHGNKGEEVALAAMEIVDLLKKVPVARPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 147 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 148 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 167 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 168 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 169 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 172 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 173 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 174 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 177 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 178 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 179 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 180 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 181 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 210 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 211 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 246 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 247 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 248 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 249 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 250 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 253 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 254 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 255 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 256 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 257 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 258 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 259 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 260 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 261 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 262 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 263 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 264 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 265 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 266 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 267 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 268 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 269 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 270 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 271 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 272 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 273 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 274 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 275 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 276 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 277 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 278 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 279 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.23 |
| Metatranscriptomes | 0.17 |
| Isolates | 4.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 11.58 |
| Nodule | 0.17 |
| Rhizoplane | 1.36 |
| Rhizosphere | 77.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105246_10687606 | 3300011119 | Bacteria | 895 |
| 2 | JGI24741J21665_1002712 | 3300001915 | Bacteria | 4500 |
| 3 | rootL2_10062548 | 3300003322 | Bacteria | 2050 |
| 4 | Ga0055526_1000005 | 3300003771 | Bacteria | 344542 |
| 5 | Ga0055526_1002233 | 3300003771 | Bacteria | 13264 |
| 6 | Ga0055537_1000288 | 3300003773 | Bacteria | 35795 |
| 7 | Ga0055537_1001737 | 3300003773 | Bacteria | 8041 |
| 8 | Ga0055537_1002054 | 3300003773 | Bacteria | 7092 |
| 9 | Ga0055524_1000005 | 3300003775 | Bacteria | 344542 |
| 10 | Ga0055524_1004724 | 3300003775 | Bacteria | 6240 |
| 11 | Ga0055536_1001397 | 3300003781 | Bacteria | 14601 |
| 12 | Ga0055536_1002130 | 3300003781 | Bacteria | 11268 |
| 13 | Ga0055536_1003244 | 3300003781 | Bacteria | 8810 |
| 14 | Ga0055536_1007869 | 3300003781 | Bacteria | 4687 |
| 15 | Ga0055534_1000002 | 3300003784 | Bacteria | 390762 |
| 16 | Ga0055534_1001086 | 3300003784 | Bacteria | 11648 |
| 17 | Ga0055528_1000002 | 3300003790 | Bacteria | 368879 |
| 18 | Ga0055528_1001584 | 3300003790 | Bacteria | 13495 |
| 19 | Ga0055530_10001810 | 3300003791 | Bacteria | 14821 |
| 20 | Ga0055530_10002674 | 3300003791 | Bacteria | 11111 |
| 21 | Ga0055530_10007278 | 3300003791 | Bacteria | 4697 |
| 22 | Ga0055540_1017257 | 3300003792 | Bacteria | 2020 |
| 23 | Ga0055531_10002857 | 3300003794 | Bacteria | 11263 |
| 24 | Ga0055531_10021694 | 3300003794 | Bacteria | 2480 |
| 25 | Ga0070658_10057638 | 3300005327 | Bacteria | 3160 |
| 26 | Ga0070676_10528254 | 3300005328 | Bacteria | 842 |
| 27 | Ga0070683_100142437 | 3300005329 | Bacteria | 2271 |
| 28 | Ga0070690_101167641 | 3300005330 | Bacteria | 613 |
| 29 | Ga0068869_100686999 | 3300005334 | Bacteria | 872 |
| 30 | Ga0070666_10000487 | 3300005335 | Bacteria | 23992 |
| 31 | Ga0070666_10796171 | 3300005335 | Bacteria | 696 |
| 32 | Ga0070680_100000582 | 3300005336 | Bacteria | 25199 |
| 33 | Ga0070680_100568292 | 3300005336 | Bacteria | 972 |
| 34 | Ga0070682_100757472 | 3300005337 | Bacteria | 784 |
| 35 | Ga0070660_100080578 | 3300005339 | Bacteria | 2555 |
| 36 | Ga0070661_100137980 | 3300005344 | Bacteria | 1836 |
| 37 | Ga0070668_100142822 | 3300005347 | Bacteria | 1930 |
| 38 | Ga0070668_100186094 | 3300005347 | Bacteria | 1698 |
| 39 | Ga0070668_100557435 | 3300005347 | Bacteria | 998 |
| 40 | Ga0070669_100148290 | 3300005353 | Bacteria | 1814 |
| 41 | Ga0070671_100031400 | 3300005355 | Bacteria | 4387 |
| 42 | Ga0070673_100433739 | 3300005364 | Bacteria | 1180 |
| 43 | Ga0070659_100058492 | 3300005366 | Bacteria | 3042 |
| 44 | Ga0070659_100194822 | 3300005366 | Bacteria | 1666 |
| 45 | Ga0070659_100424645 | 3300005366 | Bacteria | 1125 |
| 46 | Ga0070667_100231233 | 3300005367 | Bacteria | 1648 |
| 47 | Ga0070667_100244360 | 3300005367 | Bacteria | 1603 |
| 48 | Ga0070709_10024435 | 3300005434 | Bacteria | 3557 |
| 49 | Ga0070709_10297833 | 3300005434 | Bacteria | 1177 |
| 50 | Ga0070713_100533431 | 3300005436 | Bacteria | 1110 |
| 51 | Ga0070711_100719187 | 3300005439 | Bacteria | 842 |
| 52 | Ga0070663_100028812 | 3300005455 | Bacteria | 3786 |
| 53 | Ga0070663_100053496 | 3300005455 | Bacteria | 2882 |
| 54 | Ga0070663_101108360 | 3300005455 | Bacteria | 692 |
| 55 | Ga0070662_100696018 | 3300005457 | Bacteria | 860 |
| 56 | Ga0070681_10003299 | 3300005458 | Bacteria | 15068 |
| 57 | Ga0070681_10128599 | 3300005458 | Bacteria | 2465 |
| 58 | Ga0068867_100068420 | 3300005459 | Bacteria | 2650 |
| 59 | Ga0070679_100003151 | 3300005530 | Bacteria | 15068 |
| 60 | Ga0070679_100697750 | 3300005530 | Bacteria | 958 |
| 61 | Ga0070684_100089335 | 3300005535 | Bacteria | 2738 |
| 62 | Ga0068853_100016385 | 3300005539 | Bacteria | 6099 |
| 63 | Ga0068853_100053738 | 3300005539 | Bacteria | 3469 |
| 64 | Ga0068853_100218568 | 3300005539 | Bacteria | 1739 |
| 65 | Ga0068853_100771040 | 3300005539 | Bacteria | 920 |
| 66 | Ga0070672_101062330 | 3300005543 | Bacteria | 719 |
| 67 | Ga0070696_100019620 | 3300005546 | Bacteria | 4581 |
| 68 | Ga0070665_100000092 | 3300005548 | Bacteria | 174397 |
| 69 | Ga0068855_100066164 | 3300005563 | Bacteria | 4213 |
| 70 | Ga0068855_100804432 | 3300005563 | Bacteria | 999 |
| 71 | Ga0068855_101362137 | 3300005563 | Bacteria | 732 |
| 72 | Ga0070664_100128266 | 3300005564 | Bacteria | 2226 |
| 73 | Ga0068857_100038503 | 3300005577 | Bacteria | 4235 |
| 74 | Ga0068857_100209905 | 3300005577 | Bacteria | 1777 |
| 75 | Ga0068857_100226826 | 3300005577 | Bacteria | 1707 |
| 76 | Ga0068854_100030061 | 3300005578 | Bacteria | 3765 |
| 77 | Ga0068854_100210651 | 3300005578 | Bacteria | 1533 |
| 78 | Ga0068854_100512631 | 3300005578 | Bacteria | 1012 |
| 79 | Ga0068856_100121458 | 3300005614 | Bacteria | 2614 |
| 80 | Ga0068856_100161443 | 3300005614 | Bacteria | 2251 |
| 81 | Ga0068852_100042035 | 3300005616 | Bacteria | 3868 |
| 82 | Ga0068852_100075304 | 3300005616 | Bacteria | 2977 |
| 83 | Ga0068852_100178626 | 3300005616 | Bacteria | 1994 |
| 84 | Ga0068852_100268916 | 3300005616 | Bacteria | 1639 |
| 85 | Ga0068859_100665524 | 3300005617 | Bacteria | 1133 |
| 86 | Ga0068859_100667523 | 3300005617 | Bacteria | 1131 |
| 87 | Ga0068864_100004209 | 3300005618 | Bacteria | 11834 |
| 88 | Ga0068864_100111094 | 3300005618 | Bacteria | 2442 |
| 89 | Ga0068864_100211538 | 3300005618 | Bacteria | 1786 |
| 90 | Ga0068851_10019388 | 3300005834 | Bacteria | 3286 |
| 91 | Ga0068863_100006254 | 3300005841 | Bacteria | 11695 |
| 92 | Ga0068863_100173587 | 3300005841 | Bacteria | 2068 |
| 93 | Ga0068863_100192490 | 3300005841 | Bacteria | 1960 |
| 94 | Ga0068858_100288904 | 3300005842 | Bacteria | 1563 |
| 95 | Ga0068860_100017401 | 3300005843 | Bacteria | 7003 |
| 96 | Ga0068860_100270877 | 3300005843 | Bacteria | 1657 |
| 97 | Ga0068860_100912179 | 3300005843 | Bacteria | 895 |
| 98 | Ga0068862_100437022 | 3300005844 | Bacteria | 1231 |
| 99 | Ga0075368_10393426 | 3300006042 | Bacteria | 608 |
| 100 | Ga0075364_10044264 | 3300006051 | Bacteria | 2895 |
| 101 | Ga0075367_10005201 | 3300006178 | Bacteria | 6433 |
| 102 | Ga0097621_100180729 | 3300006237 | Bacteria | 1823 |
| 103 | Ga0097621_100937885 | 3300006237 | Unclassified | 807 |
| 104 | Ga0097621_101366427 | 3300006237 | Bacteria | 670 |
| 105 | Ga0068871_100040170 | 3300006358 | Bacteria | 3747 |
| 106 | Ga0068871_100065158 | 3300006358 | Bacteria | 2984 |
| 107 | Ga0068871_100231117 | 3300006358 | Bacteria | 1605 |
| 108 | Ga0068871_100248883 | 3300006358 | Bacteria | 1547 |
| 109 | Ga0068871_100522659 | 3300006358 | Bacteria | 1072 |
| 110 | Ga0068871_100808254 | 3300006358 | Bacteria | 865 |
| 111 | Ga0068871_101688111 | 3300006358 | Bacteria | 600 |
| 112 | Ga0068865_100004889 | 3300006881 | Bacteria | 8101 |
| 113 | Ga0097620_100665493 | 3300006931 | Bacteria | 1133 |
| 114 | Ga0097620_100667404 | 3300006931 | Bacteria | 1131 |
| 115 | Ga0099826_10191757 | 3300006948 | Bacteria | 1127 |
| 116 | Ga0105251_10006537 | 3300009011 | Bacteria | 7395 |
| 117 | Ga0105244_10158075 | 3300009036 | Bacteria | 1083 |
| 118 | Ga0105240_10040352 | 3300009093 | Bacteria | 5971 |
| 119 | Ga0105240_10092747 | 3300009093 | Bacteria | 3687 |
| 120 | Ga0105240_10152926 | 3300009093 | Bacteria | 2746 |
| 121 | Ga0105240_10880220 | 3300009093 | Bacteria | 965 |
| 122 | Ga0105245_10039307 | 3300009098 | Bacteria | 4211 |
| 123 | Ga0105245_10286466 | 3300009098 | Bacteria | 1612 |
| 124 | Ga0105245_10467241 | 3300009098 | Bacteria | 1273 |
| 125 | Ga0105245_10912161 | 3300009098 | Bacteria | 920 |
| 126 | Ga0105241_10021278 | 3300009174 | Bacteria | 4793 |
| 127 | Ga0105241_10094532 | 3300009174 | Bacteria | 2364 |
| 128 | Ga0105241_10340325 | 3300009174 | Bacteria | 1299 |
| 129 | Ga0105241_10642918 | 3300009174 | Bacteria | 963 |
| 130 | Ga0105242_10012218 | 3300009176 | Bacteria | 6610 |
| 131 | Ga0105237_10155336 | 3300009545 | Bacteria | 2284 |
| 132 | Ga0105237_11023099 | 3300009545 | Bacteria | 833 |
| 133 | Ga0105237_11074482 | 3300009545 | Bacteria | 812 |
| 134 | Ga0105238_10046014 | 3300009551 | Bacteria | 4407 |
| 135 | Ga0105238_10049996 | 3300009551 | Bacteria | 4209 |
| 136 | Ga0105238_10138581 | 3300009551 | Bacteria | 2410 |
| 137 | Ga0105238_10659351 | 3300009551 | Bacteria | 1057 |
| 138 | Ga0105239_10050230 | 3300010375 | Bacteria | 4575 |
| 139 | Ga0105239_10073582 | 3300010375 | Bacteria | 3756 |
| 140 | Ga0105239_10761847 | 3300010375 | Bacteria | 1108 |
| 141 | Ga0105239_11848295 | 3300010375 | Bacteria | 700 |
| 142 | Ga0105246_10011815 | 3300011119 | Bacteria | 5427 |
| 143 | Ga0157373_10006648 | 3300013100 | Bacteria | 8613 |
| 144 | Ga0157370_10001293 | 3300013104 | Bacteria | 31203 |
| 145 | Ga0157370_10002303 | 3300013104 | Bacteria | 23111 |
| 146 | Ga0157370_10519422 | 3300013104 | Bacteria | 1093 |
| 147 | Ga0157370_10645111 | 3300013104 | Bacteria | 968 |
| 148 | Ga0157369_10000001 | 3300013105 | Bacteria | 554908 |
| 149 | Ga0157369_10124679 | 3300013105 | Bacteria | 2732 |
| 150 | Ga0157369_10264932 | 3300013105 | Bacteria | 1792 |
| 151 | Ga0157369_10631295 | 3300013105 | Bacteria | 1105 |
| 152 | Ga0157374_10189274 | 3300013296 | Bacteria | 2013 |
| 153 | Ga0157378_10408304 | 3300013297 | Bacteria | 1340 |
| 154 | Ga0157378_10609073 | 3300013297 | Bacteria | 1104 |
| 155 | Ga0163162_10043381 | 3300013306 | Bacteria | 4503 |
| 156 | Ga0163162_11612043 | 3300013306 | Bacteria | 740 |
| 157 | Ga0157372_10044203 | 3300013307 | Bacteria | 4935 |
| 158 | Ga0157372_10056619 | 3300013307 | Bacteria | 4380 |
| 159 | Ga0157372_10123346 | 3300013307 | Bacteria | 2978 |
| 160 | Ga0157372_11067992 | 3300013307 | Bacteria | 934 |
| 161 | Ga0157375_10000675 | 3300013308 | Bacteria | 30223 |
| 162 | Ga0157375_11822700 | 3300013308 | Bacteria | 721 |
| 163 | Ga0157375_12716674 | 3300013308 | Bacteria | 592 |
| 164 | Ga0163163_10000112 | 3300014325 | Bacteria | 86324 |
| 165 | Ga0163163_10000585 | 3300014325 | Bacteria | 32121 |
| 166 | Ga0163163_10119878 | 3300014325 | Bacteria | 2664 |
| 167 | Ga0182008_10000084 | 3300014497 | Bacteria | 72998 |
| 168 | Ga0182008_10006699 | 3300014497 | Bacteria | 6412 |
| 169 | Ga0157379_10007853 | 3300014968 | Bacteria | 9242 |
| 170 | Ga0157379_10604651 | 3300014968 | Bacteria | 1024 |
| 171 | Ga0157379_11373490 | 3300014968 | Bacteria | 684 |
| 172 | Ga0157376_10157556 | 3300014969 | Bacteria | 2055 |
| 173 | Ga0157376_10165117 | 3300014969 | Bacteria | 2011 |
| 174 | Ga0157376_10563632 | 3300014969 | Bacteria | 1129 |
| 175 | Ga0182006_1010206 | 3300015261 | Bacteria | 4185 |
| 176 | Ga0182006_1092154 | 3300015261 | Bacteria | 1088 |
| 177 | Ga0182007_10000060 | 3300015262 | Bacteria | 88258 |
| 178 | Ga0182005_1000421 | 3300015265 | Bacteria | 22901 |
| 179 | Ga0163161_10003404 | 3300017792 | Bacteria | 11160 |
| 180 | Ga0163161_10144503 | 3300017792 | Bacteria | 1803 |
| 181 | Ga0163161_10153076 | 3300017792 | Bacteria | 1754 |
| 182 | Ga0163161_10229818 | 3300017792 | Bacteria | 1439 |
| 183 | Ga0206354_10119145 | 3300020081 | Bacteria | 1756 |
| 184 | Ga0207425_1012369 | 3300025245 | Bacteria | 2005 |
| 185 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 186 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 187 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 188 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 189 | Ga0209673_1013309 | 3300025273 | Bacteria | 3253 |
| 190 | Ga0209130_1005313 | 3300025284 | Bacteria | 4515 |
| 191 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 192 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 193 | Ga0209675_1007097 | 3300025291 | Bacteria | 4358 |
| 194 | Ga0209675_1025045 | 3300025291 | Bacteria | 1512 |
| 195 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 196 | Ga0209676_1001321 | 3300025292 | Bacteria | 25097 |
| 197 | Ga0209676_1002606 | 3300025292 | Bacteria | 12366 |
| 198 | Ga0209676_1002880 | 3300025292 | Bacteria | 11320 |
| 199 | Ga0209676_1003992 | 3300025292 | Bacteria | 8519 |
| 200 | Ga0209025_1001895 | 3300025294 | Bacteria | 24398 |
| 201 | Ga0209025_1003656 | 3300025294 | Bacteria | 14253 |
| 202 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 203 | Ga0209564_1000210 | 3300025295 | Bacteria | 133323 |
| 204 | Ga0209050_1001000 | 3300025298 | Bacteria | 35489 |
| 205 | Ga0209050_1001322 | 3300025298 | Bacteria | 27684 |
| 206 | Ga0209050_1001688 | 3300025298 | Bacteria | 22135 |
| 207 | Ga0209050_1020324 | 3300025298 | Bacteria | 2474 |
| 208 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 209 | Ga0209256_1005518 | 3300025299 | Bacteria | 7236 |
| 210 | Ga0209256_1006467 | 3300025299 | Bacteria | 6181 |
| 211 | Ga0209256_1018437 | 3300025299 | Bacteria | 2267 |
| 212 | Ga0209051_1001347 | 3300025303 | Bacteria | 21327 |
| 213 | Ga0209051_1002391 | 3300025303 | Bacteria | 13542 |
| 214 | Ga0209257_1000086 | 3300025304 | Bacteria | 287437 |
| 215 | Ga0209257_1000787 | 3300025304 | Bacteria | 46608 |
| 216 | Ga0209257_1002744 | 3300025304 | Bacteria | 16691 |
| 217 | Ga0209257_1002831 | 3300025304 | Bacteria | 16284 |
| 218 | Ga0209257_1003134 | 3300025304 | Bacteria | 14754 |
| 219 | Ga0209257_1004658 | 3300025304 | Bacteria | 10339 |
| 220 | Ga0209257_1008390 | 3300025304 | Bacteria | 5889 |
| 221 | Ga0209257_1124319 | 3300025304 | Bacteria | 599 |
| 222 | Ga0207656_10021793 | 3300025321 | Bacteria | 2564 |
| 223 | Ga0207655_1064832 | 3300025728 | Bacteria | 1390 |
| 224 | Ga0207680_10000598 | 3300025903 | Bacteria | 17011 |
| 225 | Ga0207647_10002208 | 3300025904 | Bacteria | 14832 |
| 226 | Ga0207699_10389201 | 3300025906 | Bacteria | 991 |
| 227 | Ga0207645_10038862 | 3300025907 | Bacteria | 3050 |
| 228 | Ga0207705_10037183 | 3300025909 | Bacteria | 3483 |
| 229 | Ga0207705_10041202 | 3300025909 | Bacteria | 3313 |
| 230 | Ga0207707_10000146 | 3300025912 | Bacteria | 73614 |
| 231 | Ga0207707_10053049 | 3300025912 | Bacteria | 3529 |
| 232 | Ga0207695_10003607 | 3300025913 | Bacteria | 21652 |
| 233 | Ga0207695_10031094 | 3300025913 | Bacteria | 5864 |
| 234 | Ga0207695_10063232 | 3300025913 | Bacteria | 3816 |
| 235 | Ga0207695_10383888 | 3300025913 | Bacteria | 1290 |
| 236 | Ga0207671_10007138 | 3300025914 | Bacteria | 9746 |
| 237 | Ga0207663_10123363 | 3300025916 | Bacteria | 1778 |
| 238 | Ga0207663_10964753 | 3300025916 | Bacteria | 683 |
| 239 | Ga0207660_10000676 | 3300025917 | Bacteria | 22769 |
| 240 | Ga0207660_10001813 | 3300025917 | Bacteria | 14233 |
| 241 | Ga0207657_10002836 | 3300025919 | Bacteria | 18613 |
| 242 | Ga0207657_10029430 | 3300025919 | Bacteria | 5000 |
| 243 | Ga0207657_10041210 | 3300025919 | Bacteria | 4084 |
| 244 | Ga0207649_10113639 | 3300025920 | Bacteria | 1814 |
| 245 | Ga0207649_10199837 | 3300025920 | Bacteria | 1411 |
| 246 | Ga0207652_10000084 | 3300025921 | Bacteria | 101874 |
| 247 | Ga0207652_10008959 | 3300025921 | Bacteria | 8065 |
| 248 | Ga0207652_10333672 | 3300025921 | Bacteria | 1369 |
| 249 | Ga0207681_10127555 | 3300025923 | Bacteria | 1876 |
| 250 | Ga0207681_10649266 | 3300025923 | Bacteria | 875 |
| 251 | Ga0207694_10070662 | 3300025924 | Bacteria | 2728 |
| 252 | Ga0207694_10594962 | 3300025924 | Bacteria | 930 |
| 253 | Ga0207650_11295193 | 3300025925 | Bacteria | 620 |
| 254 | Ga0207687_10022314 | 3300025927 | Bacteria | 4211 |
| 255 | Ga0207687_10341692 | 3300025927 | Bacteria | 1217 |
| 256 | Ga0207700_10528283 | 3300025928 | Bacteria | 1046 |
| 257 | Ga0207690_10235728 | 3300025932 | Bacteria | 1407 |
| 258 | Ga0207706_10133414 | 3300025933 | Bacteria | 2184 |
| 259 | Ga0207706_10207804 | 3300025933 | Bacteria | 1716 |
| 260 | Ga0207706_10395886 | 3300025933 | Bacteria | 1198 |
| 261 | Ga0207686_10029773 | 3300025934 | Bacteria | 3225 |
| 262 | Ga0207670_10475966 | 3300025936 | Bacteria | 1011 |
| 263 | Ga0207704_10045400 | 3300025938 | Bacteria | 2610 |
| 264 | Ga0207704_10842285 | 3300025938 | Bacteria | 768 |
| 265 | Ga0207689_10144046 | 3300025942 | Bacteria | 1963 |
| 266 | Ga0207661_10373039 | 3300025944 | Bacteria | 1290 |
| 267 | Ga0207661_10698846 | 3300025944 | Bacteria | 933 |
| 268 | Ga0207679_10054898 | 3300025945 | Bacteria | 2935 |
| 269 | Ga0207679_10624077 | 3300025945 | Bacteria | 973 |
| 270 | Ga0207667_10007024 | 3300025949 | Bacteria | 13600 |
| 271 | Ga0207667_10055758 | 3300025949 | Bacteria | 4153 |
| 272 | Ga0207667_10204493 | 3300025949 | Bacteria | 2025 |
| 273 | Ga0207667_11325522 | 3300025949 | Bacteria | 695 |
| 274 | Ga0207651_10620468 | 3300025960 | Bacteria | 947 |
| 275 | Ga0207668_11024692 | 3300025972 | Bacteria | 738 |
| 276 | Ga0207640_10001128 | 3300025981 | Bacteria | 14684 |
| 277 | Ga0207640_10014621 | 3300025981 | Bacteria | 4522 |
| 278 | Ga0207658_10023690 | 3300025986 | Bacteria | 4288 |
| 279 | Ga0207658_10390331 | 3300025986 | Bacteria | 1221 |
| 280 | Ga0207703_10176324 | 3300026035 | Bacteria | 1883 |
| 281 | Ga0207639_10007555 | 3300026041 | Bacteria | 7414 |
| 282 | Ga0207678_10020270 | 3300026067 | Bacteria | 5834 |
| 283 | Ga0207678_10027074 | 3300026067 | Bacteria | 5000 |
| 284 | Ga0207678_10166502 | 3300026067 | Bacteria | 1882 |
| 285 | Ga0207678_10183136 | 3300026067 | Bacteria | 1789 |
| 286 | Ga0207702_10005423 | 3300026078 | Bacteria | 11165 |
| 287 | Ga0207702_10498199 | 3300026078 | Bacteria | 1187 |
| 288 | Ga0207641_10367693 | 3300026088 | Bacteria | 1374 |
| 289 | Ga0207648_10173825 | 3300026089 | Bacteria | 1904 |
| 290 | Ga0207648_10497745 | 3300026089 | Bacteria | 1115 |
| 291 | Ga0207676_10038682 | 3300026095 | Bacteria | 3643 |
| 292 | Ga0207676_10046848 | 3300026095 | Bacteria | 3348 |
| 293 | Ga0207674_10002886 | 3300026116 | Bacteria | 21357 |
| 294 | Ga0207674_10046326 | 3300026116 | Bacteria | 4465 |
| 295 | Ga0207698_10051344 | 3300026142 | Bacteria | 3152 |
| 296 | Ga0207698_10511574 | 3300026142 | Bacteria | 1170 |
| 297 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 298 | Ga0268266_10054421 | 3300028379 | Bacteria | 3438 |
| 299 | Ga0268266_10086831 | 3300028379 | Bacteria | 2735 |
| 300 | Ga0268266_10446606 | 3300028379 | Bacteria | 1229 |
| 301 | Ga0268265_10190399 | 3300028380 | Bacteria | 1771 |
| 302 | Ga0268264_10003031 | 3300028381 | Bacteria | 14566 |
| 303 | Ga0268264_10077764 | 3300028381 | Bacteria | 2827 |
| 304 | Ga0268264_10296646 | 3300028381 | Bacteria | 1520 |
| 305 | Ga0316176_1053738 | 3300030732 | Bacteria | 1840 |
| 306 | Ga0314311_1109848 | 3300030733 | Bacteria | 1035 |
| 307 | Ga0316182_1371761 | 3300030745 | Bacteria | 1006 |
| 308 | Ga0307513_10009721 | 3300031456 | Bacteria | 12153 |
| 309 | Ga0307513_10106363 | 3300031456 | Bacteria | 2812 |
| 310 | Ga0307513_10342646 | 3300031456 | Bacteria | 1245 |
| 311 | Ga0307408_100128425 | 3300031548 | Bacteria | 1974 |
| 312 | Ga0307408_100637053 | 3300031548 | Bacteria | 951 |
| 313 | Ga0307516_10231023 | 3300031730 | Bacteria | 1553 |
| 314 | Ga0307405_10570977 | 3300031731 | Bacteria | 918 |
| 315 | Ga0307405_10602492 | 3300031731 | Bacteria | 897 |
| 316 | Ga0307413_10048178 | 3300031824 | Bacteria | 2546 |
| 317 | Ga0307413_10203386 | 3300031824 | Bacteria | 1432 |
| 318 | Ga0307413_10872122 | 3300031824 | Bacteria | 762 |
| 319 | Ga0307413_11274197 | 3300031824 | Bacteria | 642 |
| 320 | Ga0307406_10005878 | 3300031901 | Bacteria | 6732 |
| 321 | Ga0307407_10236064 | 3300031903 | Bacteria | 1245 |
| 322 | Ga0307412_11123344 | 3300031911 | Bacteria | 700 |
| 323 | Ga0307416_100117487 | 3300032002 | Bacteria | 2361 |
| 324 | Ga0307416_100124835 | 3300032002 | Bacteria | 2304 |
| 325 | Ga0307416_100294936 | 3300032002 | Bacteria | 1608 |
| 326 | Ga0307416_100357438 | 3300032002 | Bacteria | 1481 |
| 327 | Ga0307414_10050399 | 3300032004 | Bacteria | 2884 |
| 328 | Ga0307414_10177091 | 3300032004 | Bacteria | 1711 |
| 329 | Ga0307414_10228356 | 3300032004 | Bacteria | 1533 |
| 330 | Ga0307414_10253829 | 3300032004 | Bacteria | 1463 |
| 331 | Ga0307414_10335657 | 3300032004 | Bacteria | 1292 |
| 332 | Ga0307414_10385843 | 3300032004 | Bacteria | 1212 |
| 333 | Ga0307414_10416047 | 3300032004 | Bacteria | 1171 |
| 334 | Ga0307414_10520523 | 3300032004 | Bacteria | 1055 |
| 335 | Ga0307411_10018060 | 3300032005 | Bacteria | 4037 |
| 336 | Ga0307411_10516004 | 3300032005 | Bacteria | 1013 |
| 337 | Ga0307411_11663912 | 3300032005 | Bacteria | 590 |
| 338 | Ga0307411_11763537 | 3300032005 | Bacteria | 574 |
| 339 | Ga0307415_100367198 | 3300032126 | Bacteria | 1217 |
| 340 | Ga0307415_100409390 | 3300032126 | Bacteria | 1160 |
| 341 | Ga0373927_0572581 | 3300035695 | Bacteria | 746 |
| 342 | Ga0373933_0603539 | 3300035724 | Bacteria | 721 |
| 343 | Ga0373937_0156456 | 3300036401 | Bacteria | 2136 |
| 344 | Ga0373925_0063447 | 3300037068 | Bacteria | 2780 |
| 345 | Ga0395905_0242318 | 3300037471 | Bacteria | 1685 |
| 346 | Ga0439436_0014434 | 3300041404 | Bacteria | 2383 |
| 347 | Ga0439436_0026940 | 3300041404 | Bacteria | 1683 |
| 348 | Ga0439439_0012251 | 3300041406 | Bacteria | 2072 |
| 349 | Ga0439439_0021225 | 3300041406 | Bacteria | 1618 |
| 350 | Ga0439439_0042155 | 3300041406 | Bacteria | 1185 |
| 351 | Ga0439465_0008753 | 3300041413 | Bacteria | 3189 |
| 352 | Ga0439465_0010904 | 3300041413 | Bacteria | 2851 |
| 353 | Ga0439465_0287416 | 3300041413 | Bacteria | 613 |
| 354 | Ga0451789_0966542 | 3300041443 | Bacteria | 552 |
| 355 | Ga0451797_0088711 | 3300041453 | Bacteria | 677 |
| 356 | Ga0451833_1184932 | 3300041491 | Bacteria | 994 |
| 357 | Ga0451837_1457555 | 3300041494 | Bacteria | 1539 |
| 358 | Ga0451841_1204927 | 3300041498 | Bacteria | 1235 |
| 359 | Ga0451843_1369231 | 3300041509 | Bacteria | 1199 |
| 360 | Ga0451853_1403713 | 3300041512 | Bacteria | 1844 |
| 361 | Ga0451853_1931247 | 3300041512 | Bacteria | 889 |
| 362 | Ga0439433_0041699 | 3300041999 | Bacteria | 1070 |
| 363 | Ga0439432_013875 | 3300042006 | Bacteria | 2732 |
| 364 | Ga0439432_063813 | 3300042006 | Bacteria | 1131 |
| 365 | Ga0439432_101543 | 3300042006 | Bacteria | 860 |
| 366 | Ga0439432_132878 | 3300042006 | Bacteria | 734 |
| 367 | Ga0439449_0006386 | 3300042007 | Bacteria | 4509 |
| 368 | Ga0439449_0109812 | 3300042007 | Bacteria | 1021 |
| 369 | Ga0439449_0216024 | 3300042007 | Bacteria | 718 |
| 370 | Ga0439462_0016609 | 3300042015 | Bacteria | 1903 |
| 371 | Ga0439434_0025767 | 3300042435 | Bacteria | 1776 |
| 372 | Ga0495638_0006777 | 3300046460 | Bacteria | 8286 |
| 373 | Ga0495638_0014382 | 3300046460 | Bacteria | 5351 |
| 374 | Ga0495638_0056420 | 3300046460 | Bacteria | 2437 |
| 375 | Ga0495638_0162900 | 3300046460 | Bacteria | 1285 |
| 376 | Ga0495582_0022836 | 3300046473 | Bacteria | 3422 |
| 377 | Ga0495616_0072228 | 3300046513 | Bacteria | 1667 |
| 378 | Ga0495628_0289744 | 3300046516 | Bacteria | 1214 |
| 379 | Ga0495643_0001835 | 3300046522 | Bacteria | 18063 |
| 380 | Ga0495643_0333888 | 3300046522 | Bacteria | 683 |
| 381 | Ga0495663_0000485 | 3300046525 | Bacteria | 14449 |
| 382 | Ga0495663_0000914 | 3300046525 | Bacteria | 9862 |
| 383 | Ga0495665_0304763 | 3300046531 | Bacteria | 815 |
| 384 | Ga0495587_0104875 | 3300046536 | Bacteria | 1627 |
| 385 | Ga0495633_0138389 | 3300046558 | Bacteria | 1126 |
| 386 | Ga0495625_0105857 | 3300046660 | Bacteria | 1926 |
| 387 | Ga0495625_0110158 | 3300046660 | Bacteria | 1882 |
| 388 | Ga0495635_0099496 | 3300046663 | Bacteria | 1988 |
| 389 | Ga0495658_0025135 | 3300046683 | Bacteria | 3181 |
| 390 | Ga0495671_0032292 | 3300046692 | Bacteria | 2673 |
| 391 | Ga0495674_1160078 | 3300047319 | Bacteria | 586 |
| 392 | Ga0495672_0001556 | 3300047320 | Bacteria | 22458 |
| 393 | Ga0495686_0082597 | 3300047472 | Bacteria | 1960 |
| 394 | Ga0496100_0025856 | 3300048903 | Bacteria | 3593 |
| 395 | Ga0496104_0000012 | 3300048907 | Bacteria | 438011 |
| 396 | Ga0496105_0000032 | 3300048908 | Bacteria | 135801 |
| 397 | Ga0496113_0350055 | 3300048916 | Bacteria | 1185 |
| 398 | Ga0496114_0930648 | 3300048917 | Bacteria | 751 |
| 399 | Ga0496115_0747285 | 3300048918 | Bacteria | 765 |
| 400 | Ga0496116_0083618 | 3300048919 | Bacteria | 1969 |
| 401 | Ga0496116_0084783 | 3300048919 | Bacteria | 1950 |
| 402 | Ga0496117_0004764 | 3300048920 | Bacteria | 14721 |
| 403 | Ga0496118_0004204 | 3300048921 | Bacteria | 17306 |
| 404 | Ga0496118_0004296 | 3300048921 | Bacteria | 17034 |
| 405 | Ga0496118_0010793 | 3300048921 | Bacteria | 9003 |
| 406 | Ga0496118_0010794 | 3300048921 | Bacteria | 9002 |
| 407 | Ga0496121_0044131 | 3300048924 | Bacteria | 3850 |
| 408 | Ga0496122_0072047 | 3300048925 | Bacteria | 2459 |
| 409 | Ga0496122_0094712 | 3300048925 | Bacteria | 2020 |
| 410 | Ga0496122_0116918 | 3300048925 | Bacteria | 1733 |
| 411 | Ga0496122_0155091 | 3300048925 | Bacteria | 1406 |
| 412 | Ga0496123_0004282 | 3300048926 | Bacteria | 15181 |
| 413 | Ga0496123_0007695 | 3300048926 | Bacteria | 10063 |
| 414 | Ga0496123_0045387 | 3300048926 | Bacteria | 2994 |
| 415 | Ga0496124_0002535 | 3300048927 | Bacteria | 23710 |
| 416 | Ga0496124_0005775 | 3300048927 | Bacteria | 13772 |
| 417 | Ga0496124_0011580 | 3300048927 | Bacteria | 8801 |
| 418 | Ga0496124_0235171 | 3300048927 | Bacteria | 1366 |
| 419 | Ga0496124_0253353 | 3300048927 | Bacteria | 1300 |
| 420 | Ga0496125_0006793 | 3300048928 | Bacteria | 12288 |
| 421 | Ga0496125_0007934 | 3300048928 | Bacteria | 11210 |
| 422 | Ga0496125_0050417 | 3300048928 | Bacteria | 3446 |
| 423 | Ga0496125_0216964 | 3300048928 | Bacteria | 1236 |
| 424 | Ga0496126_0052949 | 3300048929 | Bacteria | 3685 |
| 425 | Ga0496126_0074047 | 3300048929 | Bacteria | 3025 |
| 426 | Ga0496126_0159770 | 3300048929 | Bacteria | 1926 |
| 427 | Ga0501031_0033784 | 3300049568 | Bacteria | 3339 |
| 428 | Ga0501031_0179292 | 3300049568 | Bacteria | 1384 |
| 429 | Ga0501032_0003925 | 3300049569 | Bacteria | 11289 |
| 430 | Ga0501032_0045378 | 3300049569 | Bacteria | 2972 |
| 431 | Ga0501033_0001369 | 3300049570 | Bacteria | 21743 |
| 432 | Ga0501033_0003778 | 3300049570 | Bacteria | 12306 |
| 433 | Ga0501033_0260447 | 3300049570 | Bacteria | 1227 |
| 434 | Ga0501033_0657675 | 3300049570 | Bacteria | 715 |
| 435 | Ga0501034_0001709 | 3300049571 | Bacteria | 28248 |
| 436 | Ga0501034_0003104 | 3300049571 | Bacteria | 19154 |
| 437 | Ga0501034_0006620 | 3300049571 | Bacteria | 12432 |
| 438 | Ga0501034_0023513 | 3300049571 | Bacteria | 6279 |
| 439 | Ga0501034_0053395 | 3300049571 | Bacteria | 4069 |
| 440 | Ga0501034_0054601 | 3300049571 | Bacteria | 4021 |
| 441 | Ga0501034_0574717 | 3300049571 | Bacteria | 1034 |
| 442 | Ga0501036_0018039 | 3300049572 | Bacteria | 5907 |
| 443 | Ga0501036_0394918 | 3300049572 | Bacteria | 1154 |
| 444 | Ga0501036_0398902 | 3300049572 | Bacteria | 1147 |
| 445 | Ga0501036_0445524 | 3300049572 | Bacteria | 1079 |
| 446 | Ga0501036_0619410 | 3300049572 | Bacteria | 897 |
| 447 | Ga0501037_0018053 | 3300049573 | Bacteria | 5196 |
| 448 | Ga0501037_0036022 | 3300049573 | Bacteria | 3647 |
| 449 | Ga0501037_0269449 | 3300049573 | Bacteria | 1188 |
| 450 | Ga0501037_0362009 | 3300049573 | Bacteria | 999 |
| 451 | Ga0501037_0363525 | 3300049573 | Bacteria | 997 |
| 452 | Ga0501037_0684654 | 3300049573 | Bacteria | 683 |
| 453 | Ga0501038_0003076 | 3300049574 | Bacteria | 15552 |
| 454 | Ga0501038_0015538 | 3300049574 | Bacteria | 6920 |
| 455 | Ga0501039_0005931 | 3300049575 | Bacteria | 9255 |
| 456 | Ga0501039_0219262 | 3300049575 | Bacteria | 1495 |
| 457 | Ga0501040_0065684 | 3300049576 | Bacteria | 2499 |
| 458 | Ga0501042_0250892 | 3300049578 | Bacteria | 1277 |
| 459 | Ga0501043_0010472 | 3300049579 | Bacteria | 7263 |
| 460 | Ga0501043_0169927 | 3300049579 | Bacteria | 1701 |
| 461 | Ga0501043_0276634 | 3300049579 | Bacteria | 1287 |
| 462 | Ga0501046_0003886 | 3300049580 | Bacteria | 13666 |
| 463 | Ga0501046_0027669 | 3300049580 | Bacteria | 4624 |
| 464 | Ga0501046_0101993 | 3300049580 | Bacteria | 2200 |
| 465 | Ga0501046_0234302 | 3300049580 | Bacteria | 1355 |
| 466 | Ga0501046_0262061 | 3300049580 | Bacteria | 1270 |
| 467 | Ga0501046_0453991 | 3300049580 | Bacteria | 921 |
| 468 | Ga0501047_0002093 | 3300049581 | Bacteria | 19094 |
| 469 | Ga0501047_0003063 | 3300049581 | Bacteria | 15848 |
| 470 | Ga0501047_0290931 | 3300049581 | Bacteria | 1477 |
| 471 | Ga0501047_0306993 | 3300049581 | Bacteria | 1428 |
| 472 | Ga0501047_0312531 | 3300049581 | Bacteria | 1411 |
| 473 | Ga0501047_0352465 | 3300049581 | Bacteria | 1308 |
| 474 | Ga0501047_1086554 | 3300049581 | Bacteria | 613 |
| 475 | Ga0501048_0042444 | 3300049582 | Bacteria | 3256 |
| 476 | Ga0501067_0000583 | 3300049583 | Bacteria | 19798 |
| 477 | Ga0501067_0002819 | 3300049583 | Bacteria | 9564 |
| 478 | Ga0501067_0326358 | 3300049583 | Bacteria | 855 |
| 479 | Ga0501068_0029797 | 3300049584 | Bacteria | 3234 |
| 480 | Ga0501068_0184873 | 3300049584 | Bacteria | 1318 |
| 481 | Ga0501069_0002178 | 3300049585 | Bacteria | 9867 |
| 482 | Ga0501069_0013764 | 3300049585 | Bacteria | 4316 |
| 483 | Ga0501069_0022289 | 3300049585 | Bacteria | 3443 |
| 484 | Ga0501069_0138008 | 3300049585 | Bacteria | 1398 |
| 485 | Ga0501070_0022458 | 3300049586 | Bacteria | 5284 |
| 486 | Ga0501070_0061919 | 3300049586 | Bacteria | 3099 |
| 487 | Ga0501070_0066254 | 3300049586 | Bacteria | 2990 |
| 488 | Ga0501070_0340871 | 3300049586 | Bacteria | 1217 |
| 489 | Ga0501070_0598102 | 3300049586 | Bacteria | 879 |
| 490 | Ga0501071_0008797 | 3300049587 | Bacteria | 6689 |
| 491 | Ga0501071_0125145 | 3300049587 | Bacteria | 1907 |
| 492 | Ga0501072_0002507 | 3300049588 | Bacteria | 13756 |
| 493 | Ga0501072_0139019 | 3300049588 | Bacteria | 1936 |
| 494 | Ga0501073_0008095 | 3300049589 | Bacteria | 7799 |
| 495 | Ga0501073_0015945 | 3300049589 | Bacteria | 5445 |
| 496 | Ga0501073_0036928 | 3300049589 | Bacteria | 3470 |
| 497 | Ga0501073_0058739 | 3300049589 | Bacteria | 2688 |
| 498 | Ga0501073_0159283 | 3300049589 | Bacteria | 1564 |
| 499 | Ga0501073_0240835 | 3300049589 | Bacteria | 1249 |
| 500 | Ga0501073_0495901 | 3300049589 | Bacteria | 844 |
| 501 | Ga0501073_0640827 | 3300049589 | Bacteria | 733 |
| 502 | Ga0501074_0003499 | 3300049590 | Bacteria | 11147 |
| 503 | Ga0501074_0005938 | 3300049590 | Bacteria | 8802 |
| 504 | Ga0501074_0062333 | 3300049590 | Bacteria | 2685 |
| 505 | Ga0501074_0065446 | 3300049590 | Bacteria | 2616 |
| 506 | Ga0501074_0223444 | 3300049590 | Bacteria | 1340 |
| 507 | Ga0501074_0335234 | 3300049590 | Bacteria | 1073 |
| 508 | Ga0501076_0554827 | 3300049592 | Bacteria | 947 |
| 509 | Ga0501077_0304286 | 3300049593 | Bacteria | 1016 |
| 510 | Ga0501079_0023751 | 3300049741 | Bacteria | 4704 |
| 511 | Ga0501079_0026319 | 3300049741 | Bacteria | 4461 |
| 512 | Ga0501079_0084900 | 3300049741 | Bacteria | 2449 |
| 513 | Ga0501079_0173661 | 3300049741 | Bacteria | 1680 |
| 514 | Ga0501079_0419027 | 3300049741 | Bacteria | 1051 |
| 515 | Ga0501080_0000256 | 3300049742 | Bacteria | 40148 |
| 516 | Ga0501080_0001893 | 3300049742 | Bacteria | 18018 |
| 517 | Ga0501080_0008868 | 3300049742 | Bacteria | 9143 |
| 518 | Ga0501080_0009555 | 3300049742 | Bacteria | 8853 |
| 519 | Ga0501080_0016829 | 3300049742 | Bacteria | 6753 |
| 520 | Ga0501080_0312935 | 3300049742 | Bacteria | 1423 |
| 521 | Ga0501080_0433568 | 3300049742 | Bacteria | 1179 |
| 522 | Ga0501080_0832949 | 3300049742 | Bacteria | 807 |
| 523 | Ga0501081_0079654 | 3300049743 | Bacteria | 2291 |
| 524 | Ga0501083_0001929 | 3300049744 | Bacteria | 14264 |
| 525 | Ga0501083_0063372 | 3300049744 | Bacteria | 2465 |
| 526 | Ga0501083_0082394 | 3300049744 | Bacteria | 2132 |
| 527 | Ga0501266_009904 | 3300049763 | Bacteria | 1209 |
| 528 | Ga0501035_0019099 | 3300049822 | Bacteria | 6309 |
| 529 | Ga0501035_0084105 | 3300049822 | Bacteria | 2806 |
| 530 | Ga0501035_0084441 | 3300049822 | Bacteria | 2800 |
| 531 | Ga0501035_0118458 | 3300049822 | Bacteria | 2316 |
| 532 | Ga0501035_0290178 | 3300049822 | Bacteria | 1381 |
| 533 | Ga0501035_0739270 | 3300049822 | Bacteria | 790 |
| 534 | Ga0501044_0003272 | 3300049823 | Bacteria | 18232 |
| 535 | Ga0501044_0014368 | 3300049823 | Bacteria | 8550 |
| 536 | Ga0501044_0014551 | 3300049823 | Bacteria | 8488 |
| 537 | Ga0501044_0045639 | 3300049823 | Bacteria | 4540 |
| 538 | Ga0501044_0051011 | 3300049823 | Bacteria | 4267 |
| 539 | Ga0501044_0076742 | 3300049823 | Bacteria | 3390 |
| 540 | Ga0501044_0100985 | 3300049823 | Bacteria | 2903 |
| 541 | Ga0501044_0111078 | 3300049823 | Bacteria | 2749 |
| 542 | Ga0501044_0114409 | 3300049823 | Bacteria | 2704 |
| 543 | Ga0501044_0186880 | 3300049823 | Bacteria | 2036 |
| 544 | Ga0501045_0029231 | 3300049824 | Bacteria | 3982 |
| 545 | nmdc:mga00v17_72407_c1 | 3300050491 | Bacteria | 2138 |
| 546 | nmdc:mga06z11_15223_c1 | 3300050494 | Bacteria | 3428 |
| 547 | Ga0500556_0284571 | 3300053104 | Bacteria | 648 |
| 548 | Ga0500568_0001136 | 3300053139 | Bacteria | 17862 |
| 549 | Ga0500624_075777 | 3300053157 | Bacteria | 664 |
| 550 | Ga0500565_010107 | 3300053734 | Bacteria | 956 |
| 551 | Ga0501084_0025460 | 3300054114 | Bacteria | 4937 |
| 552 | Ga0501084_0169997 | 3300054114 | Bacteria | 1840 |
| 553 | Ga0501084_0204750 | 3300054114 | Bacteria | 1665 |
| 554 | Ga0501084_0291415 | 3300054114 | Bacteria | 1379 |
| 555 | Ga0501084_0593938 | 3300054114 | Bacteria | 935 |
| 556 | Ga0501082_0000141 | 3300060353 | Bacteria | 59767 |
| 557 | Ga0501082_0201301 | 3300060353 | Bacteria | 1732 |
| 558 | Ga0501082_0211016 | 3300060353 | Bacteria | 1689 |
| 559 | Ga0501082_0287069 | 3300060353 | Bacteria | 1432 |
| 560 | Ga0530510_0334839 | 3300061734 | Bacteria | 1136 |
| 561 | 2578459691 | 2576861471 | Bacteria | 4648976 |
| 562 | 2643818364 | 2643221559 | Bacteria | 4424915 |
| 563 | 2643880781 | 2643221573 | Bacteria | 4784121 |
| 564 | 2643905312 | 2643221579 | Bacteria | 4443405 |
| 565 | 2643914994 | 2643221581 | Bacteria | 3893603 |
| 566 | 2643938495 | 2643221586 | Bacteria | 4446529 |
| 567 | 2644079147 | 2643221612 | Bacteria | 4361984 |
| 568 | 2644530553 | 2643221695 | Bacteria | 3441323 |
| 569 | 2644661351 | 2643221720 | Bacteria | 4694283 |
| 570 | 2644693923 | 2643221727 | Bacteria | 4415595 |
| 571 | 2644699430 | 2643221728 | Bacteria | 4797149 |
| 572 | 2842759574 | 2842757796 | Bacteria | 3981385 |
| 573 | 2852652946 | 2852649853 | Bacteria | 4036942 |
| 574 | 2857444433 | 2857442823 | Bacteria | 4562550 |
| 575 | 2919132149 | 2919130084 | Bacteria | 5301837 |
| 576 | 2923517424 | 2923516293 | Bacteria | 3716336 |
| 577 | 2929199112 | 2929195423 | Bacteria | 5325372 |
| 578 | 2939592517 | 2939589442 | Bacteria | 4214238 |
| 579 | 2939624844 | 2939622612 | Bacteria | 4698046 |
| 580 | 2941477434 | 2941475908 | Bacteria | 4145589 |
| 581 | 2974310127 | 2974307012 | Bacteria | 4172388 |
| 582 | 2977250861 | 2977247770 | Bacteria | 4160543 |
| 583 | 2984514652 | 2984514374 | Bacteria | 4172479 |
| 584 | 2987608104 | 2987605356 | Bacteria | 4187822 |
| 585 | 2995949929 | 2995948881 | Bacteria | 6358104 |
| 586 | 8003015227 | 8003014200 | Bacteria | 4059994 |
| 587 | 8021650535 | 8021648035 | Bacteria | 4772378 |
| 588 | Ga0105246_10687606 | |||
| 589 | JGI24741J21665_1002712 | |||
| 590 | rootL2_10062548 | |||
| 591 | Ga0055526_1000005 | |||
| 592 | Ga0055526_1002233 | |||
| 593 | Ga0055537_1000288 | |||
| 594 | Ga0055537_1001737 | |||
| 595 | Ga0055537_1002054 | |||
| 596 | Ga0055524_1000005 | |||
| 597 | Ga0055524_1004724 | |||
| 598 | Ga0055536_1001397 | |||
| 599 | Ga0055536_1002130 | |||
| 600 | Ga0055536_1003244 | |||
| 601 | Ga0055536_1007869 | |||
| 602 | Ga0055534_1000002 | |||
| 603 | Ga0055534_1001086 | |||
| 604 | Ga0055528_1000002 | |||
| 605 | Ga0055528_1001584 | |||
| 606 | Ga0055530_10001810 | |||
| 607 | Ga0055530_10002674 | |||
| 608 | Ga0055530_10007278 | |||
| 609 | Ga0055540_1017257 | |||
| 610 | Ga0055531_10002857 | |||
| 611 | Ga0055531_10021694 | |||
| 612 | Ga0070658_10057638 | |||
| 613 | Ga0070676_10528254 | |||
| 614 | Ga0070683_100142437 | |||
| 615 | Ga0070690_101167641 | |||
| 616 | Ga0068869_100686999 | |||
| 617 | Ga0070666_10000487 | |||
| 618 | Ga0070666_10796171 | |||
| 619 | Ga0070680_100000582 | |||
| 620 | Ga0070680_100568292 | |||
| 621 | Ga0070682_100757472 | |||
| 622 | Ga0070660_100080578 | |||
| 623 | Ga0070661_100137980 | |||
| 624 | Ga0070668_100142822 | |||
| 625 | Ga0070668_100186094 | |||
| 626 | Ga0070668_100557435 | |||
| 627 | Ga0070669_100148290 | |||
| 628 | Ga0070671_100031400 | |||
| 629 | Ga0070673_100433739 | |||
| 630 | Ga0070659_100058492 | |||
| 631 | Ga0070659_100194822 | |||
| 632 | Ga0070659_100424645 | |||
| 633 | Ga0070667_100231233 | |||
| 634 | Ga0070667_100244360 | |||
| 635 | Ga0070709_10024435 | |||
| 636 | Ga0070709_10297833 | |||
| 637 | Ga0070713_100533431 | |||
| 638 | Ga0070711_100719187 | |||
| 639 | Ga0070663_100028812 | |||
| 640 | Ga0070663_100053496 | |||
| 641 | Ga0070663_101108360 | |||
| 642 | Ga0070662_100696018 | |||
| 643 | Ga0070681_10003299 | |||
| 644 | Ga0070681_10128599 | |||
| 645 | Ga0068867_100068420 | |||
| 646 | Ga0070679_100003151 | |||
| 647 | Ga0070679_100697750 | |||
| 648 | Ga0070684_100089335 | |||
| 649 | Ga0068853_100016385 | |||
| 650 | Ga0068853_100053738 | |||
| 651 | Ga0068853_100218568 | |||
| 652 | Ga0068853_100771040 | |||
| 653 | Ga0070672_101062330 | |||
| 654 | Ga0070696_100019620 | |||
| 655 | Ga0070665_100000092 | |||
| 656 | Ga0068855_100066164 | |||
| 657 | Ga0068855_100804432 | |||
| 658 | Ga0068855_101362137 | |||
| 659 | Ga0070664_100128266 | |||
| 660 | Ga0068857_100038503 | |||
| 661 | Ga0068857_100209905 | |||
| 662 | Ga0068857_100226826 | |||
| 663 | Ga0068854_100030061 | |||
| 664 | Ga0068854_100210651 | |||
| 665 | Ga0068854_100512631 | |||
| 666 | Ga0068856_100121458 | |||
| 667 | Ga0068856_100161443 | |||
| 668 | Ga0068852_100042035 | |||
| 669 | Ga0068852_100075304 | |||
| 670 | Ga0068852_100178626 | |||
| 671 | Ga0068852_100268916 | |||
| 672 | Ga0068859_100665524 | |||
| 673 | Ga0068859_100667523 | |||
| 674 | Ga0068864_100004209 | |||
| 675 | Ga0068864_100111094 | |||
| 676 | Ga0068864_100211538 | |||
| 677 | Ga0068851_10019388 | |||
| 678 | Ga0068863_100006254 | |||
| 679 | Ga0068863_100173587 | |||
| 680 | Ga0068863_100192490 | |||
| 681 | Ga0068858_100288904 | |||
| 682 | Ga0068860_100017401 | |||
| 683 | Ga0068860_100270877 | |||
| 684 | Ga0068860_100912179 | |||
| 685 | Ga0068862_100437022 | |||
| 686 | Ga0075368_10393426 | |||
| 687 | Ga0075364_10044264 | |||
| 688 | Ga0075367_10005201 | |||
| 689 | Ga0097621_100180729 | |||
| 690 | Ga0097621_100937885 | |||
| 691 | Ga0097621_101366427 | |||
| 692 | Ga0068871_100040170 | |||
| 693 | Ga0068871_100065158 | |||
| 694 | Ga0068871_100231117 | |||
| 695 | Ga0068871_100248883 | |||
| 696 | Ga0068871_100522659 | |||
| 697 | Ga0068871_100808254 | |||
| 698 | Ga0068871_101688111 | |||
| 699 | Ga0068865_100004889 | |||
| 700 | Ga0097620_100665493 | |||
| 701 | Ga0097620_100667404 | |||
| 702 | Ga0099826_10191757 | |||
| 703 | Ga0105251_10006537 | |||
| 704 | Ga0105244_10158075 | |||
| 705 | Ga0105240_10040352 | |||
| 706 | Ga0105240_10092747 | |||
| 707 | Ga0105240_10152926 | |||
| 708 | Ga0105240_10880220 | |||
| 709 | Ga0105245_10039307 | |||
| 710 | Ga0105245_10286466 | |||
| 711 | Ga0105245_10467241 | |||
| 712 | Ga0105245_10912161 | |||
| 713 | Ga0105241_10021278 | |||
| 714 | Ga0105241_10094532 | |||
| 715 | Ga0105241_10340325 | |||
| 716 | Ga0105241_10642918 | |||
| 717 | Ga0105242_10012218 | |||
| 718 | Ga0105237_10155336 | |||
| 719 | Ga0105237_11023099 | |||
| 720 | Ga0105237_11074482 | |||
| 721 | Ga0105238_10046014 | |||
| 722 | Ga0105238_10049996 | |||
| 723 | Ga0105238_10138581 | |||
| 724 | Ga0105238_10659351 | |||
| 725 | Ga0105239_10050230 | |||
| 726 | Ga0105239_10073582 | |||
| 727 | Ga0105239_10761847 | |||
| 728 | Ga0105239_11848295 | |||
| 729 | Ga0105246_10011815 | |||
| 730 | Ga0157373_10006648 | |||
| 731 | Ga0157370_10001293 | |||
| 732 | Ga0157370_10002303 | |||
| 733 | Ga0157370_10519422 | |||
| 734 | Ga0157370_10645111 | |||
| 735 | Ga0157369_10000001 | |||
| 736 | Ga0157369_10124679 | |||
| 737 | Ga0157369_10264932 | |||
| 738 | Ga0157369_10631295 | |||
| 739 | Ga0157374_10189274 | |||
| 740 | Ga0157378_10408304 | |||
| 741 | Ga0157378_10609073 | |||
| 742 | Ga0163162_10043381 | |||
| 743 | Ga0163162_11612043 | |||
| 744 | Ga0157372_10044203 | |||
| 745 | Ga0157372_10056619 | |||
| 746 | Ga0157372_10123346 | |||
| 747 | Ga0157372_11067992 | |||
| 748 | Ga0157375_10000675 | |||
| 749 | Ga0157375_11822700 | |||
| 750 | Ga0157375_12716674 | |||
| 751 | Ga0163163_10000112 | |||
| 752 | Ga0163163_10000585 | |||
| 753 | Ga0163163_10119878 | |||
| 754 | Ga0182008_10000084 | |||
| 755 | Ga0182008_10006699 | |||
| 756 | Ga0157379_10007853 | |||
| 757 | Ga0157379_10604651 | |||
| 758 | Ga0157379_11373490 | |||
| 759 | Ga0157376_10157556 | |||
| 760 | Ga0157376_10165117 | |||
| 761 | Ga0157376_10563632 | |||
| 762 | Ga0182006_1010206 | |||
| 763 | Ga0182006_1092154 | |||
| 764 | Ga0182007_10000060 | |||
| 765 | Ga0182005_1000421 | |||
| 766 | Ga0163161_10003404 | |||
| 767 | Ga0163161_10144503 | |||
| 768 | Ga0163161_10153076 | |||
| 769 | Ga0163161_10229818 | |||
| 770 | Ga0206354_10119145 | |||
| 771 | Ga0207425_1012369 | |||
| 772 | Ga0209565_1000001 | |||
| 773 | Ga0209565_1000037 | |||
| 774 | Ga0209673_1000001 | |||
| 775 | Ga0209673_1000032 | |||
| 776 | Ga0209673_1013309 | |||
| 777 | Ga0209130_1005313 | |||
| 778 | Ga0209675_1000001 | |||
| 779 | Ga0209675_1000020 | |||
| 780 | Ga0209675_1007097 | |||
| 781 | Ga0209675_1025045 | |||
| 782 | Ga0209676_1000027 | |||
| 783 | Ga0209676_1001321 | |||
| 784 | Ga0209676_1002606 | |||
| 785 | Ga0209676_1002880 | |||
| 786 | Ga0209676_1003992 | |||
| 787 | Ga0209025_1001895 | |||
| 788 | Ga0209025_1003656 | |||
| 789 | Ga0209564_1000001 | |||
| 790 | Ga0209564_1000210 | |||
| 791 | Ga0209050_1001000 | |||
| 792 | Ga0209050_1001322 | |||
| 793 | Ga0209050_1001688 | |||
| 794 | Ga0209050_1020324 | |||
| 795 | Ga0209256_1000006 | |||
| 796 | Ga0209256_1005518 | |||
| 797 | Ga0209256_1006467 | |||
| 798 | Ga0209256_1018437 | |||
| 799 | Ga0209051_1001347 | |||
| 800 | Ga0209051_1002391 | |||
| 801 | Ga0209257_1000086 | |||
| 802 | Ga0209257_1000787 | |||
| 803 | Ga0209257_1002744 | |||
| 804 | Ga0209257_1002831 | |||
| 805 | Ga0209257_1003134 | |||
| 806 | Ga0209257_1004658 | |||
| 807 | Ga0209257_1008390 | |||
| 808 | Ga0209257_1124319 | |||
| 809 | Ga0207656_10021793 | |||
| 810 | Ga0207655_1064832 | |||
| 811 | Ga0207680_10000598 | |||
| 812 | Ga0207647_10002208 | |||
| 813 | Ga0207699_10389201 | |||
| 814 | Ga0207645_10038862 | |||
| 815 | Ga0207705_10037183 | |||
| 816 | Ga0207705_10041202 | |||
| 817 | Ga0207707_10000146 | |||
| 818 | Ga0207707_10053049 | |||
| 819 | Ga0207695_10003607 | |||
| 820 | Ga0207695_10031094 | |||
| 821 | Ga0207695_10063232 | |||
| 822 | Ga0207695_10383888 | |||
| 823 | Ga0207671_10007138 | |||
| 824 | Ga0207663_10123363 | |||
| 825 | Ga0207663_10964753 | |||
| 826 | Ga0207660_10000676 | |||
| 827 | Ga0207660_10001813 | |||
| 828 | Ga0207657_10002836 | |||
| 829 | Ga0207657_10029430 | |||
| 830 | Ga0207657_10041210 | |||
| 831 | Ga0207649_10113639 | |||
| 832 | Ga0207649_10199837 | |||
| 833 | Ga0207652_10000084 | |||
| 834 | Ga0207652_10008959 | |||
| 835 | Ga0207652_10333672 | |||
| 836 | Ga0207681_10127555 | |||
| 837 | Ga0207681_10649266 | |||
| 838 | Ga0207694_10070662 | |||
| 839 | Ga0207694_10594962 | |||
| 840 | Ga0207650_11295193 | |||
| 841 | Ga0207687_10022314 | |||
| 842 | Ga0207687_10341692 | |||
| 843 | Ga0207700_10528283 | |||
| 844 | Ga0207690_10235728 | |||
| 845 | Ga0207706_10133414 | |||
| 846 | Ga0207706_10207804 | |||
| 847 | Ga0207706_10395886 | |||
| 848 | Ga0207686_10029773 | |||
| 849 | Ga0207670_10475966 | |||
| 850 | Ga0207704_10045400 | |||
| 851 | Ga0207704_10842285 | |||
| 852 | Ga0207689_10144046 | |||
| 853 | Ga0207661_10373039 | |||
| 854 | Ga0207661_10698846 | |||
| 855 | Ga0207679_10054898 | |||
| 856 | Ga0207679_10624077 | |||
| 857 | Ga0207667_10007024 | |||
| 858 | Ga0207667_10055758 | |||
| 859 | Ga0207667_10204493 | |||
| 860 | Ga0207667_11325522 | |||
| 861 | Ga0207651_10620468 | |||
| 862 | Ga0207668_11024692 | |||
| 863 | Ga0207640_10001128 | |||
| 864 | Ga0207640_10014621 | |||
| 865 | Ga0207658_10023690 | |||
| 866 | Ga0207658_10390331 | |||
| 867 | Ga0207703_10176324 | |||
| 868 | Ga0207639_10007555 | |||
| 869 | Ga0207678_10020270 | |||
| 870 | Ga0207678_10027074 | |||
| 871 | Ga0207678_10166502 | |||
| 872 | Ga0207678_10183136 | |||
| 873 | Ga0207702_10005423 | |||
| 874 | Ga0207702_10498199 | |||
| 875 | Ga0207641_10367693 | |||
| 876 | Ga0207648_10173825 | |||
| 877 | Ga0207648_10497745 | |||
| 878 | Ga0207676_10038682 | |||
| 879 | Ga0207676_10046848 | |||
| 880 | Ga0207674_10002886 | |||
| 881 | Ga0207674_10046326 | |||
| 882 | Ga0207698_10051344 | |||
| 883 | Ga0207698_10511574 | |||
| 884 | Ga0268266_10000001 | |||
| 885 | Ga0268266_10054421 | |||
| 886 | Ga0268266_10086831 | |||
| 887 | Ga0268266_10446606 | |||
| 888 | Ga0268265_10190399 | |||
| 889 | Ga0268264_10003031 | |||
| 890 | Ga0268264_10077764 | |||
| 891 | Ga0268264_10296646 | |||
| 892 | Ga0316176_1053738 | |||
| 893 | Ga0314311_1109848 | |||
| 894 | Ga0316182_1371761 | |||
| 895 | Ga0307513_10009721 | |||
| 896 | Ga0307513_10106363 | |||
| 897 | Ga0307513_10342646 | |||
| 898 | Ga0307408_100128425 | |||
| 899 | Ga0307408_100637053 | |||
| 900 | Ga0307516_10231023 | |||
| 901 | Ga0307405_10570977 | |||
| 902 | Ga0307405_10602492 | |||
| 903 | Ga0307413_10048178 | |||
| 904 | Ga0307413_10203386 | |||
| 905 | Ga0307413_10872122 | |||
| 906 | Ga0307413_11274197 | |||
| 907 | Ga0307406_10005878 | |||
| 908 | Ga0307407_10236064 | |||
| 909 | Ga0307412_11123344 | |||
| 910 | Ga0307416_100117487 | |||
| 911 | Ga0307416_100124835 | |||
| 912 | Ga0307416_100294936 | |||
| 913 | Ga0307416_100357438 | |||
| 914 | Ga0307414_10050399 | |||
| 915 | Ga0307414_10177091 | |||
| 916 | Ga0307414_10228356 | |||
| 917 | Ga0307414_10253829 | |||
| 918 | Ga0307414_10335657 | |||
| 919 | Ga0307414_10385843 | |||
| 920 | Ga0307414_10416047 | |||
| 921 | Ga0307414_10520523 | |||
| 922 | Ga0307411_10018060 | |||
| 923 | Ga0307411_10516004 | |||
| 924 | Ga0307411_11663912 | |||
| 925 | Ga0307411_11763537 | |||
| 926 | Ga0307415_100367198 | |||
| 927 | Ga0307415_100409390 | |||
| 928 | Ga0373927_0572581 | |||
| 929 | Ga0373933_0603539 | |||
| 930 | Ga0373937_0156456 | |||
| 931 | Ga0373925_0063447 | |||
| 932 | Ga0395905_0242318 | |||
| 933 | Ga0439436_0014434 | |||
| 934 | Ga0439436_0026940 | |||
| 935 | Ga0439439_0012251 | |||
| 936 | Ga0439439_0021225 | |||
| 937 | Ga0439439_0042155 | |||
| 938 | Ga0439465_0008753 | |||
| 939 | Ga0439465_0010904 | |||
| 940 | Ga0439465_0287416 | |||
| 941 | Ga0451789_0966542 | |||
| 942 | Ga0451797_0088711 | |||
| 943 | Ga0451833_1184932 | |||
| 944 | Ga0451837_1457555 | |||
| 945 | Ga0451841_1204927 | |||
| 946 | Ga0451843_1369231 | |||
| 947 | Ga0451853_1403713 | |||
| 948 | Ga0451853_1931247 | |||
| 949 | Ga0439433_0041699 | |||
| 950 | Ga0439432_013875 | |||
| 951 | Ga0439432_063813 | |||
| 952 | Ga0439432_101543 | |||
| 953 | Ga0439432_132878 | |||
| 954 | Ga0439449_0006386 | |||
| 955 | Ga0439449_0109812 | |||
| 956 | Ga0439449_0216024 | |||
| 957 | Ga0439462_0016609 | |||
| 958 | Ga0439434_0025767 | |||
| 959 | Ga0495638_0006777 | |||
| 960 | Ga0495638_0014382 | |||
| 961 | Ga0495638_0056420 | |||
| 962 | Ga0495638_0162900 | |||
| 963 | Ga0495582_0022836 | |||
| 964 | Ga0495616_0072228 | |||
| 965 | Ga0495628_0289744 | |||
| 966 | Ga0495643_0001835 | |||
| 967 | Ga0495643_0333888 | |||
| 968 | Ga0495663_0000485 | |||
| 969 | Ga0495663_0000914 | |||
| 970 | Ga0495665_0304763 | |||
| 971 | Ga0495587_0104875 | |||
| 972 | Ga0495633_0138389 | |||
| 973 | Ga0495625_0105857 | |||
| 974 | Ga0495625_0110158 | |||
| 975 | Ga0495635_0099496 | |||
| 976 | Ga0495658_0025135 | |||
| 977 | Ga0495671_0032292 | |||
| 978 | Ga0495674_1160078 | |||
| 979 | Ga0495672_0001556 | |||
| 980 | Ga0495686_0082597 | |||
| 981 | Ga0496100_0025856 | |||
| 982 | Ga0496104_0000012 | |||
| 983 | Ga0496105_0000032 | |||
| 984 | Ga0496113_0350055 | |||
| 985 | Ga0496114_0930648 | |||
| 986 | Ga0496115_0747285 | |||
| 987 | Ga0496116_0083618 | |||
| 988 | Ga0496116_0084783 | |||
| 989 | Ga0496117_0004764 | |||
| 990 | Ga0496118_0004204 | |||
| 991 | Ga0496118_0004296 | |||
| 992 | Ga0496118_0010793 | |||
| 993 | Ga0496118_0010794 | |||
| 994 | Ga0496121_0044131 | |||
| 995 | Ga0496122_0072047 | |||
| 996 | Ga0496122_0094712 | |||
| 997 | Ga0496122_0116918 | |||
| 998 | Ga0496122_0155091 | |||
| 999 | Ga0496123_0004282 | |||
| 1000 | Ga0496123_0007695 | |||
| 1001 | Ga0496123_0045387 | |||
| 1002 | Ga0496124_0002535 | |||
| 1003 | Ga0496124_0005775 | |||
| 1004 | Ga0496124_0011580 | |||
| 1005 | Ga0496124_0235171 | |||
| 1006 | Ga0496124_0253353 | |||
| 1007 | Ga0496125_0006793 | |||
| 1008 | Ga0496125_0007934 | |||
| 1009 | Ga0496125_0050417 | |||
| 1010 | Ga0496125_0216964 | |||
| 1011 | Ga0496126_0052949 | |||
| 1012 | Ga0496126_0074047 | |||
| 1013 | Ga0496126_0159770 | |||
| 1014 | Ga0501031_0033784 | |||
| 1015 | Ga0501031_0179292 | |||
| 1016 | Ga0501032_0003925 | |||
| 1017 | Ga0501032_0045378 | |||
| 1018 | Ga0501033_0001369 | |||
| 1019 | Ga0501033_0003778 | |||
| 1020 | Ga0501033_0260447 | |||
| 1021 | Ga0501033_0657675 | |||
| 1022 | Ga0501034_0001709 | |||
| 1023 | Ga0501034_0003104 | |||
| 1024 | Ga0501034_0006620 | |||
| 1025 | Ga0501034_0023513 | |||
| 1026 | Ga0501034_0053395 | |||
| 1027 | Ga0501034_0054601 | |||
| 1028 | Ga0501034_0574717 | |||
| 1029 | Ga0501036_0018039 | |||
| 1030 | Ga0501036_0394918 | |||
| 1031 | Ga0501036_0398902 | |||
| 1032 | Ga0501036_0445524 | |||
| 1033 | Ga0501036_0619410 | |||
| 1034 | Ga0501037_0018053 | |||
| 1035 | Ga0501037_0036022 | |||
| 1036 | Ga0501037_0269449 | |||
| 1037 | Ga0501037_0362009 | |||
| 1038 | Ga0501037_0363525 | |||
| 1039 | Ga0501037_0684654 | |||
| 1040 | Ga0501038_0003076 | |||
| 1041 | Ga0501038_0015538 | |||
| 1042 | Ga0501039_0005931 | |||
| 1043 | Ga0501039_0219262 | |||
| 1044 | Ga0501040_0065684 | |||
| 1045 | Ga0501042_0250892 | |||
| 1046 | Ga0501043_0010472 | |||
| 1047 | Ga0501043_0169927 | |||
| 1048 | Ga0501043_0276634 | |||
| 1049 | Ga0501046_0003886 | |||
| 1050 | Ga0501046_0027669 | |||
| 1051 | Ga0501046_0101993 | |||
| 1052 | Ga0501046_0234302 | |||
| 1053 | Ga0501046_0262061 | |||
| 1054 | Ga0501046_0453991 | |||
| 1055 | Ga0501047_0002093 | |||
| 1056 | Ga0501047_0003063 | |||
| 1057 | Ga0501047_0290931 | |||
| 1058 | Ga0501047_0306993 | |||
| 1059 | Ga0501047_0312531 | |||
| 1060 | Ga0501047_0352465 | |||
| 1061 | Ga0501047_1086554 | |||
| 1062 | Ga0501048_0042444 | |||
| 1063 | Ga0501067_0000583 | |||
| 1064 | Ga0501067_0002819 | |||
| 1065 | Ga0501067_0326358 | |||
| 1066 | Ga0501068_0029797 | |||
| 1067 | Ga0501068_0184873 | |||
| 1068 | Ga0501069_0002178 | |||
| 1069 | Ga0501069_0013764 | |||
| 1070 | Ga0501069_0022289 | |||
| 1071 | Ga0501069_0138008 | |||
| 1072 | Ga0501070_0022458 | |||
| 1073 | Ga0501070_0061919 | |||
| 1074 | Ga0501070_0066254 | |||
| 1075 | Ga0501070_0340871 | |||
| 1076 | Ga0501070_0598102 | |||
| 1077 | Ga0501071_0008797 | |||
| 1078 | Ga0501071_0125145 | |||
| 1079 | Ga0501072_0002507 | |||
| 1080 | Ga0501072_0139019 | |||
| 1081 | Ga0501073_0008095 | |||
| 1082 | Ga0501073_0015945 | |||
| 1083 | Ga0501073_0036928 | |||
| 1084 | Ga0501073_0058739 | |||
| 1085 | Ga0501073_0159283 | |||
| 1086 | Ga0501073_0240835 | |||
| 1087 | Ga0501073_0495901 | |||
| 1088 | Ga0501073_0640827 | |||
| 1089 | Ga0501074_0003499 | |||
| 1090 | Ga0501074_0005938 | |||
| 1091 | Ga0501074_0062333 | |||
| 1092 | Ga0501074_0065446 | |||
| 1093 | Ga0501074_0223444 | |||
| 1094 | Ga0501074_0335234 | |||
| 1095 | Ga0501076_0554827 | |||
| 1096 | Ga0501077_0304286 | |||
| 1097 | Ga0501079_0023751 | |||
| 1098 | Ga0501079_0026319 | |||
| 1099 | Ga0501079_0084900 | |||
| 1100 | Ga0501079_0173661 | |||
| 1101 | Ga0501079_0419027 | |||
| 1102 | Ga0501080_0000256 | |||
| 1103 | Ga0501080_0001893 | |||
| 1104 | Ga0501080_0008868 | |||
| 1105 | Ga0501080_0009555 | |||
| 1106 | Ga0501080_0016829 | |||
| 1107 | Ga0501080_0312935 | |||
| 1108 | Ga0501080_0433568 | |||
| 1109 | Ga0501080_0832949 | |||
| 1110 | Ga0501081_0079654 | |||
| 1111 | Ga0501083_0001929 | |||
| 1112 | Ga0501083_0063372 | |||
| 1113 | Ga0501083_0082394 | |||
| 1114 | Ga0501266_009904 | |||
| 1115 | Ga0501035_0019099 | |||
| 1116 | Ga0501035_0084105 | |||
| 1117 | Ga0501035_0084441 | |||
| 1118 | Ga0501035_0118458 | |||
| 1119 | Ga0501035_0290178 | |||
| 1120 | Ga0501035_0739270 | |||
| 1121 | Ga0501044_0003272 | |||
| 1122 | Ga0501044_0014368 | |||
| 1123 | Ga0501044_0014551 | |||
| 1124 | Ga0501044_0045639 | |||
| 1125 | Ga0501044_0051011 | |||
| 1126 | Ga0501044_0076742 | |||
| 1127 | Ga0501044_0100985 | |||
| 1128 | Ga0501044_0111078 | |||
| 1129 | Ga0501044_0114409 | |||
| 1130 | Ga0501044_0186880 | |||
| 1131 | Ga0501045_0029231 | |||
| 1132 | nmdc:mga00v17_72407_c1 | |||
| 1133 | nmdc:mga06z11_15223_c1 | |||
| 1134 | Ga0500556_0284571 | |||
| 1135 | Ga0500568_0001136 | |||
| 1136 | Ga0500624_075777 | |||
| 1137 | Ga0500565_010107 | |||
| 1138 | Ga0501084_0025460 | |||
| 1139 | Ga0501084_0169997 | |||
| 1140 | Ga0501084_0204750 | |||
| 1141 | Ga0501084_0291415 | |||
| 1142 | Ga0501084_0593938 | |||
| 1143 | Ga0501082_0000141 | |||
| 1144 | Ga0501082_0201301 | |||
| 1145 | Ga0501082_0211016 | |||
| 1146 | Ga0501082_0287069 | |||
| 1147 | Ga0530510_0334839 | |||
| 1148 | 2578459691 | |||
| 1149 | 2643818364 | |||
| 1150 | 2643880781 | |||
| 1151 | 2643905312 | |||
| 1152 | 2643914994 | |||
| 1153 | 2643938495 | |||
| 1154 | 2644079147 | |||
| 1155 | 2644530553 | |||
| 1156 | 2644661351 | |||
| 1157 | 2644693923 | |||
| 1158 | 2644699430 | |||
| 1159 | 2842759574 | |||
| 1160 | 2852652946 | |||
| 1161 | 2857444433 | |||
| 1162 | 2919132149 | |||
| 1163 | 2923517424 | |||
| 1164 | 2929199112 | |||
| 1165 | 2939592517 | |||
| 1166 | 2939624844 | |||
| 1167 | 2941477434 | |||
| 1168 | 2974310127 | |||
| 1169 | 2977250861 | |||
| 1170 | 2984514652 | |||
| 1171 | 2987608104 | |||
| 1172 | 2995949929 | |||
| 1173 | 8003015227 | |||
| 1174 | 8021650535 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a4f-assembly1.cif.gz_AI | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) | 0.9792 | 17 | 82 |
| 7a4f-assembly1.cif.gz_AC | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-1 (120-mer) | 0.979 | 17 | 82 |
| 8f25-assembly1.cif.gz_A | cryo-em structure of lumazine synthase nanoparticle linked to vp8* antigen | 0.9691 | 12 | 158 |
| 1hqk-assembly1.cif.gz_A | crystal structure analysis of lumazine synthase from aquifex aeolicus | 0.9678 | 12 | 156 |
| 7a4h-assembly1.cif.gz_BB | aquifex aeolicus lumazine synthase-derived nucleocapsid variant nc-2 (180-mer) | 0.9665 | 17 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FBV7_62_217_3.40.50.960 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.971 | 12 | 156 | 3.40.50.960 |
| 1nqwC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9669 | 12 | 158 | 3.40.50.960 |
| 3mk3100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9648 | 14 | 157 | 3.40.50.960 |
| 4kq6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9394 | 12 | 152 | 3.40.50.960 |
| 2vi5I00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9287 | 17 | 158 | 3.40.50.960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5Z939-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9824 | 18 | 159 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A2E9F1P6-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9819 | 18 | 159 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A8DVC9-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (EC 2.5.1.78) | 0.9812 | 18 | 157 |
GO:0000906
GO:0005737 GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A7Y4ZTM4-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9809 | 12 | 157 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A661MHD8-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) | 0.9807 | 13 | 159 |
GO:0000906
GO:0009231 GO:0009349 |